F371338

General Info

Members Datasets Scaffolds Average Seq Length
262 199 524 137

Family's Representative Sequence

Representative Sequence 3300046680|Ga0495646_0569536|Ga0495646_0569536_72_563
Length 163
Sequence MGLPRYTDLVDTPPCQHPAGKLACVFRRIDHIGVAVEEIEASLALWRDSFQMEVAHREVVEDQGVEAVLLDVGENHVELLAPLGAQTPVGKFLAKKGPGLHHVAYQVTDIDATLAALKQSGLELIDEQPRIGIRGSRVAFLHPRATAGVLTEIVEPAAGLGGH

Samples

Sample ID Description Type Environment
1 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
132 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
133 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
134 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
135 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
138 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.25
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 3.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495646_0569536 3300046680 Bacteria 577
2 Ga0070658_10381629 3300005327 Bacteria 1209
3 Ga0070683_100144782 3300005329 Bacteria 2251
4 Ga0070683_100313370 3300005329 Bacteria 1493
5 Ga0070683_101079946 3300005329 Bacteria 771
6 Ga0068868_100545182 3300005338 Unclassified 1021
7 Ga0070687_100066829 3300005343 Bacteria 1917
8 Ga0070692_10233133 3300005345 Bacteria 1094
9 Ga0070668_101936096 3300005347 Bacteria 543
10 Ga0070669_100002375 3300005353 Bacteria 13615
11 Ga0070669_101075528 3300005353 Bacteria 692
12 Ga0070674_100560310 3300005356 Bacteria 960
13 Ga0070709_10125675 3300005434 Bacteria 1744
14 Ga0070714_100824580 3300005435 Bacteria 899
15 Ga0070714_101162489 3300005435 Bacteria 753
16 Ga0070710_10000006 3300005437 Bacteria 217422
17 Ga0070710_10062354 3300005437 Bacteria 2126
18 Ga0070710_10456734 3300005437 Unclassified 867
19 Ga0070701_10362675 3300005438 Bacteria 908
20 Ga0070711_100011501 3300005439 Bacteria 5499
21 Ga0070711_101096287 3300005439 Bacteria 686
22 Ga0070700_101489141 3300005441 Bacteria 575
23 Ga0070663_100042101 3300005455 Bacteria 3208
24 Ga0070678_100480223 3300005456 Bacteria 1093
25 Ga0070678_100555134 3300005456 Bacteria 1020
26 Ga0070662_100286627 3300005457 Bacteria 1334
27 Ga0070681_10549922 3300005458 Bacteria 1068
28 Ga0068867_100639168 3300005459 Bacteria 932
29 Ga0070685_10277966 3300005466 Bacteria 1120
30 Ga0070707_100136315 3300005468 Bacteria 2388
31 Ga0070684_100551390 3300005535 Unclassified 1070
32 Ga0070697_100617899 3300005536 Bacteria 953
33 Ga0070686_100438213 3300005544 Bacteria 1002
34 Ga0070696_101090646 3300005546 Bacteria 671
35 Ga0070665_100580113 3300005548 Bacteria 1134
36 Ga0070664_100246205 3300005564 Bacteria 1606
37 Ga0070664_100360394 3300005564 Bacteria 1324
38 Ga0070664_100591601 3300005564 Unclassified 1028
39 Ga0068854_100510120 3300005578 Bacteria 1014
40 Ga0068856_101878602 3300005614 Bacteria 610
41 Ga0068866_10280577 3300005718 Bacteria 1032
42 Ga0068851_10118028 3300005834 Bacteria 1423
43 Ga0068851_10179546 3300005834 Unclassified 1172
44 Ga0068870_10110075 3300005840 Bacteria 1571
45 Ga0068862_100690685 3300005844 Bacteria 988
46 Ga0081539_10007546 3300005985 Bacteria 9851
47 Ga0070717_11014169 3300006028 Bacteria 756
48 Ga0070712_100157054 3300006175 Bacteria 1753
49 Ga0097621_101557087 3300006237 Unclassified 628
50 Ga0075430_100218376 3300006846 Bacteria 1582
51 Ga0068865_100402739 3300006881 Bacteria 1121
52 Ga0075435_100241911 3300007076 Bacteria 1535
53 Ga0105240_10042763 3300009093 Bacteria 5771
54 Ga0111539_10672681 3300009094 Bacteria 1205
55 Ga0111539_10911428 3300009094 Unclassified 1022
56 Ga0111539_12277581 3300009094 Bacteria 628
57 Ga0105245_10004211 3300009098 Bacteria 12771
58 Ga0105245_10962390 3300009098 Bacteria 897
59 Ga0105243_10627521 3300009148 Bacteria 1038
60 Ga0105243_10677160 3300009148 Bacteria 1003
61 Ga0105241_10699427 3300009174 Bacteria 925
62 Ga0105242_10297973 3300009176 Bacteria 1470
63 Ga0105237_10003606 3300009545 Bacteria 18291
64 Ga0105238_10798601 3300009551 Bacteria 959
65 Ga0105238_10915377 3300009551 Bacteria 896
66 Ga0105249_10635801 3300009553 Bacteria 1124
67 Ga0105239_10617314 3300010375 Bacteria 1237
68 Ga0105239_11108912 3300010375 Bacteria 911
69 Ga0157378_11613817 3300013297 Bacteria 695
70 Ga0163162_11872500 3300013306 Bacteria 686
71 Ga0157375_10824151 3300013308 Bacteria 1076
72 Ga0163163_11497928 3300014325 Bacteria 736
73 Ga0163163_13280427 3300014325 Bacteria 505
74 Ga0157380_10940343 3300014326 Bacteria 893
75 Ga0157377_10060207 3300014745 Bacteria 2167
76 Ga0157379_12374433 3300014968 Bacteria 529
77 Ga0163161_10568611 3300017792 Bacteria 931
78 Ga0206356_11664938 3300020070 Bacteria 4818
79 Ga0213876_10064107 3300021384 Bacteria 1940
80 Ga0213875_10432828 3300021388 Unclassified 629
81 Ga0207692_10000001 3300025898 Bacteria 558345
82 Ga0207692_10116829 3300025898 Bacteria 1488
83 Ga0207642_10120190 3300025899 Bacteria 1354
84 Ga0207688_10079102 3300025901 Bacteria 1875
85 Ga0207688_10308404 3300025901 Bacteria 969
86 Ga0207645_10205255 3300025907 Bacteria 1297
87 Ga0207695_10031521 3300025913 Bacteria 5810
88 Ga0207671_10003355 3300025914 Bacteria 16063
89 Ga0207693_10227866 3300025915 Bacteria 1463
90 Ga0207663_10001516 3300025916 Bacteria 10855
91 Ga0207663_10105308 3300025916 Bacteria 1903
92 Ga0207662_10006021 3300025918 Bacteria 6518
93 Ga0207649_10127644 3300025920 Bacteria 1723
94 Ga0207646_10101698 3300025922 Bacteria 2577
95 Ga0207681_10026456 3300025923 Bacteria 3742
96 Ga0207687_10122186 3300025927 Bacteria 1949
97 Ga0207700_10475706 3300025928 Bacteria 1103
98 Ga0207664_10275280 3300025929 Bacteria 1476
99 Ga0207644_10413744 3300025931 Bacteria 1104
100 Ga0207690_10229225 3300025932 Bacteria 1425
101 Ga0207706_10084977 3300025933 Bacteria 2782
102 Ga0207706_10127475 3300025933 Bacteria 2238
103 Ga0207706_10477658 3300025933 Bacteria 1077
104 Ga0207669_10321357 3300025937 Bacteria 1185
105 Ga0207679_10076538 3300025945 Bacteria 2543
106 Ga0207679_10298845 3300025945 Bacteria 1387
107 Ga0207679_10466057 3300025945 Bacteria 1122
108 Ga0207712_10373026 3300025961 Bacteria 1192
109 Ga0207712_11467810 3300025961 Bacteria 611
110 Ga0207668_11685483 3300025972 Bacteria 572
111 Ga0207640_10226416 3300025981 Bacteria 1435
112 Ga0207677_10168664 3300026023 Bacteria 1709
113 Ga0207678_10102269 3300026067 Bacteria 2446
114 Ga0207708_10013743 3300026075 Bacteria 6049
115 Ga0207648_10077780 3300026089 Bacteria 2893
116 Ga0207648_10678239 3300026089 Bacteria 954
117 Ga0207674_10081418 3300026116 Bacteria 3240
118 Ga0207675_100016278 3300026118 Bacteria 6943
119 Ga0207675_102045784 3300026118 Bacteria 590
120 Ga0207683_10135471 3300026121 Bacteria 2217
121 Ga0207698_10141186 3300026142 Bacteria 2075
122 Ga0207428_10211418 3300027907 Bacteria 1457
123 Ga0265337_1004936 3300028556 Bacteria 5428
124 Ga0265326_10020449 3300028558 Bacteria 1897
125 Ga0265319_1000451 3300028563 Bacteria 29289
126 Ga0265334_10029342 3300028573 Bacteria 2206
127 Ga0265318_10003203 3300028577 Bacteria 8349
128 Ga0265336_10000017 3300028666 Bacteria 231370
129 Ga0265338_10000044 3300028800 Bacteria 223643
130 Ga0265338_10760885 3300028800 Bacteria 665
131 Ga0265330_10268321 3300031235 Bacteria 719
132 Ga0265340_10000003 3300031247 Bacteria 320583
133 Ga0265339_10078469 3300031249 Bacteria 1748
134 Ga0265327_10050625 3300031251 Bacteria 2172
135 Ga0265316_10017414 3300031344 Bacteria 6213
136 Ga0307408_100347400 3300031548 Bacteria 1258
137 Ga0265314_10355932 3300031711 Bacteria 804
138 Ga0265342_10014064 3300031712 Bacteria 5325
139 Ga0307405_10005736 3300031731 Bacteria 6031
140 Ga0307413_10005499 3300031824 Bacteria 5662
141 Ga0307410_10003933 3300031852 Bacteria 7562
142 Ga0307410_10170870 3300031852 Bacteria 1638
143 Ga0307406_10003798 3300031901 Bacteria 8221
144 Ga0307407_10184791 3300031903 Bacteria 1384
145 Ga0307409_100068303 3300031995 Bacteria 2810
146 Ga0307409_100716668 3300031995 Unclassified 1001
147 Ga0307416_100027902 3300032002 Bacteria 4189
148 Ga0307416_100402801 3300032002 Bacteria 1406
149 Ga0307414_10022545 3300032004 Bacteria 3975
150 Ga0307411_10060096 3300032005 Bacteria 2522
151 Ga0373957_0150295 3300035120 Bacteria 956
152 Ga0373947_0286850 3300035725 Bacteria 1095
153 Ga0373937_0067722 3300036401 Bacteria 3290
154 Ga0373937_0602434 3300036401 Bacteria 1043
155 Ga0373925_0584516 3300037068 Bacteria 919
156 Ga0395899_0401545 3300037312 Bacteria 907
157 Ga0395900_0479887 3300037418 Bacteria 1196
158 Ga0395900_0758990 3300037418 Bacteria 900
159 Ga0395898_0205391 3300037466 Bacteria 1880
160 Ga0395905_0322826 3300037471 Bacteria 1434
161 Ga0436364_1107785 3300037853 Bacteria 1059
162 Ga0395901_1600490 3300038443 Bacteria 605
163 Ga0436365_1073940 3300039437 Bacteria 5272
164 Ga0436365_1814168 3300039437 Bacteria 4065
165 Ga0436362_0744179 3300039453 Bacteria 668
166 Ga0451789_1090380 3300041443 Bacteria 533
167 Ga0451839_0011303 3300041496 Bacteria 639
168 Ga0451855_0432258 3300041511 Bacteria 834
169 Ga0451855_1721702 3300041511 Bacteria 576
170 Ga0439450_021644 3300042008 Bacteria 1382
171 Ga0439454_027769 3300042011 Bacteria 871
172 Ga0439455_0053930 3300042012 Bacteria 1055
173 Ga0450905_029819 3300042142 Bacteria 837
174 Ga0439459_0111245 3300042438 Bacteria 681
175 Ga0439464_0061188 3300042439 Bacteria 1102
176 Ga0439460_0185404 3300042461 Bacteria 704
177 Ga0439440_0080671 3300042993 Bacteria 860
178 Ga0466972_0255236 3300044658 Bacteria 819
179 Ga0466971_0350789 3300044719 Bacteria 714
180 Ga0466968_0307390 3300044735 Bacteria 764
181 Ga0466957_0338944 3300044842 Bacteria 1018
182 Ga0466957_0358797 3300044842 Bacteria 990
183 Ga0466957_1101257 3300044842 Bacteria 573
184 Ga0466960_0022737 3300044901 Bacteria 2807
185 Ga0466960_0143718 3300044901 Bacteria 1269
186 Ga0466960_0252312 3300044901 Bacteria 980
187 Ga0466960_0427691 3300044901 Bacteria 766
188 Ga0466958_0305460 3300045836 Bacteria 1022
189 Ga0466967_0435557 3300045976 Bacteria 1279
190 Ga0466967_1364114 3300045976 Bacteria 706
191 Ga0466967_2426907 3300045976 Bacteria 519
192 Ga0495651_0278926 3300046462 Bacteria 1130
193 Ga0495653_0002895 3300046463 Bacteria 13727
194 Ga0495653_0160005 3300046463 Bacteria 1564
195 Ga0495650_0000104 3300046471 Bacteria 208976
196 Ga0495664_0001383 3300046477 Bacteria 12819
197 Ga0495664_0117990 3300046477 Bacteria 1604
198 Ga0495618_0000066 3300046514 Bacteria 74940
199 Ga0495628_0064761 3300046516 Bacteria 2861
200 Ga0495630_0006813 3300046517 Bacteria 8146
201 Ga0495652_0109500 3300046529 Bacteria 2223
202 Ga0495665_0428288 3300046531 Bacteria 670
203 Ga0495640_0526273 3300046533 Bacteria 718
204 Ga0495640_0663149 3300046533 Bacteria 627
205 Ga0495645_0000027 3300046543 Bacteria 115688
206 Ga0495667_0621806 3300046559 Bacteria 672
207 Ga0495588_0079292 3300046674 Bacteria 1714
208 Ga0495657_0000141 3300046675 Bacteria 64876
209 Ga0495599_0119765 3300046678 Bacteria 1637
210 Ga0495647_0038696 3300046681 Bacteria 1804
211 Ga0495658_0224921 3300046683 Bacteria 1176
212 Ga0495600_0069479 3300046809 Bacteria 2302
213 Ga0495600_0119424 3300046809 Bacteria 1715
214 Ga0495604_0535235 3300047317 Bacteria 757
215 Ga0495676_0073418 3300047321 Bacteria 2623
216 Ga0495684_0005646 3300047471 Bacteria 9746
217 Ga0495684_0009555 3300047471 Bacteria 7476
218 Ga0495686_0192038 3300047472 Bacteria 1177
219 Ga0495602_0665487 3300048088 Bacteria 710
220 Ga0496100_0000240 3300048903 Bacteria 28546
221 Ga0496102_0000019 3300048905 Bacteria 264583
222 Ga0496103_0000059 3300048906 Bacteria 139196
223 Ga0496103_0255841 3300048906 Bacteria 1127
224 Ga0496103_0728314 3300048906 Bacteria 628
225 Ga0496104_0000030 3300048907 Bacteria 201919
226 Ga0496105_0224325 3300048908 Bacteria 1529
227 Ga0496105_0827986 3300048908 Bacteria 702
228 Ga0496110_0000878 3300048913 Bacteria 21164
229 Ga0496110_0447849 3300048913 Bacteria 1177
230 Ga0496111_0000016 3300048914 Bacteria 77108
231 Ga0496112_0017407 3300048915 Bacteria 6750
232 Ga0496112_1643900 3300048915 Bacteria 555
233 Ga0496113_0099613 3300048916 Bacteria 2251
234 Ga0496114_1176033 3300048917 Bacteria 653
235 Ga0496115_0000023 3300048918 Bacteria 163267
236 Ga0496115_0000041 3300048918 Bacteria 122947
237 Ga0496115_0615869 3300048918 Bacteria 862
238 Ga0496119_0372048 3300048922 Bacteria 687
239 Ga0496122_0103012 3300048925 Bacteria 1901
240 Ga0501299_054683 3300049522 Bacteria 833
241 Ga0501034_0008398 3300049571 Bacteria 10914
242 Ga0501046_0867666 3300049580 Bacteria 630
243 Ga0501069_0895964 3300049585 Bacteria 540
244 Ga0501081_0633989 3300049743 Bacteria 801
245 Ga0501044_0186301 3300049823 Bacteria 2040
246 nmdc:mga05p37_1265869_c1 3300050507 Bacteria 755
247 nmdc:mga09592_7601_c1 3300050508 Bacteria 8816
248 nmdc:mga0qj67_205847_c1 3300050509 Bacteria 1598
249 nmdc:mga0qj67_480740_c1 3300050509 Bacteria 999
250 nmdc:mga06r32_1161731_c1 3300050510 Bacteria 719
251 nmdc:mga08y16_2109609_c1 3300050511 Bacteria 511
252 nmdc:mga08y16_690436_c1 3300050511 Bacteria 1021
253 Ga0495601_0009957 3300053077 Bacteria 5634
254 Ga0495601_0023415 3300053077 Bacteria 3794
255 Ga0495601_0085579 3300053077 Bacteria 2026
256 Ga0495601_0499463 3300053077 Bacteria 785
257 Ga0495612_0000197 3300053078 Bacteria 25625
258 Ga0495612_0017880 3300053078 Bacteria 2837
259 Ga0495619_0011996 3300053085 Bacteria 5459
260 Ga0495619_0307203 3300053085 Bacteria 1098
261 Ga0495619_0361795 3300053085 Bacteria 1003
262 Ga0466962_0030125 3300061719 Bacteria 2598
263 Ga0495646_0569536
264 Ga0070658_10381629
265 Ga0070683_100144782
266 Ga0070683_100313370
267 Ga0070683_101079946
268 Ga0068868_100545182
269 Ga0070687_100066829
270 Ga0070692_10233133
271 Ga0070668_101936096
272 Ga0070669_100002375
273 Ga0070669_101075528
274 Ga0070674_100560310
275 Ga0070709_10125675
276 Ga0070714_100824580
277 Ga0070714_101162489
278 Ga0070710_10000006
279 Ga0070710_10062354
280 Ga0070710_10456734
281 Ga0070701_10362675
282 Ga0070711_100011501
283 Ga0070711_101096287
284 Ga0070700_101489141
285 Ga0070663_100042101
286 Ga0070678_100480223
287 Ga0070678_100555134
288 Ga0070662_100286627
289 Ga0070681_10549922
290 Ga0068867_100639168
291 Ga0070685_10277966
292 Ga0070707_100136315
293 Ga0070684_100551390
294 Ga0070697_100617899
295 Ga0070686_100438213
296 Ga0070696_101090646
297 Ga0070665_100580113
298 Ga0070664_100246205
299 Ga0070664_100360394
300 Ga0070664_100591601
301 Ga0068854_100510120
302 Ga0068856_101878602
303 Ga0068866_10280577
304 Ga0068851_10118028
305 Ga0068851_10179546
306 Ga0068870_10110075
307 Ga0068862_100690685
308 Ga0081539_10007546
309 Ga0070717_11014169
310 Ga0070712_100157054
311 Ga0097621_101557087
312 Ga0075430_100218376
313 Ga0068865_100402739
314 Ga0075435_100241911
315 Ga0105240_10042763
316 Ga0111539_10672681
317 Ga0111539_10911428
318 Ga0111539_12277581
319 Ga0105245_10004211
320 Ga0105245_10962390
321 Ga0105243_10627521
322 Ga0105243_10677160
323 Ga0105241_10699427
324 Ga0105242_10297973
325 Ga0105237_10003606
326 Ga0105238_10798601
327 Ga0105238_10915377
328 Ga0105249_10635801
329 Ga0105239_10617314
330 Ga0105239_11108912
331 Ga0157378_11613817
332 Ga0163162_11872500
333 Ga0157375_10824151
334 Ga0163163_11497928
335 Ga0163163_13280427
336 Ga0157380_10940343
337 Ga0157377_10060207
338 Ga0157379_12374433
339 Ga0163161_10568611
340 Ga0206356_11664938
341 Ga0213876_10064107
342 Ga0213875_10432828
343 Ga0207692_10000001
344 Ga0207692_10116829
345 Ga0207642_10120190
346 Ga0207688_10079102
347 Ga0207688_10308404
348 Ga0207645_10205255
349 Ga0207695_10031521
350 Ga0207671_10003355
351 Ga0207693_10227866
352 Ga0207663_10001516
353 Ga0207663_10105308
354 Ga0207662_10006021
355 Ga0207649_10127644
356 Ga0207646_10101698
357 Ga0207681_10026456
358 Ga0207687_10122186
359 Ga0207700_10475706
360 Ga0207664_10275280
361 Ga0207644_10413744
362 Ga0207690_10229225
363 Ga0207706_10084977
364 Ga0207706_10127475
365 Ga0207706_10477658
366 Ga0207669_10321357
367 Ga0207679_10076538
368 Ga0207679_10298845
369 Ga0207679_10466057
370 Ga0207712_10373026
371 Ga0207712_11467810
372 Ga0207668_11685483
373 Ga0207640_10226416
374 Ga0207677_10168664
375 Ga0207678_10102269
376 Ga0207708_10013743
377 Ga0207648_10077780
378 Ga0207648_10678239
379 Ga0207674_10081418
380 Ga0207675_100016278
381 Ga0207675_102045784
382 Ga0207683_10135471
383 Ga0207698_10141186
384 Ga0207428_10211418
385 Ga0265337_1004936
386 Ga0265326_10020449
387 Ga0265319_1000451
388 Ga0265334_10029342
389 Ga0265318_10003203
390 Ga0265336_10000017
391 Ga0265338_10000044
392 Ga0265338_10760885
393 Ga0265330_10268321
394 Ga0265340_10000003
395 Ga0265339_10078469
396 Ga0265327_10050625
397 Ga0265316_10017414
398 Ga0307408_100347400
399 Ga0265314_10355932
400 Ga0265342_10014064
401 Ga0307405_10005736
402 Ga0307413_10005499
403 Ga0307410_10003933
404 Ga0307410_10170870
405 Ga0307406_10003798
406 Ga0307407_10184791
407 Ga0307409_100068303
408 Ga0307409_100716668
409 Ga0307416_100027902
410 Ga0307416_100402801
411 Ga0307414_10022545
412 Ga0307411_10060096
413 Ga0373957_0150295
414 Ga0373947_0286850
415 Ga0373937_0067722
416 Ga0373937_0602434
417 Ga0373925_0584516
418 Ga0395899_0401545
419 Ga0395900_0479887
420 Ga0395900_0758990
421 Ga0395898_0205391
422 Ga0395905_0322826
423 Ga0436364_1107785
424 Ga0395901_1600490
425 Ga0436365_1073940
426 Ga0436365_1814168
427 Ga0436362_0744179
428 Ga0451789_1090380
429 Ga0451839_0011303
430 Ga0451855_0432258
431 Ga0451855_1721702
432 Ga0439450_021644
433 Ga0439454_027769
434 Ga0439455_0053930
435 Ga0450905_029819
436 Ga0439459_0111245
437 Ga0439464_0061188
438 Ga0439460_0185404
439 Ga0439440_0080671
440 Ga0466972_0255236
441 Ga0466971_0350789
442 Ga0466968_0307390
443 Ga0466957_0338944
444 Ga0466957_0358797
445 Ga0466957_1101257
446 Ga0466960_0022737
447 Ga0466960_0143718
448 Ga0466960_0252312
449 Ga0466960_0427691
450 Ga0466958_0305460
451 Ga0466967_0435557
452 Ga0466967_1364114
453 Ga0466967_2426907
454 Ga0495651_0278926
455 Ga0495653_0002895
456 Ga0495653_0160005
457 Ga0495650_0000104
458 Ga0495664_0001383
459 Ga0495664_0117990
460 Ga0495618_0000066
461 Ga0495628_0064761
462 Ga0495630_0006813
463 Ga0495652_0109500
464 Ga0495665_0428288
465 Ga0495640_0526273
466 Ga0495640_0663149
467 Ga0495645_0000027
468 Ga0495667_0621806
469 Ga0495588_0079292
470 Ga0495657_0000141
471 Ga0495599_0119765
472 Ga0495647_0038696
473 Ga0495658_0224921
474 Ga0495600_0069479
475 Ga0495600_0119424
476 Ga0495604_0535235
477 Ga0495676_0073418
478 Ga0495684_0005646
479 Ga0495684_0009555
480 Ga0495686_0192038
481 Ga0495602_0665487
482 Ga0496100_0000240
483 Ga0496102_0000019
484 Ga0496103_0000059
485 Ga0496103_0255841
486 Ga0496103_0728314
487 Ga0496104_0000030
488 Ga0496105_0224325
489 Ga0496105_0827986
490 Ga0496110_0000878
491 Ga0496110_0447849
492 Ga0496111_0000016
493 Ga0496112_0017407
494 Ga0496112_1643900
495 Ga0496113_0099613
496 Ga0496114_1176033
497 Ga0496115_0000023
498 Ga0496115_0000041
499 Ga0496115_0615869
500 Ga0496119_0372048
501 Ga0496122_0103012
502 Ga0501299_054683
503 Ga0501034_0008398
504 Ga0501046_0867666
505 Ga0501069_0895964
506 Ga0501081_0633989
507 Ga0501044_0186301
508 nmdc:mga05p37_1265869_c1
509 nmdc:mga09592_7601_c1
510 nmdc:mga0qj67_205847_c1
511 nmdc:mga0qj67_480740_c1
512 nmdc:mga06r32_1161731_c1
513 nmdc:mga08y16_2109609_c1
514 nmdc:mga08y16_690436_c1
515 Ga0495601_0009957
516 Ga0495601_0023415
517 Ga0495601_0085579
518 Ga0495601_0499463
519 Ga0495612_0000197
520 Ga0495612_0017880
521 Ga0495619_0011996
522 Ga0495619_0307203
523 Ga0495619_0361795
524 Ga0466962_0030125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

140

0.97

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

153

0.89

PF13468

Glyoxalase_3

Glyoxalase-like domain

29

151

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9688 4 137
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.9642 2 133
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.9545 1 133
6xbt-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa 0.9534 1 133
6wf7-assembly1.cif.gz_A methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ 0.9498 1 135
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9771 4 133 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9668 2 133 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9485 4 133 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9258 2 133 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9086 1 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V8W8Q0-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9972 29 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9MI44-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9945 1 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9PNI7-F1-model_v4 VOC family protein 0.9933 2 79 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9GVF9-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9923 1 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A7T9BLH3-F1-model_v4 deleted 0.9902 5 134

Map