F370891

General Info

Members Datasets Scaffolds Average Seq Length
262 160 262 319

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100000068|Ga0070711_10000006813
Length 343
Sequence LSRKLFLTFITSQLNSMRILVTGGAGYIGSVVTEELVNDGHDVAVYDSLYKGHRAAVVEGAAFVQAELSDISTLRRTLLEYRVEAVIHMAADSLVGESMVAPGKYYQNNVATGLTLLEAMRECSVHGLVFSSTAAVFGEPEKQPIKENDPTNPXXPYGESKLAFEKALRWYEVAYGLRYVSLRYFNAAGASGRFGECHHPETHLIPLVLQAALGTIPEINVHGDDYPTRDGTCVRDYIHVVDLARAHVLALSVLQKRSAVYNLGCGGDGYTVREVAEAAGEVTGVDIPIRMGARRVGDPATLIASSDKIKHELHWRPQFQDLREIIRSAWIWMKQHPTGYDVH

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
141 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
142 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
143 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
144 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
145 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
146 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
149 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
150 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
151 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
152 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.76
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000031 3300002074 Bacteria 80371
2 JGI24751J29686_10000122 3300002459 Bacteria 39084
3 JGI25406J46586_10016411 3300003203 Bacteria 3088
4 Ga0065712_10079426 3300005290 Bacteria 3215
5 Ga0065715_10205622 3300005293 Bacteria 1339
6 Ga0070658_10000650 3300005327 Bacteria 30049
7 Ga0070670_100000741 3300005331 Bacteria 25354
8 Ga0070670_100044060 3300005331 Bacteria 3836
9 Ga0070670_100054097 3300005331 Bacteria 3446
10 Ga0070670_100096543 3300005331 Unclassified 2542
11 Ga0070680_100021638 3300005336 Bacteria 5114
12 Ga0070660_100106192 3300005339 Bacteria 2230
13 Ga0070661_100072440 3300005344 Bacteria 2535
14 Ga0070692_10004347 3300005345 Bacteria 5901
15 Ga0070668_100010176 3300005347 Bacteria 6975
16 Ga0070669_100062417 3300005353 Bacteria 2740
17 Ga0070675_100008503 3300005354 Bacteria 7968
18 Ga0070673_100135114 3300005364 Unclassified 2075
19 Ga0070659_100012201 3300005366 Bacteria 6369
20 Ga0070659_100048585 3300005366 Bacteria 3334
21 Ga0070709_10060048 3300005434 Unclassified 2416
22 Ga0070711_100000068 3300005439 Bacteria 59815
23 Ga0070700_100033474 3300005441 Bacteria 3095
24 Ga0070694_100006960 3300005444 Bacteria 6869
25 Ga0070694_100068982 3300005444 Bacteria 2431
26 Ga0070694_100077202 3300005444 Bacteria 2307
27 Ga0070694_100098965 3300005444 Bacteria 2060
28 Ga0070694_100113849 3300005444 Bacteria 1931
29 Ga0070694_100126731 3300005444 Bacteria 1839
30 Ga0070708_100019348 3300005445 Bacteria 5719
31 Ga0070708_100130337 3300005445 Bacteria 2327
32 Ga0070708_100165187 3300005445 Bacteria 2064
33 Ga0070681_10001374 3300005458 Bacteria 21319
34 Ga0070681_10034946 3300005458 Bacteria 5048
35 Ga0070706_100000193 3300005467 Bacteria 76590
36 Ga0070707_100001937 3300005468 Bacteria 19873
37 Ga0070707_100011575 3300005468 Bacteria 8230
38 Ga0070707_100015371 3300005468 Bacteria 7183
39 Ga0070698_100008816 3300005471 Bacteria 10851
40 Ga0070698_100018079 3300005471 Bacteria 7423
41 Ga0070679_100111520 3300005530 Bacteria 2722
42 Ga0070697_100005895 3300005536 Bacteria 9455
43 Ga0070697_100046446 3300005536 Bacteria 3520
44 Ga0070695_100000444 3300005545 Bacteria 21524
45 Ga0070695_100137041 3300005545 Bacteria 1693
46 Ga0070704_100049278 3300005549 Bacteria 2954
47 Ga0070704_100311876 3300005549 Bacteria 1315
48 Ga0068855_100312672 3300005563 Bacteria 1738
49 Ga0068859_100024771 3300005617 Bacteria 6022
50 Ga0068859_100080071 3300005617 Bacteria 3307
51 Ga0068859_100302790 3300005617 Bacteria 1692
52 Ga0068859_100354910 3300005617 Bacteria 1561
53 Ga0068864_100012723 3300005618 Bacteria 6955
54 Ga0068864_100032894 3300005618 Bacteria 4407
55 Ga0068864_100049076 3300005618 Bacteria 3630
56 Ga0068861_100117404 3300005719 Bacteria 2141
57 Ga0068861_100125694 3300005719 Bacteria 2074
58 Ga0068870_10006938 3300005840 Bacteria 5023
59 Ga0068858_100003270 3300005842 Bacteria 16145
60 Ga0068858_100080090 3300005842 Bacteria 3034
61 Ga0068858_100122246 3300005842 Bacteria 2435
62 Ga0068860_100071212 3300005843 Bacteria 3305
63 Ga0068860_100079535 3300005843 Bacteria 3117
64 Ga0081539_10000002 3300005985 Bacteria 601032
65 Ga0081539_10000130 3300005985 Bacteria 178299
66 Ga0081539_10003189 3300005985 Bacteria 20742
67 Ga0070716_100000002 3300006173 Bacteria 396037
68 Ga0068871_100357715 3300006358 Bacteria 1293
69 Ga0075430_100027777 3300006846 Bacteria 4806
70 Ga0075430_100052769 3300006846 Unclassified 3424
71 Ga0075431_100149888 3300006847 Bacteria 2402
72 Ga0075431_100220886 3300006847 Bacteria 1933
73 Ga0075431_100287018 3300006847 Bacteria 1665
74 Ga0075433_10000017 3300006852 Bacteria 66778
75 Ga0075433_10012947 3300006852 Bacteria 6762
76 Ga0075433_10013657 3300006852 Bacteria 6612
77 Ga0075433_10172789 3300006852 Bacteria 1923
78 Ga0075433_10300763 3300006852 Bacteria 1421
79 Ga0075433_10307519 3300006852 Bacteria 1403
80 Ga0075434_100039252 3300006871 Bacteria 4691
81 Ga0075434_100042578 3300006871 Bacteria 4501
82 Ga0075434_100185174 3300006871 Bacteria 2103
83 Ga0075434_100275310 3300006871 Bacteria 1702
84 Ga0075429_100075325 3300006880 Bacteria 2939
85 Ga0075436_100000777 3300006914 Bacteria 21175
86 Ga0075436_100006648 3300006914 Bacteria 7920
87 Ga0097620_100024771 3300006931 Bacteria 6022
88 Ga0097620_100080075 3300006931 Bacteria 3307
89 Ga0097620_100112112 3300006931 Bacteria 2790
90 Ga0097620_100302792 3300006931 Bacteria 1692
91 Ga0097620_100354901 3300006931 Bacteria 1561
92 Ga0075435_100009870 3300007076 Bacteria 6947
93 Ga0099794_10004889 3300007265 Bacteria 5325
94 Ga0099794_10009718 3300007265 Bacteria 4059
95 Ga0105240_10191869 3300009093 Bacteria 2402
96 Ga0111539_10011139 3300009094 Bacteria 11313
97 Ga0105247_10146325 3300009101 Bacteria 1553
98 Ga0114129_10000454 3300009147 Bacteria 48898
99 Ga0114129_10252132 3300009147 Bacteria 2369
100 Ga0114129_10894865 3300009147 Bacteria 1125
101 Ga0105243_10017946 3300009148 Bacteria 5354
102 Ga0105243_10155611 3300009148 Bacteria 1965
103 Ga0105241_10079460 3300009174 Bacteria 2565
104 Ga0105242_10001584 3300009176 Bacteria 17885
105 Ga0105242_10004045 3300009176 Bacteria 11391
106 Ga0105248_10005749 3300009177 Bacteria 13625
107 Ga0105248_10109357 3300009177 Bacteria 3116
108 Ga0105237_10025541 3300009545 Bacteria 6039
109 Ga0105238_10006984 3300009551 Bacteria 11284
110 Ga0105249_10000745 3300009553 Bacteria 29288
111 Ga0105249_10116686 3300009553 Bacteria 2531
112 Ga0105239_10007423 3300010375 Bacteria 12577
113 Ga0105239_10448309 3300010375 Bacteria 1464
114 Ga0105246_10195409 3300011119 Bacteria 1569
115 Ga0157373_10006131 3300013100 Bacteria 8989
116 Ga0157371_10120966 3300013102 Bacteria 1861
117 Ga0157378_10000011 3300013297 Bacteria 158889
118 Ga0157378_10010783 3300013297 Bacteria 7990
119 Ga0157378_10153819 3300013297 Unclassified 2145
120 Ga0163162_10000090 3300013306 Bacteria 83702
121 Ga0163162_10027248 3300013306 Bacteria 5650
122 Ga0163162_10132681 3300013306 Bacteria 2600
123 Ga0157372_10004986 3300013307 Bacteria 14106
124 Ga0157372_10090722 3300013307 Bacteria 3475
125 Ga0157375_10002841 3300013308 Bacteria 14995
126 Ga0157375_10073967 3300013308 Bacteria 3428
127 Ga0157375_10109977 3300013308 Bacteria 2852
128 Ga0157375_10128506 3300013308 Bacteria 2652
129 Ga0163163_10005715 3300014325 Bacteria 10785
130 Ga0163163_10010747 3300014325 Bacteria 8256
131 Ga0163163_10023384 3300014325 Bacteria 5864
132 Ga0157380_10032293 3300014326 Bacteria 4026
133 Ga0157380_10063151 3300014326 Bacteria 2969
134 Ga0163161_10024113 3300017792 Bacteria 4296
135 Ga0207682_10011692 3300025893 Bacteria 3430
136 Ga0207710_10093686 3300025900 Bacteria 1409
137 Ga0207699_10044175 3300025906 Unclassified 2593
138 Ga0207643_10014653 3300025908 Bacteria 4262
139 Ga0207705_10006346 3300025909 Bacteria 8772
140 Ga0207684_10000251 3300025910 Bacteria 80339
141 Ga0207684_10005111 3300025910 Bacteria 12226
142 Ga0207654_10073426 3300025911 Bacteria 2038
143 Ga0207707_10025658 3300025912 Bacteria 5155
144 Ga0207695_10032776 3300025913 Bacteria 5680
145 Ga0207695_10038274 3300025913 Bacteria 5166
146 Ga0207663_10000017 3300025916 Bacteria 145654
147 Ga0207657_10073317 3300025919 Bacteria 2893
148 Ga0207646_10000758 3300025922 Bacteria 41879
149 Ga0207646_10011542 3300025922 Bacteria 8544
150 Ga0207646_10044354 3300025922 Bacteria 3991
151 Ga0207681_10035242 3300025923 Bacteria 3296
152 Ga0207694_10004472 3300025924 Bacteria 10908
153 Ga0207650_10000047 3300025925 Bacteria 175675
154 Ga0207650_10011979 3300025925 Bacteria 5978
155 Ga0207650_10222279 3300025925 Bacteria 1520
156 Ga0207644_10001872 3300025931 Bacteria 13691
157 Ga0207690_10009578 3300025932 Bacteria 5752
158 Ga0207690_10032796 3300025932 Bacteria 3335
159 Ga0207686_10000368 3300025934 Bacteria 31650
160 Ga0207686_10001562 3300025934 Bacteria 12930
161 Ga0207709_10009422 3300025935 Bacteria 5372
162 Ga0207669_10050056 3300025937 Bacteria 2495
163 Ga0207665_10000004 3300025939 Bacteria 218220
164 Ga0207665_10025355 3300025939 Bacteria 3911
165 Ga0207665_10077542 3300025939 Bacteria 2281
166 Ga0207691_10395593 3300025940 Bacteria 1179
167 Ga0207711_10008115 3300025941 Bacteria 8787
168 Ga0207711_10072855 3300025941 Bacteria 2984
169 Ga0207711_10167575 3300025941 Bacteria 1992
170 Ga0207711_10343024 3300025941 Bacteria 1383
171 Ga0207689_10051297 3300025942 Unclassified 3401
172 Ga0207689_10283568 3300025942 Bacteria 1372
173 Ga0207667_10239524 3300025949 Bacteria 1857
174 Ga0207651_10148726 3300025960 Unclassified 1820
175 Ga0207712_10000259 3300025961 Bacteria 51318
176 Ga0207712_10005031 3300025961 Bacteria 8366
177 Ga0207712_10025249 3300025961 Bacteria 3947
178 Ga0207668_10104608 3300025972 Bacteria 2111
179 Ga0207658_10210510 3300025986 Bacteria 1629
180 Ga0207703_10150028 3300026035 Bacteria 2032
181 Ga0207703_10151571 3300026035 Bacteria 2022
182 Ga0207708_10053620 3300026075 Bacteria 3073
183 Ga0207641_10236857 3300026088 Bacteria 1699
184 Ga0207676_10015774 3300026095 Bacteria 5461
185 Ga0207676_10029964 3300026095 Bacteria 4079
186 Ga0207676_10049213 3300026095 Bacteria 3277
187 Ga0207674_10166397 3300026116 Bacteria 2159
188 Ga0207675_100006163 3300026118 Bacteria 11391
189 Ga0207675_100016720 3300026118 Bacteria 6851
190 Ga0207675_100052497 3300026118 Bacteria 3804
191 Ga0207683_10089178 3300026121 Bacteria 2744
192 Ga0209984_1001112 3300027424 Bacteria 2871
193 Ga0210000_1000424 3300027462 Bacteria 5824
194 Ga0209999_1022416 3300027543 Bacteria 1162
195 Ga0209970_1000466 3300027614 Bacteria 6905
196 Ga0210002_1000882 3300027617 Bacteria 4119
197 Ga0209983_1002007 3300027665 Bacteria 4504
198 Ga0209971_1000002 3300027682 Bacteria 120509
199 Ga0209966_1000321 3300027695 Bacteria 15552
200 Ga0209998_10000166 3300027717 Bacteria 24399
201 Ga0209974_10000004 3300027876 Bacteria 57351
202 Ga0207428_10098490 3300027907 Bacteria 2262
203 Ga0268265_10029165 3300028380 Bacteria 3959
204 Ga0268264_10112943 3300028381 Bacteria 2383
205 Ga0268264_10142824 3300028381 Bacteria 2137
206 Ga0268264_10174854 3300028381 Bacteria 1945
207 Ga0307515_10102259 3300028794 Bacteria 3449
208 Ga0307513_10010201 3300031456 Bacteria 11807
209 Ga0307405_10044939 3300031731 Bacteria 2703
210 Ga0307407_10096584 3300031903 Bacteria 1824
211 Ga0307414_10017165 3300032004 Bacteria 4423
212 Ga0373951_0016111 3300035091 Bacteria 1686
213 Ga0373941_0005912 3300035115 Bacteria 2914
214 Ga0373942_0006921 3300035207 Bacteria 2620
215 Ga0395900_0070445 3300037418 Bacteria 3595
216 Ga0395898_0252280 3300037466 Bacteria 1683
217 Ga0395901_0095944 3300038443 Bacteria 3108
218 Ga0439434_0010740 3300042435 Bacteria 2702
219 Ga0439464_0013777 3300042439 Bacteria 2170
220 Ga0439464_0034744 3300042439 Bacteria 1422
221 Ga0451577_0175918 3300042876 Bacteria 1929
222 Ga0451577_0207277 3300042876 Bacteria 1770
223 Ga0453684_0018057 3300044712 Bacteria 10859
224 Ga0453684_0264710 3300044712 Bacteria 1968
225 Ga0451576_0026760 3300045051 Bacteria 6199
226 Ga0495662_0062528 3300046476 Bacteria 1798
227 Ga0495634_0076569 3300046642 Bacteria 2196
228 Ga0496108_0030468 3300048911 Bacteria 4472
229 Ga0496112_0038012 3300048915 Bacteria 4700
230 Ga0501291_006889 3300049514 Bacteria 1526
231 Ga0501291_016857 3300049514 Bacteria 1119
232 Ga0501291_017656 3300049514 Bacteria 1101
233 Ga0501296_001708 3300049519 Bacteria 2236
234 Ga0501298_000611 3300049521 Bacteria 4885
235 Ga0501202_003276 3300049652 Bacteria 2766
236 Ga0501202_010785 3300049652 Bacteria 1701
237 Ga0501207_003633 3300049654 Bacteria 2063
238 Ga0501209_033838 3300049656 Bacteria 1313
239 Ga0501217_004876 3300049661 Bacteria 2780
240 Ga0501223_012730 3300049663 Bacteria 1680
241 Ga0501239_001829 3300049672 Bacteria 1874
242 Ga0501249_006842 3300049679 Bacteria 2351
243 Ga0501256_003673 3300049685 Bacteria 1286
244 Ga0501225_0004925 3300049705 Bacteria 3946
245 Ga0501225_0014095 3300049705 Bacteria 2234
246 Ga0501273_000852 3300049770 Bacteria 2674
247 nmdc:mga05p37_145875_c1 3300050507 Bacteria 2898
248 nmdc:mga05p37_262443_c1 3300050507 Bacteria 2067
249 nmdc:mga09592_216629_c1 3300050508 Bacteria 1659
250 nmdc:mga09592_58909_c1 3300050508 Unclassified 3247
251 nmdc:mga0qj67_23110_c1 3300050509 Bacteria 4780
252 nmdc:mga08y16_36228_c1 3300050511 Bacteria 5181
253 nmdc:mga0n895_318943_c1 3300050512 Bacteria 1575
254 nmdc:mga0n895_64608_c1 3300050512 Bacteria 3620
255 nmdc:mga0n895_65956_c1 3300050512 Bacteria 3584
256 nmdc:mga0rr50_11529_c1 3300050513 Bacteria 5665
257 nmdc:mga08x19_11_c1 3300050514 Bacteria 403007
258 nmdc:mga0a205_234208_c1 3300050515 Bacteria 1719
259 nmdc:mga0a205_366154_c1 3300050515 Bacteria 1308
260 nmdc:mga0a205_50792_c1 3300050515 Bacteria 4004
261 nmdc:mga0a205_7034_c1 3300050515 Bacteria 5242
262 nmdc:mga0a205_82599_c1 3300050515 Bacteria 3103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025961 Ga0207712_10005031 Ga0207712_100050313 248
2 3300013306 Ga0163162_10132681 Ga0163162_101326811 250
3 3300009176 Ga0105242_10004045 Ga0105242_100040458 265
4 3300025934 Ga0207686_10000368 Ga0207686_100003689 265
5 3300025942 Ga0207689_10051297 Ga0207689_100512974 265
6 3300006871 Ga0075434_100275310 Ga0075434_1002753102 268
7 3300046642 Ga0495634_0076569 Ga0495634_0076569_741_1733 268
8 3300005444 Ga0070694_100068982 Ga0070694_1000689822 269
9 3300006852 Ga0075433_10300763 Ga0075433_103007632 269
10 3300010375 Ga0105239_10448309 Ga0105239_104483092 269
11 3300026118 Ga0207675_100006163 Ga0207675_1000061634 269
12 3300005536 Ga0070697_100046446 Ga0070697_1000464463 270
13 3300006871 Ga0075434_100039252 Ga0075434_1000392523 270
14 3300026035 Ga0207703_10150028 Ga0207703_101500282 270
15 3300050512 nmdc:mga0n895_65956_c1 nmdc:mga0n895_65956_c1_784_1785 270
16 3300005293 Ga0065715_10205622 Ga0065715_102056221 271
17 3300005434 Ga0070709_10060048 Ga0070709_100600482 271
18 3300005549 Ga0070704_100049278 Ga0070704_1000492783 271
19 3300006852 Ga0075433_10307519 Ga0075433_103075191 271
20 3300025906 Ga0207699_10044175 Ga0207699_100441752 271
21 3300025939 Ga0207665_10077542 Ga0207665_100775423 271
22 3300035091 Ga0373951_0016111 Ga0373951_0016111_585_1427 271
23 3300050515 nmdc:mga0a205_366154_c1 nmdc:mga0a205_366154_c1_294_1280 271
24 3300005347 Ga0070668_100010176 Ga0070668_1000101762 274
25 3300009553 Ga0105249_10000745 Ga0105249_1000074525 274
26 3300013306 Ga0163162_10000090 Ga0163162_1000009072 274
27 3300014326 Ga0157380_10032293 Ga0157380_100322932 274
28 3300025961 Ga0207712_10000259 Ga0207712_1000025931 274
29 3300037466 Ga0395898_0252280 Ga0395898_0252280_562_1539 274
30 3300038443 Ga0395901_0095944 Ga0395901_0095944_106_1083 274
31 3300050512 nmdc:mga0n895_64608_c1 nmdc:mga0n895_64608_c1_756_1733 274
32 3300005444 Ga0070694_100126731 Ga0070694_1001267311 275
33 3300005467 Ga0070706_100000193 Ga0070706_10000019329 275
34 3300025910 Ga0207684_10000251 Ga0207684_1000025139 275
35 3300046476 Ga0495662_0062528 Ga0495662_0062528_746_1741 275
36 3300049514 Ga0501291_017656 Ga0501291_017656_38_892 275
37 3300007076 Ga0075435_100009870 Ga0075435_1000098705 276
38 3300005842 Ga0068858_100122246 Ga0068858_1001222461 304
39 3300013308 Ga0157375_10128506 Ga0157375_101285062 304
40 3300025942 Ga0207689_10283568 Ga0207689_102835681 304
41 3300025941 Ga0207711_10167575 Ga0207711_101675751 306
42 3300035207 Ga0373942_0006921 Ga0373942_0006921_854_1828 306
43 3300007265 Ga0099794_10004889 Ga0099794_100048893 308
44 3300049514 Ga0501291_016857 Ga0501291_016857_13_966 308
45 3300005468 Ga0070707_100011575 Ga0070707_1000115754 310
46 3300005471 Ga0070698_100018079 Ga0070698_1000180795 310
47 3300025922 Ga0207646_10011542 Ga0207646_100115422 310
48 3300037418 Ga0395900_0070445 Ga0395900_0070445_754_1719 310
49 3300005842 Ga0068858_100003270 Ga0068858_10000327010 311
50 3300006931 Ga0097620_100112112 Ga0097620_1001121122 311
51 3300007265 Ga0099794_10009718 Ga0099794_100097183 311
52 3300025893 Ga0207682_10011692 Ga0207682_100116923 311
53 3300025937 Ga0207669_10050056 Ga0207669_100500562 311
54 3300025986 Ga0207658_10210510 Ga0207658_102105102 311
55 3300026035 Ga0207703_10151571 Ga0207703_101515712 311
56 3300026095 Ga0207676_10049213 Ga0207676_100492134 311
57 3300026121 Ga0207683_10089178 Ga0207683_100891782 311
58 3300005444 Ga0070694_100098965 Ga0070694_1000989652 312
59 3300005458 Ga0070681_10001374 Ga0070681_100013744 312
60 3300005545 Ga0070695_100137041 Ga0070695_1001370412 312
61 3300005985 Ga0081539_10003189 Ga0081539_100031899 312
62 3300009147 Ga0114129_10000454 Ga0114129_1000045455 312
63 3300009147 Ga0114129_10894865 Ga0114129_108948651 312
64 3300009545 Ga0105237_10025541 Ga0105237_100255415 312
65 3300025912 Ga0207707_10025658 Ga0207707_100256582 312
66 3300025913 Ga0207695_10038274 Ga0207695_100382743 312
67 3300050507 nmdc:mga05p37_262443_c1 nmdc:mga05p37_262443_c1_1012_1986 312
68 3300050508 nmdc:mga09592_58909_c1 nmdc:mga09592_58909_c1_2066_3031 312
69 3300005445 Ga0070708_100019348 Ga0070708_1000193482 313
70 3300005445 Ga0070708_100165187 Ga0070708_1001651871 313
71 3300006852 Ga0075433_10000017 Ga0075433_1000001728 313
72 3300006914 Ga0075436_100000777 Ga0075436_1000007779 313
73 3300050513 nmdc:mga0rr50_11529_c1 nmdc:mga0rr50_11529_c1_1915_2892 313
74 3300005290 Ga0065712_10079426 Ga0065712_100794263 314
75 3300005536 Ga0070697_100005895 Ga0070697_1000058955 314
76 3300005842 Ga0068858_100080090 Ga0068858_1000800903 314
77 3300005843 Ga0068860_100071212 Ga0068860_1000712124 314
78 3300006847 Ga0075431_100220886 Ga0075431_1002208862 314
79 3300028381 Ga0268264_10112943 Ga0268264_101129433 314
80 3300002459 JGI24751J29686_10000122 JGI24751J29686_1000012221 315
81 3300005331 Ga0070670_100000741 Ga0070670_1000007419 315
82 3300005331 Ga0070670_100044060 Ga0070670_1000440601 315
83 3300005331 Ga0070670_100096543 Ga0070670_1000965433 315
84 3300005353 Ga0070669_100062417 Ga0070669_1000624171 315
85 3300005366 Ga0070659_100048585 Ga0070659_1000485854 315
86 3300005444 Ga0070694_100113849 Ga0070694_1001138492 315
87 3300005618 Ga0068864_100032894 Ga0068864_1000328942 315
88 3300005618 Ga0068864_100049076 Ga0068864_1000490763 315
89 3300005840 Ga0068870_10006938 Ga0068870_100069385 315
90 3300005985 Ga0081539_10000002 Ga0081539_1000000272 315
91 3300006852 Ga0075433_10013657 Ga0075433_100136576 315
92 3300006871 Ga0075434_100042578 Ga0075434_1000425783 315
93 3300006880 Ga0075429_100075325 Ga0075429_1000753252 315
94 3300009094 Ga0111539_10011139 Ga0111539_100111395 315
95 3300009147 Ga0114129_10252132 Ga0114129_102521322 315
96 3300009177 Ga0105248_10109357 Ga0105248_101093573 315
97 3300011119 Ga0105246_10195409 Ga0105246_101954092 315
98 3300013297 Ga0157378_10153819 Ga0157378_101538192 315
99 3300013308 Ga0157375_10073967 Ga0157375_100739673 315
100 3300014325 Ga0163163_10005715 Ga0163163_100057159 315
101 3300014325 Ga0163163_10010747 Ga0163163_100107472 315
102 3300025908 Ga0207643_10014653 Ga0207643_100146532 315
103 3300025911 Ga0207654_10073426 Ga0207654_100734262 315
104 3300025923 Ga0207681_10035242 Ga0207681_100352422 315
105 3300025925 Ga0207650_10000047 Ga0207650_10000047136 315
106 3300025925 Ga0207650_10011979 Ga0207650_100119793 315
107 3300025925 Ga0207650_10222279 Ga0207650_102222791 315
108 3300025932 Ga0207690_10032796 Ga0207690_100327962 315
109 3300026088 Ga0207641_10236857 Ga0207641_102368572 315
110 3300026095 Ga0207676_10015774 Ga0207676_100157742 315
111 3300032004 Ga0307414_10017165 Ga0307414_100171653 315
112 3300049514 Ga0501291_006889 Ga0501291_006889_193_1167 315
113 3300049519 Ga0501296_001708 Ga0501296_001708_614_1588 315
114 3300049521 Ga0501298_000611 Ga0501298_000611_1798_2772 315
115 3300049652 Ga0501202_010785 Ga0501202_010785_670_1644 315
116 3300049656 Ga0501209_033838 Ga0501209_033838_220_1194 315
117 3300049661 Ga0501217_004876 Ga0501217_004876_1656_2630 315
118 3300049663 Ga0501223_012730 Ga0501223_012730_655_1629 315
119 3300049672 Ga0501239_001829 Ga0501239_001829_607_1581 315
120 3300049685 Ga0501256_003673 Ga0501256_003673_51_1025 315
121 3300049705 Ga0501225_0004925 Ga0501225_0004925_1295_2269 315
122 3300049705 Ga0501225_0014095 Ga0501225_0014095_667_1641 315
123 3300049770 Ga0501273_000852 Ga0501273_000852_1598_2572 315
124 3300050508 nmdc:mga09592_216629_c1 nmdc:mga09592_216629_c1_282_1256 315
125 3300050511 nmdc:mga08y16_36228_c1 nmdc:mga08y16_36228_c1_883_1866 315
126 3300050512 nmdc:mga0n895_318943_c1 nmdc:mga0n895_318943_c1_227_1201 315
127 3300050515 nmdc:mga0a205_234208_c1 nmdc:mga0a205_234208_c1_517_1491 315
128 3300050515 nmdc:mga0a205_7034_c1 nmdc:mga0a205_7034_c1_4188_5162 315
129 3300005327 Ga0070658_10000650 Ga0070658_1000065013 316
130 3300005331 Ga0070670_100054097 Ga0070670_1000540972 316
131 3300005336 Ga0070680_100021638 Ga0070680_1000216382 316
132 3300005339 Ga0070660_100106192 Ga0070660_1001061922 316
133 3300005344 Ga0070661_100072440 Ga0070661_1000724402 316
134 3300005345 Ga0070692_10004347 Ga0070692_100043475 316
135 3300005354 Ga0070675_100008503 Ga0070675_1000085032 316
136 3300005366 Ga0070659_100012201 Ga0070659_1000122013 316
137 3300005444 Ga0070694_100006960 Ga0070694_1000069604 316
138 3300005444 Ga0070694_100077202 Ga0070694_1000772022 316
139 3300005458 Ga0070681_10034946 Ga0070681_100349463 316
140 3300005530 Ga0070679_100111520 Ga0070679_1001115202 316
141 3300005545 Ga0070695_100000444 Ga0070695_1000004448 316
142 3300005563 Ga0068855_100312672 Ga0068855_1003126722 316
143 3300005617 Ga0068859_100302790 Ga0068859_1003027902 316
144 3300005617 Ga0068859_100354910 Ga0068859_1003549102 316
145 3300005618 Ga0068864_100012723 Ga0068864_1000127234 316
146 3300006358 Ga0068871_100357715 Ga0068871_1003577152 316
147 3300006846 Ga0075430_100052769 Ga0075430_1000527693 316
148 3300006847 Ga0075431_100287018 Ga0075431_1002870182 316
149 3300006931 Ga0097620_100302792 Ga0097620_1003027922 316
150 3300006931 Ga0097620_100354901 Ga0097620_1003549012 316
151 3300009093 Ga0105240_10191869 Ga0105240_101918692 316
152 3300009101 Ga0105247_10146325 Ga0105247_101463252 316
153 3300009553 Ga0105249_10116686 Ga0105249_101166863 316
154 3300010375 Ga0105239_10007423 Ga0105239_100074232 316
155 3300013102 Ga0157371_10120966 Ga0157371_101209661 316
156 3300013306 Ga0163162_10027248 Ga0163162_100272483 316
157 3300013307 Ga0157372_10004986 Ga0157372_100049864 316
158 3300013307 Ga0157372_10090722 Ga0157372_100907222 316
159 3300013308 Ga0157375_10109977 Ga0157375_101099772 316
160 3300014325 Ga0163163_10023384 Ga0163163_100233843 316
161 3300025900 Ga0207710_10093686 Ga0207710_100936862 316
162 3300025909 Ga0207705_10006346 Ga0207705_100063467 316
163 3300025913 Ga0207695_10032776 Ga0207695_100327763 316
164 3300025919 Ga0207657_10073317 Ga0207657_100733172 316
165 3300025932 Ga0207690_10009578 Ga0207690_100095784 316
166 3300025940 Ga0207691_10395593 Ga0207691_103955931 316
167 3300025941 Ga0207711_10008115 Ga0207711_100081153 316
168 3300025949 Ga0207667_10239524 Ga0207667_102395242 316
169 3300025961 Ga0207712_10025249 Ga0207712_100252493 316
170 3300025972 Ga0207668_10104608 Ga0207668_101046082 316
171 3300026095 Ga0207676_10029964 Ga0207676_100299644 316
172 3300027424 Ga0209984_1001112 Ga0209984_10011123 316
173 3300027462 Ga0210000_1000424 Ga0210000_10004247 316
174 3300027543 Ga0209999_1022416 Ga0209999_10224162 316
175 3300027614 Ga0209970_1000466 Ga0209970_10004667 316
176 3300027617 Ga0210002_1000882 Ga0210002_10008824 316
177 3300027665 Ga0209983_1002007 Ga0209983_10020073 316
178 3300027682 Ga0209971_1000002 Ga0209971_100000255 316
179 3300027695 Ga0209966_1000321 Ga0209966_100032112 316
180 3300027717 Ga0209998_10000166 Ga0209998_100001667 316
181 3300027876 Ga0209974_10000004 Ga0209974_1000000426 316
182 3300031903 Ga0307407_10096584 Ga0307407_100965841 316
183 3300035115 Ga0373941_0005912 Ga0373941_0005912_218_1207 316
184 3300042439 Ga0439464_0013777 Ga0439464_0013777_957_1937 316
185 3300042876 Ga0451577_0207277 Ga0451577_0207277_54_1034 316
186 3300044712 Ga0453684_0018057 Ga0453684_0018057_5722_6828 316
187 3300044712 Ga0453684_0264710 Ga0453684_0264710_785_1765 316
188 3300048915 Ga0496112_0038012 Ga0496112_0038012_2447_3433 316
189 3300002074 JGI24748J21848_1000031 JGI24748J21848_100003162 317
190 3300003203 JGI25406J46586_10016411 JGI25406J46586_100164112 317
191 3300005364 Ga0070673_100135114 Ga0070673_1001351142 317
192 3300005439 Ga0070711_100000068 Ga0070711_10000006813 317
193 3300005441 Ga0070700_100033474 Ga0070700_1000334743 317
194 3300005445 Ga0070708_100130337 Ga0070708_1001303371 317
195 3300005468 Ga0070707_100001937 Ga0070707_1000019372 317
196 3300005468 Ga0070707_100015371 Ga0070707_1000153712 317
197 3300005471 Ga0070698_100008816 Ga0070698_10000881612 317
198 3300005549 Ga0070704_100311876 Ga0070704_1003118761 317
199 3300005617 Ga0068859_100024771 Ga0068859_1000247715 317
200 3300005617 Ga0068859_100080071 Ga0068859_1000800714 317
201 3300005719 Ga0068861_100117404 Ga0068861_1001174041 317
202 3300005719 Ga0068861_100125694 Ga0068861_1001256942 317
203 3300005843 Ga0068860_100079535 Ga0068860_1000795353 317
204 3300005985 Ga0081539_10000130 Ga0081539_10000130132 317
205 3300006173 Ga0070716_100000002 Ga0070716_100000002226 317
206 3300006846 Ga0075430_100027777 Ga0075430_1000277772 317
207 3300006847 Ga0075431_100149888 Ga0075431_1001498883 317
208 3300006852 Ga0075433_10012947 Ga0075433_100129474 317
209 3300006852 Ga0075433_10172789 Ga0075433_101727892 317
210 3300006871 Ga0075434_100185174 Ga0075434_1001851743 317
211 3300006914 Ga0075436_100006648 Ga0075436_1000066486 317
212 3300006931 Ga0097620_100024771 Ga0097620_1000247715 317
213 3300006931 Ga0097620_100080075 Ga0097620_1000800754 317
214 3300009148 Ga0105243_10017946 Ga0105243_100179462 317
215 3300009148 Ga0105243_10155611 Ga0105243_101556112 317
216 3300009174 Ga0105241_10079460 Ga0105241_100794602 317
217 3300009176 Ga0105242_10001584 Ga0105242_1000158414 317
218 3300009177 Ga0105248_10005749 Ga0105248_1000574913 317
219 3300009551 Ga0105238_10006984 Ga0105238_100069847 317
220 3300013100 Ga0157373_10006131 Ga0157373_100061317 317
221 3300013297 Ga0157378_10000011 Ga0157378_10000011141 317
222 3300013297 Ga0157378_10010783 Ga0157378_100107839 317
223 3300013308 Ga0157375_10002841 Ga0157375_1000284116 317
224 3300014326 Ga0157380_10063151 Ga0157380_100631513 317
225 3300017792 Ga0163161_10024113 Ga0163161_100241131 317
226 3300025910 Ga0207684_10005111 Ga0207684_1000511114 317
227 3300025916 Ga0207663_10000017 Ga0207663_1000001714 317
228 3300025922 Ga0207646_10000758 Ga0207646_100007582 317
229 3300025922 Ga0207646_10044354 Ga0207646_100443542 317
230 3300025924 Ga0207694_10004472 Ga0207694_100044727 317
231 3300025931 Ga0207644_10001872 Ga0207644_100018724 317
232 3300025934 Ga0207686_10001562 Ga0207686_1000156211 317
233 3300025935 Ga0207709_10009422 Ga0207709_100094222 317
234 3300025939 Ga0207665_10000004 Ga0207665_1000000438 317
235 3300025939 Ga0207665_10025355 Ga0207665_100253553 317
236 3300025941 Ga0207711_10072855 Ga0207711_100728553 317
237 3300025941 Ga0207711_10343024 Ga0207711_103430242 317
238 3300025960 Ga0207651_10148726 Ga0207651_101487262 317
239 3300026075 Ga0207708_10053620 Ga0207708_100536203 317
240 3300026116 Ga0207674_10166397 Ga0207674_101663972 317
241 3300026118 Ga0207675_100016720 Ga0207675_1000167205 317
242 3300026118 Ga0207675_100052497 Ga0207675_1000524973 317
243 3300027907 Ga0207428_10098490 Ga0207428_100984902 317
244 3300028380 Ga0268265_10029165 Ga0268265_100291654 317
245 3300028381 Ga0268264_10142824 Ga0268264_101428242 317
246 3300028381 Ga0268264_10174854 Ga0268264_101748542 317
247 3300028794 Ga0307515_10102259 Ga0307515_101022592 317
248 3300031456 Ga0307513_10010201 Ga0307513_100102016 317
249 3300031731 Ga0307405_10044939 Ga0307405_100449393 317
250 3300042435 Ga0439434_0010740 Ga0439434_0010740_166_1146 317
251 3300042439 Ga0439464_0034744 Ga0439464_0034744_240_1241 317
252 3300042876 Ga0451577_0175918 Ga0451577_0175918_515_1495 317
253 3300045051 Ga0451576_0026760 Ga0451576_0026760_3168_4148 317
254 3300048911 Ga0496108_0030468 Ga0496108_0030468_2432_3412 317
255 3300049652 Ga0501202_003276 Ga0501202_003276_362_1342 317
256 3300049654 Ga0501207_003633 Ga0501207_003633_765_1745 317
257 3300049679 Ga0501249_006842 Ga0501249_006842_1097_2077 317
258 3300050507 nmdc:mga05p37_145875_c1 nmdc:mga05p37_145875_c1_382_1377 317
259 3300050509 nmdc:mga0qj67_23110_c1 nmdc:mga0qj67_23110_c1_2556_3536 317
260 3300050514 nmdc:mga08x19_11_c1 nmdc:mga08x19_11_c1_8950_9933 317
261 3300050515 nmdc:mga0a205_50792_c1 nmdc:mga0a205_50792_c1_411_1391 317
262 3300050515 nmdc:mga0a205_82599_c1 nmdc:mga0a205_82599_c1_1650_2630 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

17

184

0.95

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

19

264

0.94

PF05368

NmrA

NmrA-like family

19

186

0.86

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

20

170

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

20

329

0.82

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

19

195

0.78

PF13460

NAD_binding_10

NAD(P)H-binding

23

186

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9564 2 32
1a9y-assembly1.cif.gz_A-2 udp-galactose 4-epimerase mutant s124a/y149f complexed with udp-glucose 0.94 1 317
1kvu-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.9395 1 317
1kvs-assembly1.cif.gz_A udp-galactose 4-epimerase complexed with udp-phenol 0.9395 1 317
1kvt-assembly1.cif.gz_A-2 udp-galactose 4-epimerase complexed with udp-phenol 0.9385 1 317
ID Description Score Start End Superfamily
4lisA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9628 176 315 3.90.25.10
af_A0A1D6PCE2_262_419_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9555 167 315 3.90.25.10
af_A0A1D6K005_288_418_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9533 185 314 3.90.25.10
2c20D02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9506 164 317 3.90.25.10
af_Q4DUZ8_207_378_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9446 164 312 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A401WRT5-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9803 140 317 GO:0006012
GO:0016853
AF-F7KRN4-F1-model_v4 UDP-glucose 4-epimerase 0.9781 166 317 GO:0016853
GO:0033499
AF-A0A3L7X4L2-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9767 133 317 GO:0016853
GO:0033499
AF-A0A242LDQ7-F1-model_v4 deleted 0.9738 185 317
AF-X0WLX8-F1-model_v4 NAD(P)-binding domain-containing protein 0.9737 197 317 GO:0016853

Feature Viewer

pLDDT pTM Quality
88.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map