F371218

General Info

Members Datasets Scaffolds Average Seq Length
262 196 524 146

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0117260|Ga0373946_0117260_475_981
Length 168
Sequence MIRYTLVCNKRHEFESWFANSAAYDKQAKRGLVTCPLCGSAKVEKALMTPRLGRADTPSNHEAAPAPHPPADAGKEEAAPAAAKMPTPVAMISPQEQEFRRKLRELRDHLVKNAENVGQRFPEEARKMHYGEAEHRSIFGVASPKDAKALHDEGIEFSPLPVLPDERN

Samples

Sample ID Description Type Environment
1 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
100 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
101 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
130 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
173 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
174 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
175 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
186 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
187 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
188 2643221719 Rhizobium sp. Root274 Isolate Unclassified
189 2643221736 Bosea sp. Root483D1 Isolate Unclassified
190 2738541293 Rhizobium sp. GV031 Isolate Unclassified
191 2841760612 Bosea sp. Tri-49 Isolate Nodule
192 2844104063 Bosea sp. Tri-39 Isolate Nodule
193 2851182111 Bosea sp. Tri-44 Isolate Nodule
194 2851246043 Bosea sp. Tri-54 Isolate Nodule
195 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
196 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.66
Metatranscriptomes 0.76
Isolates 4.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.69
Nodule 1.53
Rhizoplane 3.44
Rhizosphere 75.95
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373946_0117260 3300035171 Bacteria 1212
2 JGI25159J45721_1010820 3300002987 Bacteria 2288
3 JGI25151J46595_10101887 3300003187 Bacteria 772
4 Ga0055543_1037881 3300004625 Bacteria 822
5 Ga0065165_1000048 3300005262 Bacteria 196539
6 Ga0065715_10132859 3300005293 Bacteria 1982
7 Ga0065707_10207983 3300005295 Bacteria 1279
8 Ga0070658_10018192 3300005327 Bacteria 5622
9 Ga0070658_10030922 3300005327 Bacteria 4300
10 Ga0070670_100328148 3300005331 Bacteria 1342
11 Ga0070680_100031748 3300005336 Bacteria 4247
12 Ga0070680_100060508 3300005336 Bacteria 3099
13 Ga0070680_100246965 3300005336 Bacteria 1509
14 Ga0070660_100019923 3300005339 Bacteria 4922
15 Ga0070660_100097485 3300005339 Bacteria 2326
16 Ga0070691_10034163 3300005341 Bacteria 2393
17 Ga0070675_101659668 3300005354 Bacteria 590
18 Ga0070673_100225181 3300005364 Bacteria 1625
19 Ga0070714_100106065 3300005435 Bacteria 2482
20 Ga0070713_100037720 3300005436 Bacteria 3908
21 Ga0070710_10545563 3300005437 Bacteria 800
22 Ga0070711_100016116 3300005439 Bacteria 4741
23 Ga0070700_101130021 3300005441 Bacteria 651
24 Ga0070708_100308072 3300005445 Bacteria 1491
25 Ga0070679_100484714 3300005530 Bacteria 1181
26 Ga0070684_100601726 3300005535 Bacteria 1022
27 Ga0070704_100390408 3300005549 Bacteria 1185
28 Ga0070704_100689792 3300005549 Bacteria 905
29 Ga0068855_100020793 3300005563 Bacteria 7869
30 Ga0068855_100049944 3300005563 Bacteria 4931
31 Ga0068856_100019620 3300005614 Bacteria 6562
32 Ga0068856_100170819 3300005614 Bacteria 2186
33 Ga0068852_100038101 3300005616 Bacteria 4038
34 Ga0068852_100074350 3300005616 Bacteria 2992
35 Ga0068852_100724791 3300005616 Bacteria 1005
36 Ga0068866_10078121 3300005718 Bacteria 1770
37 Ga0070717_10380610 3300006028 Bacteria 1265
38 Ga0070717_10587612 3300006028 Bacteria 1010
39 Ga0070716_100132683 3300006173 Bacteria 1577
40 Ga0070712_100068376 3300006175 Bacteria 2531
41 Ga0070712_100133206 3300006175 Bacteria 1886
42 Ga0075369_10154789 3300006186 Bacteria 1049
43 Ga0075366_10254425 3300006195 Bacteria 1071
44 Ga0075434_100364645 3300006871 Bacteria 1466
45 Ga0075436_100119620 3300006914 Bacteria 1842
46 Ga0075435_100264981 3300007076 Bacteria 1465
47 Ga0099794_10076398 3300007265 Bacteria 1646
48 Ga0099795_10049973 3300007788 Bacteria 1519
49 Ga0105240_10034425 3300009093 Bacteria 6533
50 Ga0114129_10117830 3300009147 Bacteria 3658
51 Ga0105242_10302850 3300009176 Bacteria 1460
52 Ga0105248_10012099 3300009177 Bacteria 9519
53 Ga0105249_10038856 3300009553 Bacteria 4319
54 Ga0105239_10799971 3300010375 Bacteria 1080
55 Ga0157373_10923684 3300013100 Bacteria 648
56 Ga0157371_10042514 3300013102 Bacteria 3238
57 Ga0157371_10334505 3300013102 Bacteria 1100
58 Ga0157370_10109735 3300013104 Bacteria 2579
59 Ga0157370_10535430 3300013104 Bacteria 1074
60 Ga0157369_10435591 3300013105 Bacteria 1358
61 Ga0157369_10697299 3300013105 Bacteria 1046
62 Ga0157378_10386153 3300013297 Bacteria 1376
63 Ga0163162_11566080 3300013306 Bacteria 751
64 Ga0157372_10138040 3300013307 Bacteria 2808
65 Ga0157380_10583459 3300014326 Bacteria 1103
66 Ga0157379_10173160 3300014968 Bacteria 1948
67 Ga0206356_10194691 3300020070 Bacteria 953
68 Ga0206354_10159276 3300020081 Bacteria 1914
69 Ga0213872_10217313 3300021361 Bacteria 814
70 Ga0213876_10021446 3300021384 Bacteria 3416
71 Ga0213875_10427714 3300021388 Unclassified 633
72 Ga0209130_1000071 3300025284 Bacteria 178273
73 Ga0209025_1001404 3300025294 Bacteria 31975
74 Ga0209256_1060153 3300025299 Bacteria 887
75 Ga0207426_1008734 3300025302 Bacteria 4059
76 Ga0207688_10266511 3300025901 Bacteria 1041
77 Ga0207705_10529002 3300025909 Bacteria 916
78 Ga0207684_10101538 3300025910 Bacteria 2459
79 Ga0207695_10284781 3300025913 Bacteria 1546
80 Ga0207693_10055790 3300025915 Bacteria 3099
81 Ga0207693_10267949 3300025915 Bacteria 1338
82 Ga0207663_10018748 3300025916 Bacteria 3886
83 Ga0207660_10129083 3300025917 Bacteria 1922
84 Ga0207660_10208372 3300025917 Bacteria 1530
85 Ga0207660_10367198 3300025917 Bacteria 1155
86 Ga0207657_10056063 3300025919 Bacteria 3402
87 Ga0207657_10578710 3300025919 Bacteria 877
88 Ga0207652_10088767 3300025921 Bacteria 2713
89 Ga0207652_10554790 3300025921 Bacteria 1032
90 Ga0207681_10488359 3300025923 Bacteria 1007
91 Ga0207694_10042748 3300025924 Bacteria 3496
92 Ga0207650_10253293 3300025925 Bacteria 1426
93 Ga0207659_10155313 3300025926 Bacteria 1791
94 Ga0207664_10142811 3300025929 Bacteria 2027
95 Ga0207664_10488790 3300025929 Bacteria 1101
96 Ga0207686_10288043 3300025934 Bacteria 1215
97 Ga0207709_10182776 3300025935 Bacteria 1482
98 Ga0207665_10251289 3300025939 Bacteria 1306
99 Ga0207711_10017623 3300025941 Bacteria 5932
100 Ga0207661_10216752 3300025944 Bacteria 1690
101 Ga0207667_10012233 3300025949 Bacteria 9911
102 Ga0207667_10056020 3300025949 Bacteria 4143
103 Ga0207651_10104369 3300025960 Bacteria 2112
104 Ga0207712_10367791 3300025961 Bacteria 1200
105 Ga0207708_10403965 3300026075 Bacteria 1130
106 Ga0207702_10066828 3300026078 Bacteria 3083
107 Ga0207698_10034614 3300026142 Bacteria 3684
108 Ga0207698_10058251 3300026142 Bacteria 2993
109 Ga0209983_1078254 3300027665 Bacteria 740
110 Ga0209974_10073856 3300027876 Bacteria 1166
111 Ga0307515_10000860 3300028794 Bacteria 69854
112 Ga0307515_10484017 3300028794 Bacteria 849
113 Ga0265338_10083304 3300028800 Bacteria 2675
114 Ga0265330_10028892 3300031235 Bacteria 2495
115 Ga0265325_10233134 3300031241 Bacteria 839
116 Ga0265340_10020132 3300031247 Bacteria 3433
117 Ga0265316_10528744 3300031344 Bacteria 841
118 Ga0307513_10002143 3300031456 Bacteria 27633
119 Ga0307513_10425336 3300031456 Bacteria 1057
120 Ga0265313_10033389 3300031595 Bacteria 2616
121 Ga0307514_10136555 3300031649 Bacteria 1677
122 Ga0265342_10000608 3300031712 Bacteria 37799
123 Ga0265342_10055668 3300031712 Bacteria 2347
124 Ga0373930_0014122 3300034816 Bacteria 1482
125 Ga0373928_0014605 3300035084 Bacteria 1590
126 Ga0373929_0059332 3300035085 Unclassified 892
127 Ga0373934_0071678 3300035086 Bacteria 1386
128 Ga0373960_0004579 3300035121 Bacteria 3174
129 Ga0373943_0153163 3300035170 Bacteria 1250
130 Ga0373946_0106785 3300035171 Bacteria 1262
131 Ga0373955_0064747 3300035172 Bacteria 2027
132 Ga0373942_0011028 3300035207 Bacteria 2136
133 Ga0373931_0010202 3300035691 Bacteria 4511
134 Ga0373935_0683392 3300035692 Bacteria 754
135 Ga0373927_0101174 3300035695 Bacteria 1874
136 Ga0373927_0141120 3300035695 Bacteria 1576
137 Ga0373927_0183910 3300035695 Bacteria 1371
138 Ga0373933_0143780 3300035724 Bacteria 1507
139 Ga0373947_0046214 3300035725 Bacteria 2607
140 Ga0373937_0075814 3300036401 Bacteria 3105
141 Ga0373925_0064348 3300037068 Bacteria 2761
142 Ga0373925_0881827 3300037068 Bacteria 737
143 Ga0395899_0037863 3300037312 Bacteria 3615
144 Ga0395900_0003479 3300037418 Bacteria 16993
145 Ga0395900_0110830 3300037418 Bacteria 2819
146 Ga0395900_0355648 3300037418 Bacteria 1437
147 Ga0395900_0814342 3300037418 Bacteria 861
148 Ga0395898_0028510 3300037466 Bacteria 5594
149 Ga0395898_0063874 3300037466 Bacteria 3572
150 Ga0395898_0095928 3300037466 Bacteria 2849
151 Ga0395905_0003609 3300037471 Bacteria 16455
152 Ga0395905_0143390 3300037471 Bacteria 2247
153 Ga0395905_0151899 3300037471 Bacteria 2178
154 Ga0395905_0715614 3300037471 Unclassified 903
155 Ga0436364_0340476 3300037853 Bacteria 2273
156 Ga0436364_0471476 3300037853 Bacteria 961
157 Ga0436364_1356296 3300037853 Bacteria 1640
158 Ga0395901_0122549 3300038443 Bacteria 2732
159 Ga0395901_0164151 3300038443 Bacteria 2332
160 Ga0395901_0251153 3300038443 Bacteria 1842
161 Ga0436365_0414414 3300039437 Bacteria 44510
162 Ga0436361_0896735 3300039447 Bacteria 20111
163 Ga0436363_0474591 3300039450 Bacteria 1085
164 Ga0436363_0867783 3300039450 Bacteria 660
165 Ga0436362_0666752 3300039453 Bacteria 1316
166 Ga0439453_0000046 3300041408 Bacteria 8474
167 Ga0451793_1632004 3300041452 Bacteria 540
168 Ga0439443_001826 3300042003 Bacteria 2443
169 Ga0439435_0000894 3300042436 Bacteria 5135
170 Ga0439460_0064491 3300042461 Bacteria 1124
171 Ga0450893_0051783 3300042532 Bacteria 771
172 Ga0439440_0051825 3300042993 Bacteria 1027
173 Ga0495629_0266519 3300046459 Bacteria 1177
174 Ga0495638_0217035 3300046460 Bacteria 1071
175 Ga0495662_0009857 3300046476 Bacteria 4693
176 Ga0495607_0153076 3300046501 Bacteria 1178
177 Ga0495630_0337853 3300046517 Bacteria 1152
178 Ga0495630_0799901 3300046517 Bacteria 720
179 Ga0495632_0006754 3300046519 Bacteria 7335
180 Ga0495654_0253918 3300046530 Bacteria 731
181 Ga0495640_0040021 3300046533 Bacteria 3285
182 Ga0495640_0269181 3300046533 Bacteria 1063
183 Ga0495634_0044352 3300046642 Bacteria 3010
184 Ga0495613_0416259 3300046689 Bacteria 915
185 Ga0495674_0342136 3300047319 Bacteria 1216
186 Ga0495684_0417769 3300047471 Bacteria 938
187 Ga0496104_0022385 3300048907 Bacteria 5805
188 Ga0496105_0148988 3300048908 Bacteria 1924
189 Ga0496109_0031349 3300048912 Bacteria 4770
190 Ga0496110_0100375 3300048913 Bacteria 2594
191 Ga0496110_0153543 3300048913 Bacteria 2085
192 Ga0496111_0141673 3300048914 Bacteria 1781
193 Ga0496115_0055162 3300048918 Bacteria 3192
194 Ga0496115_0175762 3300048918 Bacteria 1770
195 Ga0496118_0170988 3300048921 Bacteria 1327
196 Ga0496121_0147149 3300048924 Bacteria 1739
197 Ga0496124_0721622 3300048927 Bacteria 629
198 Ga0501031_0237903 3300049568 Bacteria 1184
199 Ga0501033_0026943 3300049570 Bacteria 4324
200 Ga0501033_0028432 3300049570 Bacteria 4200
201 Ga0501033_0113714 3300049570 Bacteria 1968
202 Ga0501033_0845688 3300049570 Bacteria 617
203 Ga0501034_0053529 3300049571 Bacteria 4063
204 Ga0501034_0169942 3300049571 Bacteria 2148
205 Ga0501034_0868620 3300049571 Bacteria 791
206 Ga0501037_0222525 3300049573 Bacteria 1327
207 Ga0501038_0015297 3300049574 Bacteria 6975
208 Ga0501038_0091027 3300049574 Bacteria 2556
209 Ga0501043_0126398 3300049579 Bacteria 2005
210 Ga0501043_0263938 3300049579 Bacteria 1323
211 Ga0501043_0519425 3300049579 Bacteria 888
212 Ga0501047_0000950 3300049581 Bacteria 29378
213 Ga0501047_0199369 3300049581 Bacteria 1863
214 Ga0501047_0211793 3300049581 Bacteria 1796
215 Ga0501047_0227085 3300049581 Bacteria 1721
216 Ga0501070_0156817 3300049586 Bacteria 1877
217 Ga0501257_243284 3300049686 Bacteria 531
218 Ga0501080_0039111 3300049742 Bacteria 4427
219 Ga0501083_0386481 3300049744 Bacteria 910
220 Ga0501035_0050449 3300049822 Bacteria 3729
221 Ga0501044_0002477 3300049823 Bacteria 21066
222 Ga0501044_0005986 3300049823 Bacteria 13449
223 Ga0501044_0051785 3300049823 Bacteria 4232
224 Ga0501044_0063819 3300049823 Bacteria 3761
225 Ga0501044_0101273 3300049823 Bacteria 2898
226 Ga0501044_0332413 3300049823 Bacteria 1442
227 nmdc:mga0yw44_1041126_c1 3300050492 Bacteria 554
228 nmdc:mga0k408_396301_c1 3300050493 Bacteria 822
229 nmdc:mga05p37_1628281_c1 3300050507 Bacteria 634
230 nmdc:mga05p37_219048_c1 3300050507 Bacteria 2297
231 nmdc:mga08y16_1732062_c1 3300050511 Bacteria 579
232 nmdc:mga0n895_115028_c1 3300050512 Bacteria 2708
233 nmdc:mga0rr50_157266_c1 3300050513 Bacteria 1842
234 nmdc:mga08x19_287387_c1 3300050514 Bacteria 1140
235 Ga0500643_012301 3300053087 Bacteria 3069
236 Ga0500644_0012635 3300053088 Bacteria 2340
237 Ga0500644_0513980 3300053088 Bacteria 527
238 Ga0500646_0222385 3300053090 Bacteria 655
239 Ga0500647_0377804 3300053091 Bacteria 581
240 Ga0500566_0041328 3300053094 Bacteria 2664
241 Ga0500566_0264906 3300053094 Bacteria 827
242 Ga0500641_0130477 3300053096 Bacteria 1084
243 Ga0500595_000085 3300053119 Bacteria 65800
244 Ga0500608_090679 3300053122 Bacteria 1429
245 Ga0500618_037656 3300053125 Bacteria 1117
246 Ga0500618_051208 3300053125 Bacteria 934
247 Ga0500652_000056 3300053131 Bacteria 51871
248 Ga0500559_0007801 3300053136 Bacteria 4727
249 Ga0500622_0000829 3300053156 Bacteria 26478
250 Ga0500645_000015 3300053730 Bacteria 150140
251 2510842153 2510461069 Bacteria 5505000
252 2643758958 2643221547 Bacteria 4740017
253 2644300093 2643221653 Bacteria 4569637
254 2644658319 2643221719 Bacteria 4568197
255 2644746374 2643221736 Bacteria 6608466
256 2738803859 2738541293 Bacteria 7065685
257 2841766321 2841760612 Bacteria 6454112
258 2844106087 2844104063 Bacteria 6440972
259 2851186592 2851182111 Bacteria 6047226
260 2851246443 2851246043 Bacteria 6439203
261 8005249009 8005246636 Bacteria 4933972
262 8054464457 8054460903 Bacteria 4872905
263 Ga0373946_0117260
264 JGI25159J45721_1010820
265 JGI25151J46595_10101887
266 Ga0055543_1037881
267 Ga0065165_1000048
268 Ga0065715_10132859
269 Ga0065707_10207983
270 Ga0070658_10018192
271 Ga0070658_10030922
272 Ga0070670_100328148
273 Ga0070680_100031748
274 Ga0070680_100060508
275 Ga0070680_100246965
276 Ga0070660_100019923
277 Ga0070660_100097485
278 Ga0070691_10034163
279 Ga0070675_101659668
280 Ga0070673_100225181
281 Ga0070714_100106065
282 Ga0070713_100037720
283 Ga0070710_10545563
284 Ga0070711_100016116
285 Ga0070700_101130021
286 Ga0070708_100308072
287 Ga0070679_100484714
288 Ga0070684_100601726
289 Ga0070704_100390408
290 Ga0070704_100689792
291 Ga0068855_100020793
292 Ga0068855_100049944
293 Ga0068856_100019620
294 Ga0068856_100170819
295 Ga0068852_100038101
296 Ga0068852_100074350
297 Ga0068852_100724791
298 Ga0068866_10078121
299 Ga0070717_10380610
300 Ga0070717_10587612
301 Ga0070716_100132683
302 Ga0070712_100068376
303 Ga0070712_100133206
304 Ga0075369_10154789
305 Ga0075366_10254425
306 Ga0075434_100364645
307 Ga0075436_100119620
308 Ga0075435_100264981
309 Ga0099794_10076398
310 Ga0099795_10049973
311 Ga0105240_10034425
312 Ga0114129_10117830
313 Ga0105242_10302850
314 Ga0105248_10012099
315 Ga0105249_10038856
316 Ga0105239_10799971
317 Ga0157373_10923684
318 Ga0157371_10042514
319 Ga0157371_10334505
320 Ga0157370_10109735
321 Ga0157370_10535430
322 Ga0157369_10435591
323 Ga0157369_10697299
324 Ga0157378_10386153
325 Ga0163162_11566080
326 Ga0157372_10138040
327 Ga0157380_10583459
328 Ga0157379_10173160
329 Ga0206356_10194691
330 Ga0206354_10159276
331 Ga0213872_10217313
332 Ga0213876_10021446
333 Ga0213875_10427714
334 Ga0209130_1000071
335 Ga0209025_1001404
336 Ga0209256_1060153
337 Ga0207426_1008734
338 Ga0207688_10266511
339 Ga0207705_10529002
340 Ga0207684_10101538
341 Ga0207695_10284781
342 Ga0207693_10055790
343 Ga0207693_10267949
344 Ga0207663_10018748
345 Ga0207660_10129083
346 Ga0207660_10208372
347 Ga0207660_10367198
348 Ga0207657_10056063
349 Ga0207657_10578710
350 Ga0207652_10088767
351 Ga0207652_10554790
352 Ga0207681_10488359
353 Ga0207694_10042748
354 Ga0207650_10253293
355 Ga0207659_10155313
356 Ga0207664_10142811
357 Ga0207664_10488790
358 Ga0207686_10288043
359 Ga0207709_10182776
360 Ga0207665_10251289
361 Ga0207711_10017623
362 Ga0207661_10216752
363 Ga0207667_10012233
364 Ga0207667_10056020
365 Ga0207651_10104369
366 Ga0207712_10367791
367 Ga0207708_10403965
368 Ga0207702_10066828
369 Ga0207698_10034614
370 Ga0207698_10058251
371 Ga0209983_1078254
372 Ga0209974_10073856
373 Ga0307515_10000860
374 Ga0307515_10484017
375 Ga0265338_10083304
376 Ga0265330_10028892
377 Ga0265325_10233134
378 Ga0265340_10020132
379 Ga0265316_10528744
380 Ga0307513_10002143
381 Ga0307513_10425336
382 Ga0265313_10033389
383 Ga0307514_10136555
384 Ga0265342_10000608
385 Ga0265342_10055668
386 Ga0373930_0014122
387 Ga0373928_0014605
388 Ga0373929_0059332
389 Ga0373934_0071678
390 Ga0373960_0004579
391 Ga0373943_0153163
392 Ga0373946_0106785
393 Ga0373955_0064747
394 Ga0373942_0011028
395 Ga0373931_0010202
396 Ga0373935_0683392
397 Ga0373927_0101174
398 Ga0373927_0141120
399 Ga0373927_0183910
400 Ga0373933_0143780
401 Ga0373947_0046214
402 Ga0373937_0075814
403 Ga0373925_0064348
404 Ga0373925_0881827
405 Ga0395899_0037863
406 Ga0395900_0003479
407 Ga0395900_0110830
408 Ga0395900_0355648
409 Ga0395900_0814342
410 Ga0395898_0028510
411 Ga0395898_0063874
412 Ga0395898_0095928
413 Ga0395905_0003609
414 Ga0395905_0143390
415 Ga0395905_0151899
416 Ga0395905_0715614
417 Ga0436364_0340476
418 Ga0436364_0471476
419 Ga0436364_1356296
420 Ga0395901_0122549
421 Ga0395901_0164151
422 Ga0395901_0251153
423 Ga0436365_0414414
424 Ga0436361_0896735
425 Ga0436363_0474591
426 Ga0436363_0867783
427 Ga0436362_0666752
428 Ga0439453_0000046
429 Ga0451793_1632004
430 Ga0439443_001826
431 Ga0439435_0000894
432 Ga0439460_0064491
433 Ga0450893_0051783
434 Ga0439440_0051825
435 Ga0495629_0266519
436 Ga0495638_0217035
437 Ga0495662_0009857
438 Ga0495607_0153076
439 Ga0495630_0337853
440 Ga0495630_0799901
441 Ga0495632_0006754
442 Ga0495654_0253918
443 Ga0495640_0040021
444 Ga0495640_0269181
445 Ga0495634_0044352
446 Ga0495613_0416259
447 Ga0495674_0342136
448 Ga0495684_0417769
449 Ga0496104_0022385
450 Ga0496105_0148988
451 Ga0496109_0031349
452 Ga0496110_0100375
453 Ga0496110_0153543
454 Ga0496111_0141673
455 Ga0496115_0055162
456 Ga0496115_0175762
457 Ga0496118_0170988
458 Ga0496121_0147149
459 Ga0496124_0721622
460 Ga0501031_0237903
461 Ga0501033_0026943
462 Ga0501033_0028432
463 Ga0501033_0113714
464 Ga0501033_0845688
465 Ga0501034_0053529
466 Ga0501034_0169942
467 Ga0501034_0868620
468 Ga0501037_0222525
469 Ga0501038_0015297
470 Ga0501038_0091027
471 Ga0501043_0126398
472 Ga0501043_0263938
473 Ga0501043_0519425
474 Ga0501047_0000950
475 Ga0501047_0199369
476 Ga0501047_0211793
477 Ga0501047_0227085
478 Ga0501070_0156817
479 Ga0501257_243284
480 Ga0501080_0039111
481 Ga0501083_0386481
482 Ga0501035_0050449
483 Ga0501044_0002477
484 Ga0501044_0005986
485 Ga0501044_0051785
486 Ga0501044_0063819
487 Ga0501044_0101273
488 Ga0501044_0332413
489 nmdc:mga0yw44_1041126_c1
490 nmdc:mga0k408_396301_c1
491 nmdc:mga05p37_1628281_c1
492 nmdc:mga05p37_219048_c1
493 nmdc:mga08y16_1732062_c1
494 nmdc:mga0n895_115028_c1
495 nmdc:mga0rr50_157266_c1
496 nmdc:mga08x19_287387_c1
497 Ga0500643_012301
498 Ga0500644_0012635
499 Ga0500644_0513980
500 Ga0500646_0222385
501 Ga0500647_0377804
502 Ga0500566_0041328
503 Ga0500566_0264906
504 Ga0500641_0130477
505 Ga0500595_000085
506 Ga0500608_090679
507 Ga0500618_037656
508 Ga0500618_051208
509 Ga0500652_000056
510 Ga0500559_0007801
511 Ga0500622_0000829
512 Ga0500645_000015
513 2510842153
514 2643758958
515 2644300093
516 2644658319
517 2644746374
518 2738803859
519 2841766321
520 2844106087
521 2851186592
522 2851246443
523 8005249009
524 8054464457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06676

DUF1178

Protein of unknown function (DUF1178)

1

165

0.92

Map