F372684

General Info

Members Datasets Scaffolds Average Seq Length
264 179 526 55

Family's Representative Sequence

Representative Sequence 3300027360|Ga0209969_1003096|Ga0209969_10030964
Length 64
Sequence MAKNKGTRILITLECTECRSNLNKRSPGVSRYSTQKNRRNNPERLELKKYCPHCNKSTIHKEIK

Samples

Sample ID Description Type Environment
1 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
47 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
87 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
144 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
175 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
176 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
177 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
178 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
179 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.55
Metatranscriptomes 18.18
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.52
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209969_1003096 3300027360 Eukaryota 2299
2 Ga0058859_10002493 3300004798 Bacteria 1319
3 Ga0058863_10042652 3300004799 Bacteria 861
4 Ga0058863_11733352 3300004799 Bacteria 640
5 Ga0058863_11914619 3300004799 Bacteria 969
6 Ga0058860_12051577 3300004801 Bacteria 821
7 Ga0058862_10095289 3300004803 Bacteria 1681
8 Ga0058862_12792987 3300004803 Bacteria 1185
9 Ga0070682_100701420 3300005337 Bacteria 811
10 Ga0070660_100984860 3300005339 Bacteria 712
11 Ga0070692_10366214 3300005345 Bacteria 900
12 Ga0070675_101176080 3300005354 Bacteria 706
13 Ga0070667_101712644 3300005367 Bacteria 591
14 Ga0070709_10000741 3300005434 Bacteria 18462
15 Ga0070709_10022040 3300005434 Bacteria 3720
16 Ga0070714_100113221 3300005435 Bacteria 2405
17 Ga0070714_100672730 3300005435 Bacteria 997
18 Ga0070714_101029401 3300005435 Bacteria 802
19 Ga0070714_101174130 3300005435 Bacteria 749
20 Ga0070713_101208961 3300005436 Bacteria 732
21 Ga0070713_101331555 3300005436 Bacteria 696
22 Ga0070705_100456582 3300005440 Bacteria 960
23 Ga0070708_100273178 3300005445 Bacteria 1590
24 Ga0070708_102083221 3300005445 Bacteria 525
25 Ga0070662_101315106 3300005457 Bacteria 622
26 Ga0070681_10373429 3300005458 Bacteria 1337
27 Ga0070681_11587374 3300005458 Bacteria 580
28 Ga0070706_102016265 3300005467 Bacteria 523
29 Ga0070699_100582540 3300005518 Bacteria 1020
30 Ga0070684_100094759 3300005535 Bacteria 2659
31 Ga0070697_100449049 3300005536 Bacteria 1123
32 Ga0070686_100489437 3300005544 Bacteria 952
33 Ga0070693_100501357 3300005547 Bacteria 861
34 Ga0070664_100531977 3300005564 Bacteria 1086
35 Ga0068856_102007202 3300005614 Bacteria 589
36 Ga0068863_102131904 3300005841 Bacteria 571
37 Ga0070717_12137525 3300006028 Unclassified 503
38 Ga0070715_10683665 3300006163 Unclassified 611
39 Ga0070712_100653275 3300006175 Bacteria 894
40 Ga0070712_100703480 3300006175 Bacteria 862
41 Ga0075428_100779079 3300006844 Bacteria 1017
42 Ga0075431_100164097 3300006847 Bacteria 2284
43 Ga0075434_101875456 3300006871 Bacteria 606
44 Ga0068865_100002530 3300006881 Bacteria 10829
45 Ga0075436_100012426 3300006914 Bacteria 5837
46 Ga0075435_100809491 3300007076 Unclassified 816
47 Ga0105240_10030203 3300009093 Bacteria 7047
48 Ga0114129_11861245 3300009147 Bacteria 730
49 Ga0105241_11562759 3300009174 Bacteria 637
50 Ga0105238_13069200 3300009551 Bacteria 501
51 Ga0157378_13150701 3300013297 Bacteria 512
52 Ga0157375_13610226 3300013308 Bacteria 515
53 Ga0163161_10788827 3300017792 Bacteria 797
54 Ga0197907_10200838 3300020069 Bacteria 558
55 Ga0206356_10188329 3300020070 Bacteria 621
56 Ga0206356_10797823 3300020070 Bacteria 754
57 Ga0206349_1470448 3300020075 Bacteria 1644
58 Ga0206355_1016175 3300020076 Bacteria 1470
59 Ga0206355_1506783 3300020076 Bacteria 1153
60 Ga0206351_10149984 3300020077 Unclassified 516
61 Ga0206352_10338683 3300020078 Bacteria 672
62 Ga0206352_10570943 3300020078 Bacteria 535
63 Ga0206352_10983690 3300020078 Bacteria 829
64 Ga0206352_11144201 3300020078 Bacteria 1832
65 Ga0206350_10891108 3300020080 Bacteria 1426
66 Ga0206350_10982794 3300020080 Bacteria 2271
67 Ga0206350_11038564 3300020080 Bacteria 591
68 Ga0206354_10678818 3300020081 Bacteria 798
69 Ga0206353_11765665 3300020082 Bacteria 712
70 Ga0154015_1084455 3300020610 Bacteria 646
71 Ga0154015_1689929 3300020610 Bacteria 558
72 Ga0224712_10028106 3300022467 Bacteria 2007
73 Ga0224712_10667706 3300022467 Bacteria 510
74 Ga0207688_10869472 3300025901 Bacteria 571
75 Ga0207695_10762732 3300025913 Bacteria 848
76 Ga0207664_10863871 3300025929 Bacteria 813
77 Ga0207664_11362647 3300025929 Bacteria 630
78 Ga0207664_11638750 3300025929 Bacteria 565
79 Ga0207704_10005036 3300025938 Bacteria 6078
80 Ga0207665_10061064 3300025939 Bacteria 2554
81 Ga0207702_10163711 3300026078 Bacteria 2033
82 Ga0209984_1027242 3300027424 Eukaryota 800
83 Ga0209998_10001510 3300027717 Bacteria 5592
84 Ga0209974_10073110 3300027876 Eukaryota 1172
85 Ga0265319_1047986 3300028563 Bacteria 1419
86 Ga0265318_10000706 3300028577 Bacteria 22445
87 Ga0265330_10000240 3300031235 Bacteria 41294
88 Ga0265332_10000118 3300031238 Bacteria 67370
89 Ga0265328_10011696 3300031239 Bacteria 3502
90 Ga0265320_10001584 3300031240 Bacteria 16342
91 Ga0265331_10000984 3300031250 Bacteria 22445
92 Ga0265327_10018681 3300031251 Bacteria 4288
93 Ga0265316_10005482 3300031344 Bacteria 12316
94 Ga0265316_10265935 3300031344 Bacteria 1256
95 Ga0307408_100170595 3300031548 Bacteria 1737
96 Ga0265313_10001417 3300031595 Bacteria 22445
97 Ga0265313_10054302 3300031595 Bacteria 1903
98 Ga0316575_10026808 3300031665 Bacteria 2240
99 Ga0316579_10026699 3300031691 Bacteria 2616
100 Ga0265314_10001816 3300031711 Bacteria 23009
101 Ga0265342_10049667 3300031712 Bacteria 2509
102 Ga0316576_10118374 3300031727 Bacteria 1988
103 Ga0316576_10181907 3300031727 Bacteria 1586
104 Ga0316576_10864238 3300031727 Eukaryota 649
105 Ga0316578_10183051 3300031728 Bacteria 1263
106 Ga0316578_10316312 3300031728 Bacteria 932
107 Ga0316577_10024348 3300031733 Bacteria 3365
108 Ga0307412_10713855 3300031911 Bacteria 862
109 Ga0307416_101009053 3300032002 Bacteria 935
110 Ga0307411_11563960 3300032005 Bacteria 608
111 Ga0307415_100394872 3300032126 Eukaryota 1179
112 Ga0316583_10323912 3300032133 Bacteria 533
113 Ga0316580_10054174 3300032139 Bacteria 1235
114 Ga0316593_10002635 3300032168 Bacteria 4302
115 Ga0316593_10029783 3300032168 Bacteria 1768
116 Ga0316592_1001374 3300033524 Bacteria 3888
117 Ga0316592_1001923 3300033524 Bacteria 3495
118 Ga0316592_1035294 3300033524 Bacteria 1097
119 Ga0316592_1115114 3300033524 Bacteria 623
120 Ga0316586_1004198 3300033527 Bacteria 1950
121 Ga0316588_1193365 3300033528 Bacteria 531
122 Ga0316588_1199892 3300033528 Bacteria 522
123 Ga0316596_1026606 3300033541 Bacteria 1492
124 Ga0316596_1096406 3300033541 Bacteria 798
125 Ga0373936_0089158 3300035113 Bacteria 1292
126 Ga0373945_0228462 3300035116 Bacteria 780
127 Ga0373953_0298565 3300035117 Bacteria 703
128 Ga0373943_0053792 3300035170 Bacteria 1989
129 Ga0373943_0444071 3300035170 Bacteria 753
130 Ga0373946_0179440 3300035171 Bacteria 1004
131 Ga0373955_0084335 3300035172 Bacteria 1801
132 Ga0373955_0213173 3300035172 Bacteria 1152
133 Ga0373961_0185877 3300035241 Bacteria 726
134 Ga0316574_0078427 3300035398 Bacteria 2094
135 Ga0316574_0168175 3300035398 Bacteria 1412
136 Ga0316574_0960798 3300035398 Bacteria 515
137 Ga0373935_0608001 3300035692 Bacteria 800
138 Ga0373927_0402422 3300035695 Bacteria 903
139 Ga0373933_0398750 3300035724 Bacteria 897
140 Ga0373947_0105811 3300035725 Bacteria 1773
141 Ga0373947_0145176 3300035725 Bacteria 1525
142 Ga0373937_0347766 3300036401 Bacteria 1404
143 Ga0373925_0014724 3300037068 Bacteria 5650
144 Ga0400483_026186 3300039062 Eukaryota 1344
145 Ga0400487_03567 3300039110 Eukaryota 56162
146 Ga0436365_0874407 3300039437 Bacteria 589
147 Ga0436365_1162125 3300039437 Bacteria 577
148 Ga0436365_1896642 3300039437 Unclassified 732
149 Ga0436361_1210722 3300039447 Bacteria 2015
150 Ga0451791_0058943 3300041451 Bacteria 641
151 Ga0451843_1598143 3300041509 Bacteria 762
152 Ga0451577_0000255 3300042876 Bacteria 105353
153 Ga0451577_0036920 3300042876 Bacteria 4399
154 Ga0451577_0188151 3300042876 Bacteria 1862
155 Ga0451577_0367440 3300042876 Bacteria 1305
156 Ga0451577_0370908 3300042876 Bacteria 1298
157 Ga0451577_0567186 3300042876 Bacteria 1030
158 Ga0451577_0669196 3300042876 Bacteria 941
159 Ga0451577_1398942 3300042876 Bacteria 620
160 Ga0451577_1699018 3300042876 Bacteria 555
161 Ga0453683_0069713 3300044673 Bacteria 2198
162 Ga0453683_0260209 3300044673 Bacteria 1107
163 Ga0453683_0541113 3300044673 Bacteria 757
164 Ga0453683_0752845 3300044673 Bacteria 640
165 Ga0453683_0840450 3300044673 Bacteria 605
166 Ga0466965_0476267 3300044683 Bacteria 698
167 Ga0466964_0761814 3300044706 Bacteria 544
168 Ga0453684_0000024 3300044712 Bacteria 819351
169 Ga0453684_0000640 3300044712 Bacteria 126342
170 Ga0453684_0016312 3300044712 Bacteria 11631
171 Ga0453684_0024636 3300044712 Bacteria 8780
172 Ga0453684_0035642 3300044712 Eukaryota 6875
173 Ga0453684_0042774 3300044712 Bacteria 6100
174 Ga0453684_0063103 3300044712 Bacteria 4742
175 Ga0453684_0140794 3300044712 Bacteria 2881
176 Ga0453684_0163504 3300044712 Bacteria 2630
177 Ga0453684_0184458 3300044712 Bacteria 2447
178 Ga0453684_0224971 3300044712 Bacteria 2170
179 Ga0453684_0244698 3300044712 Bacteria 2063
180 Ga0453684_0451101 3300044712 Bacteria 1431
181 Ga0453684_0565737 3300044712 Bacteria 1250
182 Ga0453684_0925877 3300044712 Bacteria 932
183 Ga0453684_1040358 3300044712 Bacteria 868
184 Ga0453684_1111253 3300044712 Bacteria 834
185 Ga0453684_1242645 3300044712 Bacteria 780
186 Ga0453684_1268077 3300044712 Bacteria 770
187 Ga0453684_1835129 3300044712 Bacteria 615
188 Ga0453684_1920423 3300044712 Unclassified 598
189 Ga0451576_0001224 3300045051 Bacteria 45523
190 Ga0451576_0005777 3300045051 Bacteria 15393
191 Ga0451576_0020385 3300045051 Eukaryota 7222
192 Ga0451576_0461021 3300045051 Bacteria 1334
193 Ga0451576_1818587 3300045051 Bacteria 629
194 Ga0451576_1877840 3300045051 Bacteria 618
195 Ga0466967_0502314 3300045976 Bacteria 1190
196 Ga0495592_0291185 3300046454 Bacteria 1064
197 Ga0495662_0037535 3300046476 Bacteria 2340
198 Ga0495664_0327632 3300046477 Bacteria 923
199 Ga0495618_0090381 3300046514 Bacteria 1958
200 Ga0495628_0624474 3300046516 Bacteria 767
201 Ga0495640_0064663 3300046533 Bacteria 2472
202 Ga0495586_0904792 3300046535 Bacteria 508
203 Ga0495587_0344222 3300046536 Bacteria 831
204 Ga0495645_0249769 3300046543 Bacteria 1179
205 Ga0495667_0411097 3300046559 Bacteria 852
206 Ga0495635_0093700 3300046663 Bacteria 2054
207 Ga0495599_0861204 3300046678 Bacteria 515
208 Ga0495623_0348437 3300046679 Bacteria 807
209 Ga0495646_0385875 3300046680 Bacteria 730
210 Ga0495624_0251946 3300046690 Bacteria 1068
211 Ga0495604_0637168 3300047317 Bacteria 681
212 Ga0495636_0020876 3300047318 Bacteria 2641
213 Ga0495674_0016775 3300047319 Bacteria 6832
214 Ga0495684_0295010 3300047471 Bacteria 1166
215 Ga0496103_0552438 3300048906 Bacteria 735
216 Ga0496104_1287674 3300048907 Bacteria 634
217 Ga0496108_1141266 3300048911 Bacteria 661
218 Ga0501306_052777 3300049127 Bacteria 655
219 Ga0501306_095011 3300049127 Bacteria 528
220 Ga0501310_079340 3300049130 Bacteria 513
221 Ga0501292_063781 3300049515 Bacteria 673
222 Ga0501315_088759 3300049531 Bacteria 533
223 Ga0501317_089049 3300049533 Bacteria 544
224 Ga0501320_018620 3300049536 Bacteria 786
225 Ga0501325_042921 3300049541 Bacteria 555
226 Ga0501031_0331237 3300049568 Bacteria 986
227 Ga0501032_0344827 3300049569 Bacteria 960
228 Ga0501034_0043527 3300049571 Bacteria 4544
229 Ga0501034_0682178 3300049571 Bacteria 927
230 Ga0501039_0285796 3300049575 Bacteria 1297
231 Ga0501039_0945529 3300049575 Bacteria 670
232 Ga0501041_1060510 3300049577 Bacteria 522
233 Ga0501043_0697793 3300049579 Bacteria 742
234 Ga0501047_0376361 3300049581 Bacteria 1255
235 Ga0501047_0566105 3300049581 Bacteria 960
236 Ga0501067_0036095 3300049583 Bacteria 2745
237 Ga0501068_0011815 3300049584 Bacteria 4937
238 Ga0501069_0166146 3300049585 Bacteria 1272
239 Ga0501070_0411320 3300049586 Bacteria 1093
240 Ga0501070_1184167 3300049586 Bacteria 587
241 Ga0501080_1622309 3300049742 Bacteria 547
242 Ga0501081_1199957 3300049743 Bacteria 575
243 Ga0501083_0735917 3300049744 Bacteria 641
244 Ga0501044_0132402 3300049823 Bacteria 2487
245 Ga0501044_0236966 3300049823 Bacteria 1770
246 nmdc:mga05p37_658410_c1 3300050507 Bacteria 1171
247 nmdc:mga06r32_110238_c1 3300050510 Bacteria 2707
248 nmdc:mga0rr50_901721_c1 3300050513 Unclassified 754
249 nmdc:mga08x19_42443_c1 3300050514 Bacteria 2900
250 Ga0495601_0139521 3300053077 Bacteria 1581
251 Ga0495612_0189803 3300053078 Bacteria 904
252 Ga0495619_1098509 3300053085 Bacteria 529
253 Ga0587083_0024416 3300059505 Bacteria 1150
254 Ga0587088_017798 3300059508 Bacteria 1149
255 Ga0587069_050423 3300059642 Bacteria 739
256 Ga0530510_0053431 3300061734 Bacteria 2919
257 Ga0530510_0270662 3300061734 Bacteria 1268
258 2676489673 2675903060 Bacteria 10051191
259 2873314736 2873314349 Bacteria 8512634
260 2884694528 2884693830 Bacteria 11273186
261 2895432998 2895427314 Bacteria 13147766
262 2895444432 2895442618 Bacteria 11027144
263 8055178718 8055172936 Bacteria 9305943
264 Ga0209969_1003096
265 Ga0058859_10002493
266 Ga0058863_10042652
267 Ga0058863_11733352
268 Ga0058863_11914619
269 Ga0058860_12051577
270 Ga0058862_10095289
271 Ga0058862_12792987
272 Ga0070682_100701420
273 Ga0070660_100984860
274 Ga0070692_10366214
275 Ga0070675_101176080
276 Ga0070667_101712644
277 Ga0070709_10000741
278 Ga0070709_10022040
279 Ga0070714_100113221
280 Ga0070714_100672730
281 Ga0070714_101029401
282 Ga0070714_101174130
283 Ga0070713_101208961
284 Ga0070713_101331555
285 Ga0070705_100456582
286 Ga0070708_100273178
287 Ga0070708_102083221
288 Ga0070662_101315106
289 Ga0070681_10373429
290 Ga0070681_11587374
291 Ga0070706_102016265
292 Ga0070699_100582540
293 Ga0070684_100094759
294 Ga0070697_100449049
295 Ga0070686_100489437
296 Ga0070693_100501357
297 Ga0070664_100531977
298 Ga0068856_102007202
299 Ga0068863_102131904
300 Ga0070717_12137525
301 Ga0070715_10683665
302 Ga0070712_100653275
303 Ga0070712_100703480
304 Ga0075428_100779079
305 Ga0075431_100164097
306 Ga0075434_101875456
307 Ga0068865_100002530
308 Ga0075436_100012426
309 Ga0075435_100809491
310 Ga0105240_10030203
311 Ga0114129_11861245
312 Ga0105241_11562759
313 Ga0105238_13069200
314 Ga0157378_13150701
315 Ga0157375_13610226
316 Ga0163161_10788827
317 Ga0197907_10200838
318 Ga0206356_10188329
319 Ga0206356_10797823
320 Ga0206349_1470448
321 Ga0206355_1016175
322 Ga0206355_1506783
323 Ga0206351_10149984
324 Ga0206352_10338683
325 Ga0206352_10570943
326 Ga0206352_10983690
327 Ga0206352_11144201
328 Ga0206350_10891108
329 Ga0206350_10982794
330 Ga0206350_11038564
331 Ga0206354_10678818
332 Ga0206353_11765665
333 Ga0154015_1084455
334 Ga0154015_1689929
335 Ga0224712_10028106
336 Ga0224712_10667706
337 Ga0207688_10869472
338 Ga0207695_10762732
339 Ga0207664_10863871
340 Ga0207664_11362647
341 Ga0207664_11638750
342 Ga0207704_10005036
343 Ga0207665_10061064
344 Ga0207702_10163711
345 Ga0209984_1027242
346 Ga0209998_10001510
347 Ga0209974_10073110
348 Ga0265319_1047986
349 Ga0265318_10000706
350 Ga0265330_10000240
351 Ga0265332_10000118
352 Ga0265328_10011696
353 Ga0265320_10001584
354 Ga0265331_10000984
355 Ga0265327_10018681
356 Ga0265316_10005482
357 Ga0265316_10265935
358 Ga0307408_100170595
359 Ga0265313_10001417
360 Ga0265313_10054302
361 Ga0316575_10026808
362 Ga0316579_10026699
363 Ga0265314_10001816
364 Ga0265342_10049667
365 Ga0316576_10118374
366 Ga0316576_10181907
367 Ga0316576_10864238
368 Ga0316578_10183051
369 Ga0316578_10316312
370 Ga0316577_10024348
371 Ga0307412_10713855
372 Ga0307416_101009053
373 Ga0307411_11563960
374 Ga0307415_100394872
375 Ga0316583_10323912
376 Ga0316580_10054174
377 Ga0316593_10002635
378 Ga0316593_10029783
379 Ga0316592_1001374
380 Ga0316592_1001923
381 Ga0316592_1035294
382 Ga0316592_1115114
383 Ga0316586_1004198
384 Ga0316588_1193365
385 Ga0316588_1199892
386 Ga0316596_1026606
387 Ga0316596_1096406
388 Ga0373936_0089158
389 Ga0373945_0228462
390 Ga0373953_0298565
391 Ga0373943_0053792
392 Ga0373943_0444071
393 Ga0373946_0179440
394 Ga0373955_0084335
395 Ga0373955_0213173
396 Ga0373961_0185877
397 Ga0316574_0078427
398 Ga0316574_0168175
399 Ga0316574_0960798
400 Ga0373935_0608001
401 Ga0373927_0402422
402 Ga0373933_0398750
403 Ga0373947_0105811
404 Ga0373947_0145176
405 Ga0373937_0347766
406 Ga0373925_0014724
407 Ga0400483_026186
408 Ga0400487_03567
409 Ga0436365_0874407
410 Ga0436365_1162125
411 Ga0436365_1896642
412 Ga0436361_1210722
413 Ga0451791_0058943
414 Ga0451843_1598143
415 Ga0451577_0000255
416 Ga0451577_0036920
417 Ga0451577_0188151
418 Ga0451577_0367440
419 Ga0451577_0370908
420 Ga0451577_0567186
421 Ga0451577_0669196
422 Ga0451577_1398942
423 Ga0451577_1699018
424 Ga0453683_0069713
425 Ga0453683_0260209
426 Ga0453683_0541113
427 Ga0453683_0752845
428 Ga0453683_0840450
429 Ga0466965_0476267
430 Ga0466964_0761814
431 Ga0453684_0000024
432 Ga0453684_0000640
433 Ga0453684_0016312
434 Ga0453684_0024636
435 Ga0453684_0035642
436 Ga0453684_0042774
437 Ga0453684_0063103
438 Ga0453684_0140794
439 Ga0453684_0163504
440 Ga0453684_0184458
441 Ga0453684_0224971
442 Ga0453684_0244698
443 Ga0453684_0451101
444 Ga0453684_0565737
445 Ga0453684_0925877
446 Ga0453684_1040358
447 Ga0453684_1111253
448 Ga0453684_1242645
449 Ga0453684_1268077
450 Ga0453684_1835129
451 Ga0453684_1920423
452 Ga0451576_0001224
453 Ga0451576_0005777
454 Ga0451576_0020385
455 Ga0451576_0461021
456 Ga0451576_1818587
457 Ga0451576_1877840
458 Ga0466967_0502314
459 Ga0495592_0291185
460 Ga0495662_0037535
461 Ga0495664_0327632
462 Ga0495618_0090381
463 Ga0495628_0624474
464 Ga0495640_0064663
465 Ga0495586_0904792
466 Ga0495587_0344222
467 Ga0495645_0249769
468 Ga0495667_0411097
469 Ga0495635_0093700
470 Ga0495599_0861204
471 Ga0495623_0348437
472 Ga0495646_0385875
473 Ga0495624_0251946
474 Ga0495604_0637168
475 Ga0495636_0020876
476 Ga0495674_0016775
477 Ga0495684_0295010
478 Ga0496103_0552438
479 Ga0496104_1287674
480 Ga0496108_1141266
481 Ga0501306_052777
482 Ga0501306_095011
483 Ga0501310_079340
484 Ga0501292_063781
485 Ga0501315_088759
486 Ga0501317_089049
487 Ga0501320_018620
488 Ga0501325_042921
489 Ga0501031_0331237
490 Ga0501032_0344827
491 Ga0501034_0043527
492 Ga0501034_0682178
493 Ga0501039_0285796
494 Ga0501039_0945529
495 Ga0501041_1060510
496 Ga0501043_0697793
497 Ga0501047_0376361
498 Ga0501047_0566105
499 Ga0501067_0036095
500 Ga0501068_0011815
501 Ga0501069_0166146
502 Ga0501070_0411320
503 Ga0501070_1184167
504 Ga0501080_1622309
505 Ga0501081_1199957
506 Ga0501083_0735917
507 Ga0501044_0132402
508 Ga0501044_0236966
509 nmdc:mga05p37_658410_c1
510 nmdc:mga06r32_110238_c1
511 nmdc:mga0rr50_901721_c1
512 nmdc:mga08x19_42443_c1
513 Ga0495601_0139521
514 Ga0495612_0189803
515 Ga0495619_1098509
516 Ga0587083_0024416
517 Ga0587088_017798
518 Ga0587069_050423
519 Ga0530510_0053431
520 Ga0530510_0270662
521 2676489673
522 2873314736
523 2884694528
524 2895432998
525 2895444432
526 8055178718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00471

Ribosomal_L33

Ribosomal protein L33

9

64

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a5j-assembly1.cif.gz_1 structure of the split human mitoribosomal large subunit with p-and e-site mt-trnas 0.8832 11 56
6gaw-assembly1.cif.gz_B6 unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the complete 55s ribosome. 0.8785 9 56
7qh7-assembly1.cif.gz_1 cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 4 0.8769 11 56
7nql-assembly1.cif.gz_B6 55s mammalian mitochondrial ribosome with ict1 and p site trnamet 0.8746 11 56
7oie-assembly1.cif.gz_1 cryo-em structure of late human 39s mitoribosome assembly intermediates, state 5b 0.8711 11 56
ID Description Score Start End Superfamily
af_Q9W4L1_1_64_2.20.28.120 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8963 9 56 2.20.28.120
5oom100 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8856 11 56 2.20.28.120
1vw4X00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8807 9 56 2.20.28.120
af_D4ABL7_1_65_2.20.28.120 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8789 11 56 2.20.28.120
4v19600 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.8099 10 56 2.20.28.120
ID Description Score Start End GO Terms
AF-A0A6P6I4R7-F1-model_v4 Large ribosomal subunit protein bL33m (39S ribosomal protein L33, mitochondrial) 0.8783 11 56 GO:0003735
GO:0005739
GO:0005840
GO:0006412
GO:0016020
GO:1990904
AF-A0A3M1ZZF2-F1-model_v4 Large ribosomal subunit protein bL33 0.8772 8 56 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A445CRW3-F1-model_v4 50S ribosomal protein L33, chloroplastic 0.8726 10 56 GO:0003735
GO:0005737
GO:0006412
GO:0015934
AF-A0A1C3K918-F1-model_v4 Large ribosomal subunit protein bL33 (50S ribosomal protein L33) 0.8701 10 56 GO:0003735
GO:0006412
GO:0022625
AF-A0A1F6EZ81-F1-model_v4 Large ribosomal subunit protein bL33 0.8699 11 56 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904

Map