F371974

General Info

Members Datasets Scaffolds Average Seq Length
263 178 240 351

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100122668|Ga0307408_1001226682
Length 400
Sequence VSLIQTLIRTGPAEKLQLLQKRSSYYKEVSNLSSQAQASPALLGVGILGAGPVTQAIHLPSLARLGNILEVRHIMDVDPAVAEAVAGRVGANFSTSMEELLADPAVDIVAICSPHQFHAAQVIASCRAGKKAVLCEKPFAMSGEEAAGISAVSAETGVPIIVGAMHTFDPGWLAAEDAWGDLPEQVHTVRSSIVLPPNPRFEDFATEIVGRVPLPGSDTSDPKVIKAMLTGGVMGLAIHDLPLVRRFTPDFESVEVLHAEIVRPFGYVISLRAGSVTIELRAAMNATWEPSWEFEAIGNDAALRIDFTPSYVHAGSATARILSEGRTTVLGPFGHNGYEGEWRKLAELASGTGQPPSAETLIHDLEFALAIADAAAGRIDANPVDAGSAASSPADQEVNA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221597 Microbacterium sp. Root180 Isolate Unclassified
4 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
5 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
6 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
7 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
8 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
9 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
10 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
11 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
12 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
13 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
14 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
15 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
16 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
17 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
18 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
19 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
20 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
21 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
22 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
23 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
24 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
25 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
164 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
165 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
166 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
167 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
168 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
172 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
173 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
174 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
175 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
176 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
177 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.11
Metatranscriptomes 1.14
Isolates 8.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.27
Nodule 0
Rhizoplane 11.03
Rhizosphere 61.22
Stem 0
Stem Tuber 0
Unclassified 17.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3682158 2162886007 Bacteria 1765
2 LJQas_1000181 3300000549 Bacteria 11327
3 JGI25152J39213_1000210 3300002773 Bacteria 39512
4 Ga0065704_10000277 3300005289 Bacteria 104842
5 Ga0065704_10090984 3300005289 Bacteria 2749
6 Ga0065704_10164691 3300005289 Bacteria 1330
7 Ga0065707_10004227 3300005295 Bacteria 3751
8 Ga0070668_100001642 3300005347 Bacteria 16213
9 Ga0070668_100105447 3300005347 Bacteria 2238
10 Ga0070669_100000039 3300005353 Bacteria 135033
11 Ga0070669_100002282 3300005353 Bacteria 13908
12 Ga0070671_100001097 3300005355 Bacteria 20070
13 Ga0070667_100001038 3300005367 Bacteria 25387
14 Ga0070665_100000271 3300005548 Bacteria 84713
15 Ga0070665_100007128 3300005548 Bacteria 11368
16 Ga0068859_100499158 3300005617 Bacteria 1312
17 Ga0068863_100012597 3300005841 Bacteria 8156
18 Ga0068858_100079929 3300005842 Bacteria 3038
19 Ga0068860_100006402 3300005843 Bacteria 11820
20 Ga0068860_100054108 3300005843 Bacteria 3815
21 Ga0075432_10000816 3300006058 Bacteria 9758
22 Ga0075432_10005154 3300006058 Bacteria 4452
23 Ga0075367_10001018 3300006178 Bacteria 11517
24 Ga0075370_10168960 3300006353 Bacteria 1285
25 Ga0097620_100499103 3300006931 Bacteria 1312
26 Ga0105251_10001939 3300009011 Bacteria 16942
27 Ga0105251_10002411 3300009011 Bacteria 14753
28 Ga0105244_10053544 3300009036 Bacteria 2050
29 Ga0105250_10007398 3300009092 Bacteria 4722
30 Ga0105243_10008787 3300009148 Bacteria 7736
31 Ga0105248_10003008 3300009177 Bacteria 18705
32 Ga0105238_10195071 3300009551 Bacteria 2001
33 Ga0105249_10064338 3300009553 Bacteria 3372
34 Ga0105148_100055 3300009978 Bacteria 17717
35 Ga0105246_10002033 3300011119 Bacteria 12207
36 Ga0105246_10042974 3300011119 Bacteria 3064
37 Ga0157369_10058749 3300013105 Bacteria 4148
38 Ga0157369_10119968 3300013105 Bacteria 2790
39 Ga0157369_10157319 3300013105 Bacteria 2400
40 Ga0157369_10263467 3300013105 Bacteria 1797
41 Ga0157374_10158341 3300013296 Bacteria 2205
42 Ga0157374_10492341 3300013296 Bacteria 1230
43 Ga0163162_10000601 3300013306 Bacteria 33304
44 Ga0163162_10146180 3300013306 Bacteria 2480
45 Ga0157380_10190555 3300014326 Bacteria 1810
46 Ga0163161_10003843 3300017792 Bacteria 10528
47 Ga0206353_11122844 3300020082 Bacteria 3558
48 Ga0207425_1009728 3300025245 Bacteria 2377
49 Ga0209148_1004581 3300025254 Bacteria 3365
50 Ga0209129_1000159 3300025258 Bacteria 103426
51 Ga0209025_1000211 3300025294 Bacteria 139109
52 Ga0207696_1001506 3300025711 Bacteria 12516
53 Ga0207655_1057401 3300025728 Bacteria 1529
54 Ga0207713_1001395 3300025735 Bacteria 19537
55 Ga0207681_10000111 3300025923 Bacteria 68734
56 Ga0207681_10000667 3300025923 Bacteria 22714
57 Ga0207644_10079213 3300025931 Bacteria 2423
58 Ga0207709_10006781 3300025935 Bacteria 6409
59 Ga0207711_10007681 3300025941 Bacteria 9016
60 Ga0207711_10176238 3300025941 Bacteria 1942
61 Ga0207712_10125884 3300025961 Bacteria 1945
62 Ga0207668_10001069 3300025972 Bacteria 16349
63 Ga0207668_10035879 3300025972 Bacteria 3306
64 Ga0207658_10000467 3300025986 Bacteria 37722
65 Ga0207658_10409669 3300025986 Unclassified 1193
66 Ga0207678_10239555 3300026067 Bacteria 1554
67 Ga0207641_10003802 3300026088 Bacteria 13246
68 Ga0268266_10000212 3300028379 Bacteria 101029
69 Ga0268266_10005844 3300028379 Bacteria 11384
70 Ga0268265_10076388 3300028380 Bacteria 2627
71 Ga0268264_10011036 3300028381 Bacteria 7459
72 Ga0268264_10018888 3300028381 Bacteria 5635
73 Ga0307515_10009304 3300028794 Bacteria 19008
74 Ga0307515_10077929 3300028794 Bacteria 4368
75 Ga0307512_10016949 3300030522 Bacteria 6708
76 Ga0307513_10004547 3300031456 Bacteria 18508
77 Ga0307513_10011039 3300031456 Bacteria 11267
78 Ga0307509_10211093 3300031507 Bacteria 1766
79 Ga0307408_100005282 3300031548 Bacteria 8654
80 Ga0307408_100063424 3300031548 Bacteria 2703
81 Ga0307408_100122668 3300031548 Bacteria 2015
82 Ga0307508_10002171 3300031616 Bacteria 21014
83 Ga0307508_10019488 3300031616 Bacteria 6167
84 Ga0307516_10001035 3300031730 Bacteria 38669
85 Ga0307405_10001558 3300031731 Bacteria 9722
86 Ga0307405_10248053 3300031731 Bacteria 1323
87 Ga0307413_10024033 3300031824 Bacteria 3314
88 Ga0307413_10046244 3300031824 Bacteria 2586
89 Ga0307413_10171504 3300031824 Bacteria 1536
90 Ga0307410_10001505 3300031852 Bacteria 10581
91 Ga0307410_10026085 3300031852 Bacteria 3674
92 Ga0307410_10116769 3300031852 Bacteria 1939
93 Ga0307410_10205777 3300031852 Bacteria 1505
94 Ga0307406_10000043 3300031901 Bacteria 71775
95 Ga0307406_10252959 3300031901 Bacteria 1328
96 Ga0307407_10005730 3300031903 Bacteria 5427
97 Ga0307407_10013191 3300031903 Bacteria 4000
98 Ga0307407_10029039 3300031903 Bacteria 2965
99 Ga0307409_100154156 3300031995 Bacteria 1999
100 Ga0307416_100006680 3300032002 Bacteria 7239
101 Ga0307416_100007086 3300032002 Bacteria 7083
102 Ga0307416_100054199 3300032002 Bacteria 3222
103 Ga0307416_100399075 3300032002 Bacteria 1412
104 Ga0307414_10023703 3300032004 Bacteria 3898
105 Ga0307414_10083259 3300032004 Bacteria 2349
106 Ga0307414_10279045 3300032004 Bacteria 1403
107 Ga0307415_100084915 3300032126 Bacteria 2273
108 Ga0307415_100137708 3300032126 Bacteria 1859
109 Ga0307510_10148288 3300033180 Bacteria 1972
110 Ga0395899_0013305 3300037312 Bacteria 6295
111 Ga0395899_0022857 3300037312 Bacteria 4738
112 Ga0395900_0055179 3300037418 Bacteria 4091
113 Ga0395900_0107083 3300037418 Bacteria 2872
114 Ga0395900_0185675 3300037418 Bacteria 2111
115 Ga0395900_0375872 3300037418 Bacteria 1390
116 Ga0395898_0018255 3300037466 Bacteria 7153
117 Ga0395898_0038940 3300037466 Bacteria 4708
118 Ga0395898_0148928 3300037466 Bacteria 2240
119 Ga0395898_0218196 3300037466 Bacteria 1819
120 Ga0395905_0007201 3300037471 Bacteria 11102
121 Ga0395901_0003088 3300038443 Bacteria 16763
122 Ga0395901_0043774 3300038443 Bacteria 4643
123 Ga0395901_0195029 3300038443 Bacteria 2124
124 Ga0395901_0269475 3300038443 Bacteria 1771
125 Ga0436361_0266036 3300039447 Unclassified 2116
126 Ga0466965_0074344 3300044683 Bacteria 1712
127 Ga0495627_000110 3300046453 Bacteria 101742
128 Ga0495603_0145319 3300046455 Bacteria 1379
129 Ga0495629_0111539 3300046459 Bacteria 1907
130 Ga0495629_0127408 3300046459 Bacteria 1774
131 Ga0495638_0000074 3300046460 Bacteria 163843
132 Ga0495580_0015572 3300046472 Bacteria 5731
133 Ga0495582_0031632 3300046473 Bacteria 2909
134 Ga0495639_0007378 3300046475 Bacteria 4720
135 Ga0495584_0077424 3300046491 Bacteria 1673
136 Ga0495583_0001281 3300046506 Bacteria 26270
137 Ga0495583_0002135 3300046506 Bacteria 17683
138 Ga0495616_0043409 3300046513 Bacteria 2284
139 Ga0495632_0003841 3300046519 Bacteria 10449
140 Ga0495632_0004071 3300046519 Bacteria 10094
141 Ga0495637_0027144 3300046520 Bacteria 2564
142 Ga0495643_0012587 3300046522 Bacteria 5097
143 Ga0495648_0000050 3300046524 Bacteria 163843
144 Ga0495663_0000012 3300046525 Bacteria 157546
145 Ga0495597_0007420 3300046542 Bacteria 5570
146 Ga0495633_0001020 3300046558 Bacteria 22941
147 Ga0495633_0008940 3300046558 Bacteria 5582
148 Ga0495625_0079350 3300046660 Bacteria 2289
149 Ga0495670_0068369 3300046691 Bacteria 1795
150 Ga0495671_0003234 3300046692 Bacteria 10112
151 Ga0495671_0010597 3300046692 Bacteria 5097
152 Ga0495581_0000566 3300047315 Bacteria 19224
153 Ga0495683_0065433 3300047323 Bacteria 1793
154 Ga0495673_0000157 3300047469 Bacteria 117733
155 Ga0495681_0002285 3300047470 Bacteria 13781
156 Ga0495593_0016265 3300047673 Bacteria 4199
157 Ga0495615_0000014 3300048090 Bacteria 60447
158 Ga0496100_0000953 3300048903 Bacteria 13857
159 Ga0496100_0086591 3300048903 Bacteria 2128
160 Ga0496101_0267665 3300048904 Bacteria 1334
161 Ga0496102_0000245 3300048905 Bacteria 71339
162 Ga0496102_0028947 3300048905 Bacteria 4952
163 Ga0496103_0000563 3300048906 Bacteria 29449
164 Ga0496103_0022955 3300048906 Bacteria 3760
165 Ga0496103_0051545 3300048906 Bacteria 2547
166 Ga0496104_0000309 3300048907 Bacteria 43427
167 Ga0496104_0010083 3300048907 Bacteria 8436
168 Ga0496105_0015874 3300048908 Bacteria 6008
169 Ga0496105_0108259 3300048908 Bacteria 2294
170 Ga0496107_0232860 3300048910 Bacteria 1371
171 Ga0496108_0005336 3300048911 Bacteria 10386
172 Ga0496108_0253881 3300048911 Bacteria 1530
173 Ga0496108_0322832 3300048911 Bacteria 1346
174 Ga0496109_0015384 3300048912 Bacteria 6666
175 Ga0496109_0448100 3300048912 Bacteria 1219
176 Ga0496110_0170914 3300048913 Bacteria 1972
177 Ga0496112_0005853 3300048915 Bacteria 10706
178 Ga0496112_0097147 3300048915 Bacteria 2916
179 Ga0496112_0118191 3300048915 Bacteria 2621
180 Ga0496113_0000057 3300048916 Bacteria 48482
181 Ga0496113_0257092 3300048916 Bacteria 1395
182 Ga0496113_0278198 3300048916 Bacteria 1338
183 Ga0496113_0309811 3300048916 Bacteria 1265
184 Ga0496114_0010432 3300048917 Bacteria 7392
185 Ga0496114_0017688 3300048917 Bacteria 5758
186 Ga0496114_0051594 3300048917 Bacteria 3425
187 Ga0496117_0001511 3300048920 Bacteria 33304
188 Ga0496117_0027127 3300048920 Bacteria 4469
189 Ga0496117_0080027 3300048920 Bacteria 2150
190 Ga0496118_0019077 3300048921 Bacteria 6147
191 Ga0496118_0034314 3300048921 Bacteria 4142
192 Ga0496118_0187087 3300048921 Bacteria 1243
193 Ga0496119_0000300 3300048922 Bacteria 69505
194 Ga0496120_0012838 3300048923 Bacteria 5675
195 Ga0496121_0003436 3300048924 Bacteria 22630
196 Ga0496121_0005760 3300048924 Bacteria 15722
197 Ga0496121_0008543 3300048924 Bacteria 12011
198 Ga0496122_0001627 3300048925 Bacteria 35050
199 Ga0496123_0001423 3300048926 Bacteria 33454
200 Ga0496124_0006157 3300048927 Bacteria 13154
201 Ga0496124_0126667 3300048927 Bacteria 2033
202 Ga0496124_0171953 3300048927 Bacteria 1676
203 Ga0496124_0190025 3300048927 Bacteria 1572
204 Ga0496124_0210257 3300048927 Bacteria 1472
205 Ga0496125_0001582 3300048928 Bacteria 32340
206 Ga0496125_0217435 3300048928 Bacteria 1234
207 Ga0496126_0000158 3300048929 Bacteria 156032
208 Ga0496126_0024672 3300048929 Bacteria 5802
209 Ga0496126_0098208 3300048929 Bacteria 2566
210 Ga0501034_0059852 3300049571 Bacteria 3826
211 Ga0501038_0012032 3300049574 Bacteria 7900
212 Ga0501039_0022166 3300049575 Bacteria 4875
213 Ga0501046_0005259 3300049580 Bacteria 11575
214 Ga0501047_0007630 3300049581 Bacteria 10186
215 Ga0501223_000021 3300049663 Bacteria 66697
216 Ga0501235_034667 3300049669 Bacteria 1145
217 Ga0501225_0000011 3300049705 Bacteria 74084
218 Ga0501225_0007217 3300049705 Bacteria 3225
219 nmdc:mga06z11_64514_c1 3300050494 Bacteria 1920
220 nmdc:mga07m45_155627_c1 3300050496 Bacteria 1326
221 Ga0500644_0025251 3300053088 Bacteria 1826
222 Ga0500583_0000509 3300053092 Bacteria 11940
223 Ga0500651_0082215 3300053093 Bacteria 1994
224 Ga0500641_0029399 3300053096 Bacteria 2153
225 Ga0500562_004207 3300053108 Bacteria 3636
226 Ga0500569_011460 3300053109 Bacteria 2119
227 Ga0500594_0004468 3300053118 Bacteria 3083
228 Ga0500597_006881 3300053120 Bacteria 3815
229 Ga0500590_000023 3300053148 Bacteria 41133
230 Ga0500604_0000114 3300053151 Bacteria 24882
231 Ga0500616_0000260 3300053153 Bacteria 81259
232 Ga0500622_0004468 3300053156 Bacteria 8768
233 Ga0500624_000004 3300053157 Bacteria 196921
234 Ga0500637_0000006 3300053178 Bacteria 99157
235 Ga0500567_002414 3300053723 Bacteria 8001
236 Ga0500570_000526 3300053724 Bacteria 15018
237 Ga0500625_000005 3300053729 Bacteria 209509
238 Ga0500645_015980 3300053730 Bacteria 2371
239 Ga0587098_006335 3300059604 Bacteria 1196
240 Ga0587072_019739 3300059643 Bacteria 1182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0127408 Ga0495629_0127408_20_970 301
2 3300011119 Ga0105246_10042974 Ga0105246_100429742 306
3 3300048927 Ga0496124_0126667 Ga0496124_0126667_284_1228 307
4 3300013105 Ga0157369_10058749 Ga0157369_100587493 309
5 3300046455 Ga0495603_0145319 Ga0495603_0145319_344_1333 312
6 3300048912 Ga0496109_0448100 Ga0496109_0448100_17_961 314
7 3300048916 Ga0496113_0278198 Ga0496113_0278198_302_1291 314
8 3300031901 Ga0307406_10252959 Ga0307406_102529592 315
9 3300048915 Ga0496112_0118191 Ga0496112_0118191_249_1283 315
10 3300053120 Ga0500597_006881 Ga0500597_006881_1841_2911 315
11 3300053157 Ga0500624_000004 Ga0500624_000004_114522_115592 315
12 3300053178 Ga0500637_0000006 Ga0500637_0000006_20229_21299 315
13 3300038443 Ga0395901_0195029 Ga0395901_0195029_279_1349 320
14 3300031456 Ga0307513_10004547 Ga0307513_1000454715 323
15 3300049574 Ga0501038_0012032 Ga0501038_0012032_6707_7753 324
16 3300049575 Ga0501039_0022166 Ga0501039_0022166_1413_2459 324
17 3300033180 Ga0307510_10148288 Ga0307510_101482882 327
18 3300053092 Ga0500583_0000509 Ga0500583_0000509_2773_3822 330
19 3300050496 nmdc:mga07m45_155627_c1 nmdc:mga07m45_155627_c1_125_1126 331
20 3300009036 Ga0105244_10053544 Ga0105244_100535442 332
21 3300009148 Ga0105243_10008787 Ga0105243_100087873 332
22 3300011119 Ga0105246_10002033 Ga0105246_100020336 332
23 3300025935 Ga0207709_10006781 Ga0207709_100067816 332
24 3300031507 Ga0307509_10211093 Ga0307509_102110932 333
25 3300037466 Ga0395898_0148928 Ga0395898_0148928_317_1381 334
26 iso_pu_bacteria 2738543031 2739351276 334
27 3300026067 Ga0207678_10239555 Ga0207678_102395551 335
28 3300031548 Ga0307408_100005282 Ga0307408_1000052824 335
29 3300031731 Ga0307405_10001558 Ga0307405_100015585 335
30 3300031824 Ga0307413_10024033 Ga0307413_100240333 335
31 3300031852 Ga0307410_10116769 Ga0307410_101167692 335
32 3300031901 Ga0307406_10000043 Ga0307406_100000432 335
33 3300031903 Ga0307407_10005730 Ga0307407_100057306 335
34 3300031995 Ga0307409_100154156 Ga0307409_1001541562 335
35 3300032002 Ga0307416_100007086 Ga0307416_1000070862 335
36 3300032126 Ga0307415_100137708 Ga0307415_1001377082 335
37 3300037312 Ga0395899_0013305 Ga0395899_0013305_2248_3279 336
38 3300037418 Ga0395900_0055179 Ga0395900_0055179_672_1703 336
39 3300037466 Ga0395898_0018255 Ga0395898_0018255_3874_4905 336
40 3300038443 Ga0395901_0003088 Ga0395901_0003088_12193_13224 336
41 3300048903 Ga0496100_0000953 Ga0496100_0000953_7727_8773 336
42 3300048924 Ga0496121_0008543 Ga0496121_0008543_7732_8778 336
43 iso_pu_bacteria 2643221566 2643847616 336
44 iso_pu_bacteria 2643221597 2643996852 336
45 3300037312 Ga0395899_0022857 Ga0395899_0022857_860_1897 337
46 3300037418 Ga0395900_0185675 Ga0395900_0185675_14_1048 337
47 3300037466 Ga0395898_0218196 Ga0395898_0218196_569_1606 337
48 3300037471 Ga0395905_0007201 Ga0395905_0007201_1599_2636 337
49 3300038443 Ga0395901_0269475 Ga0395901_0269475_522_1559 337
50 3300046472 Ga0495580_0015572 Ga0495580_0015572_1363_2436 337
51 iso_pu_bacteria 2857723135 2857725282 337
52 3300013296 Ga0157374_10492341 Ga0157374_104923411 339
53 3300014326 Ga0157380_10190555 Ga0157380_101905552 339
54 3300037418 Ga0395900_0375872 Ga0395900_0375872_30_1118 339
55 3300048908 Ga0496105_0015874 Ga0496105_0015874_1556_2620 339
56 3300048910 Ga0496107_0232860 Ga0496107_0232860_230_1294 339
57 3300048913 Ga0496110_0170914 Ga0496110_0170914_715_1779 339
58 3300053151 Ga0500604_0000114 Ga0500604_0000114_9123_10157 339
59 iso_pu_bacteria 2848551377 2848551422 339
60 3300048912 Ga0496109_0015384 Ga0496109_0015384_3193_4257 340
61 3300025972 Ga0207668_10035879 Ga0207668_100358792 341
62 3300028794 Ga0307515_10009304 Ga0307515_1000930412 341
63 3300028794 Ga0307515_10077929 Ga0307515_100779294 341
64 3300030522 Ga0307512_10016949 Ga0307512_100169496 341
65 3300031616 Ga0307508_10002171 Ga0307508_100021716 341
66 3300031616 Ga0307508_10019488 Ga0307508_100194882 341
67 3300031730 Ga0307516_10001035 Ga0307516_1000103518 341
68 3300031852 Ga0307410_10205777 Ga0307410_102057772 341
69 3300039447 Ga0436361_0266036 Ga0436361_0266036_690_1730 341
70 3300053088 Ga0500644_0025251 Ga0500644_0025251_291_1349 341
71 3300053093 Ga0500651_0082215 Ga0500651_0082215_429_1487 341
72 3300053096 Ga0500641_0029399 Ga0500641_0029399_473_1531 341
73 3300053109 Ga0500569_011460 Ga0500569_011460_734_1792 341
74 3300053118 Ga0500594_0004468 Ga0500594_0004468_1402_2460 341
75 3300005842 Ga0068858_100079929 Ga0068858_1000799293 342
76 3300006058 Ga0075432_10005154 Ga0075432_100051543 342
77 3300025931 Ga0207644_10079213 Ga0207644_100792132 342
78 3300025941 Ga0207711_10007681 Ga0207711_100076817 342
79 3300048904 Ga0496101_0267665 Ga0496101_0267665_139_1209 342
80 3300048920 Ga0496117_0080027 Ga0496117_0080027_167_1249 342
81 3300048921 Ga0496118_0034314 Ga0496118_0034314_950_2032 342
82 3300048924 Ga0496121_0005760 Ga0496121_0005760_2254_3324 342
83 iso_pu_bacteria 2945920336 2945923104 342
84 iso_pu_bacteria 2964326757 2964326915 342
85 3300005548 Ga0070665_100000271 Ga0070665_10000027172 343
86 3300006178 Ga0075367_10001018 Ga0075367_100010184 343
87 3300028379 Ga0268266_10000212 Ga0268266_1000021228 343
88 3300048927 Ga0496124_0190025 Ga0496124_0190025_451_1533 343
89 3300050494 nmdc:mga06z11_64514_c1 nmdc:mga06z11_64514_c1_307_1419 343
90 3300000549 LJQas_1000181 LJQas_10001817 344
91 3300005843 Ga0068860_100054108 Ga0068860_1000541082 344
92 3300025254 Ga0209148_1004581 Ga0209148_10045813 344
93 3300028381 Ga0268264_10018888 Ga0268264_100188884 344
94 3300031903 Ga0307407_10029039 Ga0307407_100290392 344
95 3300032002 Ga0307416_100054199 Ga0307416_1000541992 344
96 3300032126 Ga0307415_100084915 Ga0307415_1000849151 344
97 3300048906 Ga0496103_0051545 Ga0496103_0051545_722_1816 344
98 3300048907 Ga0496104_0010083 Ga0496104_0010083_115_1188 344
99 3300048911 Ga0496108_0253881 Ga0496108_0253881_150_1244 344
100 3300048911 Ga0496108_0322832 Ga0496108_0322832_103_1176 344
101 iso_pu_bacteria 2945956166 2945957115 344
102 3300005353 Ga0070669_100002282 Ga0070669_1000022822 345
103 3300009011 Ga0105251_10001939 Ga0105251_1000193911 345
104 3300009551 Ga0105238_10195071 Ga0105238_101950712 345
105 3300025923 Ga0207681_10000667 Ga0207681_100006672 345
106 3300031456 Ga0307513_10011039 Ga0307513_1001103910 345
107 3300031548 Ga0307408_100122668 Ga0307408_1001226682 345
108 3300031824 Ga0307413_10171504 Ga0307413_101715041 345
109 3300031852 Ga0307410_10001505 Ga0307410_100015054 345
110 3300031903 Ga0307407_10013191 Ga0307407_100131913 345
111 3300032002 Ga0307416_100006680 Ga0307416_1000066807 345
112 3300032004 Ga0307414_10023703 Ga0307414_100237032 345
113 3300046453 Ga0495627_000110 Ga0495627_000110_90108_91151 345
114 3300046460 Ga0495638_0000074 Ga0495638_0000074_13275_14318 345
115 3300046491 Ga0495584_0077424 Ga0495584_0077424_74_1117 345
116 3300046506 Ga0495583_0001281 Ga0495583_0001281_7643_8686 345
117 3300046506 Ga0495583_0002135 Ga0495583_0002135_10095_11138 345
118 3300046513 Ga0495616_0043409 Ga0495616_0043409_145_1188 345
119 3300046519 Ga0495632_0003841 Ga0495632_0003841_1883_2926 345
120 3300046519 Ga0495632_0004071 Ga0495632_0004071_6115_7158 345
121 3300046520 Ga0495637_0027144 Ga0495637_0027144_123_1166 345
122 3300046522 Ga0495643_0012587 Ga0495643_0012587_2144_3187 345
123 3300046524 Ga0495648_0000050 Ga0495648_0000050_13275_14318 345
124 3300046525 Ga0495663_0000012 Ga0495663_0000012_137646_138689 345
125 3300046558 Ga0495633_0001020 Ga0495633_0001020_6130_7173 345
126 3300046558 Ga0495633_0008940 Ga0495633_0008940_2937_3980 345
127 3300046692 Ga0495671_0003234 Ga0495671_0003234_6133_7176 345
128 3300046692 Ga0495671_0010597 Ga0495671_0010597_2144_3187 345
129 3300047323 Ga0495683_0065433 Ga0495683_0065433_326_1369 345
130 3300047469 Ga0495673_0000157 Ga0495673_0000157_99107_100150 345
131 3300047470 Ga0495681_0002285 Ga0495681_0002285_7291_8334 345
132 3300048090 Ga0495615_0000014 Ga0495615_0000014_39136_40179 345
133 3300048917 Ga0496114_0051594 Ga0496114_0051594_621_1691 345
134 3300053108 Ga0500562_004207 Ga0500562_004207_2465_3508 345
135 3300005841 Ga0068863_100012597 Ga0068863_1000125973 346
136 3300006058 Ga0075432_10000816 Ga0075432_100008167 346
137 3300006353 Ga0075370_10168960 Ga0075370_101689602 346
138 3300026088 Ga0207641_10003802 Ga0207641_100038022 346
139 3300037418 Ga0395900_0107083 Ga0395900_0107083_433_1542 346
140 3300038443 Ga0395901_0043774 Ga0395901_0043774_487_1596 346
141 3300044683 Ga0466965_0074344 Ga0466965_0074344_237_1349 346
142 3300049571 Ga0501034_0059852 Ga0501034_0059852_15_1094 346
143 3300049580 Ga0501046_0005259 Ga0501046_0005259_2833_3912 346
144 3300049581 Ga0501047_0007630 Ga0501047_0007630_4647_5726 346
145 iso_pu_bacteria 2945916053 2945916645 346
146 3300002773 JGI25152J39213_1000210 JGI25152J39213_10002103 347
147 3300013105 Ga0157369_10119968 Ga0157369_101199682 347
148 3300013105 Ga0157369_10157319 Ga0157369_101573192 347
149 3300013105 Ga0157369_10263467 Ga0157369_102634672 347
150 3300013296 Ga0157374_10158341 Ga0157374_101583412 347
151 3300020082 Ga0206353_11122844 Ga0206353_111228443 347
152 3300025245 Ga0207425_1009728 Ga0207425_10097282 347
153 3300025258 Ga0209129_1000159 Ga0209129_100015973 347
154 3300025294 Ga0209025_1000211 Ga0209025_100021137 347
155 3300025728 Ga0207655_1057401 Ga0207655_10574011 347
156 3300031548 Ga0307408_100063424 Ga0307408_1000634243 347
157 3300031731 Ga0307405_10248053 Ga0307405_102480531 347
158 3300031824 Ga0307413_10046244 Ga0307413_100462442 347
159 3300031852 Ga0307410_10026085 Ga0307410_100260852 347
160 3300032002 Ga0307416_100399075 Ga0307416_1003990751 347
161 3300032004 Ga0307414_10083259 Ga0307414_100832592 347
162 3300032004 Ga0307414_10279045 Ga0307414_102790452 347
163 3300037466 Ga0395898_0038940 Ga0395898_0038940_1872_2960 347
164 3300046459 Ga0495629_0111539 Ga0495629_0111539_387_1451 347
165 3300046473 Ga0495582_0031632 Ga0495582_0031632_1002_2090 347
166 3300046475 Ga0495639_0007378 Ga0495639_0007378_820_1908 347
167 3300046691 Ga0495670_0068369 Ga0495670_0068369_257_1321 347
168 3300047315 Ga0495581_0000566 Ga0495581_0000566_8134_9222 347
169 3300047673 Ga0495593_0016265 Ga0495593_0016265_260_1348 347
170 3300048905 Ga0496102_0028947 Ga0496102_0028947_2376_3461 347
171 3300048915 Ga0496112_0097147 Ga0496112_0097147_833_1918 347
172 3300053153 Ga0500616_0000260 Ga0500616_0000260_68347_69411 347
173 3300053730 Ga0500645_015980 Ga0500645_015980_872_1936 347
174 3300059604 Ga0587098_006335 Ga0587098_006335_68_1159 347
175 3300059643 Ga0587072_019739 Ga0587072_019739_73_1164 347
176 iso_pu_bacteria 2808606360 2808850582 347
177 iso_pu_bacteria 2844849076 2844851489 347
178 iso_pu_bacteria 2857740372 2857741760 347
179 iso_pu_bacteria 2904776348 2904778778 347
180 iso_pu_bacteria 2919034639 2919038131 347
181 iso_pu_bacteria 2919051321 2919054851 347
182 iso_pu_bacteria 2919538618 2919539559 347
183 iso_pu_bacteria 2946037020 2946041177 347
184 iso_pu_bacteria 2974302888 2974304618 347
185 3300046542 Ga0495597_0007420 Ga0495597_0007420_2947_4023 348
186 3300046660 Ga0495625_0079350 Ga0495625_0079350_909_1985 348
187 3300048906 Ga0496103_0022955 Ga0496103_0022955_1975_3042 348
188 3300048916 Ga0496113_0309811 Ga0496113_0309811_96_1187 348
189 3300048917 Ga0496114_0010432 Ga0496114_0010432_772_1839 348
190 3300048917 Ga0496114_0017688 Ga0496114_0017688_4583_5650 348
191 3300053148 Ga0500590_000023 Ga0500590_000023_23770_24846 348
192 3300053156 Ga0500622_0004468 Ga0500622_0004468_7672_8748 348
193 3300053723 Ga0500567_002414 Ga0500567_002414_5112_6182 348
194 3300053724 Ga0500570_000526 Ga0500570_000526_387_1463 348
195 3300053729 Ga0500625_000005 Ga0500625_000005_29700_30770 348
196 iso_pu_bacteria 2775506735 2775657990 348
197 iso_pu_bacteria 2808606366 2808876853 348
198 iso_pu_bacteria 2808606371 2808898355 348
199 iso_pu_bacteria 2811994871 2812318883 348
200 iso_pu_bacteria 2946059875 2946060419 348
201 2162886007 SwRhRL2b_contig_3682158 SwRhRL2b_0103.00003180 352
202 3300005289 Ga0065704_10000277 Ga0065704_1000027779 352
203 3300005289 Ga0065704_10090984 Ga0065704_100909843 352
204 3300005289 Ga0065704_10164691 Ga0065704_101646912 352
205 3300005295 Ga0065707_10004227 Ga0065707_100042271 352
206 3300005347 Ga0070668_100001642 Ga0070668_10000164211 352
207 3300005347 Ga0070668_100105447 Ga0070668_1001054472 352
208 3300005353 Ga0070669_100000039 Ga0070669_10000003937 352
209 3300005355 Ga0070671_100001097 Ga0070671_10000109711 352
210 3300005367 Ga0070667_100001038 Ga0070667_10000103814 352
211 3300005548 Ga0070665_100007128 Ga0070665_1000071288 352
212 3300005617 Ga0068859_100499158 Ga0068859_1004991582 352
213 3300005843 Ga0068860_100006402 Ga0068860_1000064022 352
214 3300006931 Ga0097620_100499103 Ga0097620_1004991032 352
215 3300009011 Ga0105251_10002411 Ga0105251_1000241113 352
216 3300009092 Ga0105250_10007398 Ga0105250_100073982 352
217 3300009177 Ga0105248_10003008 Ga0105248_100030084 352
218 3300009553 Ga0105249_10064338 Ga0105249_100643383 352
219 3300009978 Ga0105148_100055 Ga0105148_1000553 352
220 3300013306 Ga0163162_10000601 Ga0163162_1000060113 352
221 3300013306 Ga0163162_10146180 Ga0163162_101461803 352
222 3300017792 Ga0163161_10003843 Ga0163161_100038433 352
223 3300025711 Ga0207696_1001506 Ga0207696_10015069 352
224 3300025735 Ga0207713_1001395 Ga0207713_10013956 352
225 3300025923 Ga0207681_10000111 Ga0207681_1000011123 352
226 3300025941 Ga0207711_10176238 Ga0207711_101762382 352
227 3300025961 Ga0207712_10125884 Ga0207712_101258842 352
228 3300025972 Ga0207668_10001069 Ga0207668_100010694 352
229 3300025986 Ga0207658_10000467 Ga0207658_1000046714 352
230 3300025986 Ga0207658_10409669 Ga0207658_104096691 352
231 3300028379 Ga0268266_10005844 Ga0268266_100058444 352
232 3300028380 Ga0268265_10076388 Ga0268265_100763882 352
233 3300028381 Ga0268264_10011036 Ga0268264_100110363 352
234 3300048903 Ga0496100_0086591 Ga0496100_0086591_279_1337 352
235 3300048905 Ga0496102_0000245 Ga0496102_0000245_42013_43071 352
236 3300048906 Ga0496103_0000563 Ga0496103_0000563_17803_18861 352
237 3300048907 Ga0496104_0000309 Ga0496104_0000309_127_1185 352
238 3300048908 Ga0496105_0108259 Ga0496105_0108259_650_1708 352
239 3300048911 Ga0496108_0005336 Ga0496108_0005336_3338_4396 352
240 3300048915 Ga0496112_0005853 Ga0496112_0005853_7808_8866 352
241 3300048916 Ga0496113_0000057 Ga0496113_0000057_10394_11452 352
242 3300048916 Ga0496113_0257092 Ga0496113_0257092_107_1165 352
243 3300048920 Ga0496117_0001511 Ga0496117_0001511_10291_11349 352
244 3300048920 Ga0496117_0027127 Ga0496117_0027127_1231_2289 352
245 3300048921 Ga0496118_0019077 Ga0496118_0019077_1062_2120 352
246 3300048921 Ga0496118_0187087 Ga0496118_0187087_78_1136 352
247 3300048922 Ga0496119_0000300 Ga0496119_0000300_67969_69027 352
248 3300048923 Ga0496120_0012838 Ga0496120_0012838_798_1856 352
249 3300048924 Ga0496121_0003436 Ga0496121_0003436_10014_11072 352
250 3300048925 Ga0496122_0001627 Ga0496122_0001627_11533_12591 352
251 3300048926 Ga0496123_0001423 Ga0496123_0001423_13642_14700 352
252 3300048927 Ga0496124_0006157 Ga0496124_0006157_7727_8785 352
253 3300048927 Ga0496124_0171953 Ga0496124_0171953_593_1651 352
254 3300048927 Ga0496124_0210257 Ga0496124_0210257_374_1432 352
255 3300048928 Ga0496125_0001582 Ga0496125_0001582_12528_13586 352
256 3300048928 Ga0496125_0217435 Ga0496125_0217435_134_1192 352
257 3300048929 Ga0496126_0000158 Ga0496126_0000158_76155_77213 352
258 3300048929 Ga0496126_0024672 Ga0496126_0024672_3995_5053 352
259 3300048929 Ga0496126_0098208 Ga0496126_0098208_1406_2464 352
260 3300049663 Ga0501223_000021 Ga0501223_000021_32875_33933 352
261 3300049669 Ga0501235_034667 Ga0501235_034667_11_1069 352
262 3300049705 Ga0501225_0000011 Ga0501225_0000011_32880_33938 352
263 3300049705 Ga0501225_0007217 Ga0501225_0007217_1650_2708 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

43

164

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8393 4 352
4had-assembly1.cif.gz_D crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.839 5 345
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8369 4 352
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8355 4 352
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8338 4 352
ID Description Score Start End Superfamily
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 5 129 3.40.50.720
af_Q2G1E5_4_119_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 7 123 3.40.50.720
3q2kH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 5 126 3.40.50.720
af_Q04869_4_115_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9518 7 115 3.40.50.720
1zh8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 5 126 3.40.50.720
ID Description Score Start End GO Terms
AF-Q9KHV5-F1-model_v4 WlbA 0.9653 4 125 GO:0000166
AF-A0A6B0Z0M7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9574 5 127 GO:0000166
AF-A0A359F8H9-F1-model_v4 deleted 0.9526 6 145
AF-A0A067LQ68-F1-model_v4 deleted 0.9479 3 352
AF-A0A380FAB1-F1-model_v4 Putative oxidoreductase (EC 1.-.-.-, EC 1.1.1.18) 0.9459 5 121 GO:0000166
GO:0050112

Feature Viewer

pLDDT pTM Quality
90.21 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map