F369696

General Info

Members Datasets Scaffolds Average Seq Length
260 201 520 161

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0220062|Ga0316574_0220062_159_707
Length 182
Sequence MKEIIMAAEIVSFMLNGRETVVVTNPLETLQSVLRDRLGYMATKSGCSQGGCGSCTVLVNGEPMVSCLLPAKDIEGQEVTTLEGLTKSGAGEIHPIQQAFYDNFAMQCGYCTPGMIMVSKALIDRAQRAGTHPTHDEIAEAISGNVCRCTGYQSIFEAISDASHRISGHEWSGGRDIGGKTK

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
46 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
78 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
87 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
93 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
111 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
156 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
157 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
158 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
159 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
160 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
161 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
164 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
165 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
166 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
167 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
168 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
169 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2512875024
172 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
173 2643221733 Bosea sp. Root381 Isolate Unclassified
174 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
175 2791355199
176 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
177 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
178 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
179 2841760612 Bosea sp. Tri-49 Isolate Nodule
180 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
181 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
182 2844104063 Bosea sp. Tri-39 Isolate Nodule
183 2851182111 Bosea sp. Tri-44 Isolate Nodule
184 2851246043 Bosea sp. Tri-54 Isolate Nodule
185 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
186 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
187 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
188 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
189 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
190 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
191 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
192 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
193 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
194 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
195 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
196 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
197 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
198 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
199 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
200 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
201 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.26
Metatranscriptomes 1.16
Isolates 11.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 8.46
Rhizoplane 1.54
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0220062 3300035398 Bacteria 1216
2 LJQas_1002407 3300000549 Bacteria 2605
3 JGI25406J46586_10000396 3300003203 Bacteria 19980
4 JGI25153J46596_10003187 3300003215 Bacteria 9235
5 Ga0055526_1008451 3300003771 Bacteria 5133
6 Ga0055524_1006847 3300003775 Bacteria 4915
7 JGI25405J52794_10001397 3300003911 Bacteria 3954
8 Ga0065165_1000026 3300005262 Bacteria 233376
9 Ga0070658_10388873 3300005327 Bacteria 1197
10 Ga0070668_100409693 3300005347 Bacteria 1159
11 Ga0070674_100354800 3300005356 Bacteria 1186
12 Ga0070709_10000191 3300005434 Bacteria 39021
13 Ga0070709_10002454 3300005434 Bacteria 10039
14 Ga0070714_100123239 3300005435 Bacteria 2308
15 Ga0070714_100154055 3300005435 Bacteria 2073
16 Ga0070701_10046380 3300005438 Bacteria 2234
17 Ga0070708_100000129 3300005445 Bacteria 51544
18 Ga0070708_100488816 3300005445 Bacteria 1161
19 Ga0070706_100000156 3300005467 Bacteria 86633
20 Ga0070706_100089512 3300005467 Bacteria 2854
21 Ga0070707_100000078 3300005468 Bacteria 86633
22 Ga0070707_100004183 3300005468 Bacteria 13526
23 Ga0070699_100000254 3300005518 Bacteria 52437
24 Ga0070699_100295351 3300005518 Bacteria 1453
25 Ga0070679_100194660 3300005530 Bacteria 1995
26 Ga0070679_101077176 3300005530 Bacteria 748
27 Ga0068853_100036813 3300005539 Bacteria 4162
28 Ga0070696_101376674 3300005546 Bacteria 601
29 Ga0070665_100160544 3300005548 Bacteria 2250
30 Ga0070665_101089098 3300005548 Bacteria 810
31 Ga0070704_100007115 3300005549 Bacteria 6645
32 Ga0068864_100464812 3300005618 Bacteria 1212
33 Ga0068858_100311343 3300005842 Bacteria 1504
34 Ga0070717_10265017 3300006028 Bacteria 1521
35 Ga0070716_100004226 3300006173 Bacteria 6837
36 Ga0070712_100010470 3300006175 Bacteria 5852
37 Ga0070712_100086434 3300006175 Bacteria 2286
38 Ga0070712_100454240 3300006175 Bacteria 1067
39 Ga0075362_10382089 3300006177 Bacteria 708
40 Ga0075367_10166847 3300006178 Bacteria 1370
41 Ga0075433_10002817 3300006852 Bacteria 13308
42 Ga0075434_100001572 3300006871 Bacteria 19352
43 Ga0075429_100008939 3300006880 Bacteria 8706
44 Ga0075436_100109850 3300006914 Bacteria 1924
45 Ga0099794_10077956 3300007265 Bacteria 1631
46 Ga0099794_10269090 3300007265 Bacteria 880
47 Ga0099795_10024349 3300007788 Bacteria 2018
48 Ga0111539_11402934 3300009094 Bacteria 810
49 Ga0111539_11509915 3300009094 Unclassified 779
50 Ga0105238_10122007 3300009551 Bacteria 2585
51 Ga0099796_10210810 3300010159 Bacteria 792
52 Ga0105239_10102386 3300010375 Bacteria 3169
53 Ga0157371_10954715 3300013102 Bacteria 652
54 Ga0157369_10534928 3300013105 Unclassified 1212
55 Ga0157376_11922637 3300014969 Bacteria 629
56 Ga0163161_10273134 3300017792 Bacteria 1323
57 Ga0214545_1039437 3300021324 Bacteria 1324
58 Ga0214543_1039183 3300021327 Bacteria 1320
59 Ga0213871_10042849 3300021441 Bacteria 1220
60 Ga0209025_1035768 3300025294 Bacteria 2237
61 Ga0209025_1037037 3300025294 Bacteria 2172
62 Ga0209256_1000460 3300025299 Bacteria 61538
63 Ga0207699_10005066 3300025906 Bacteria 6304
64 Ga0207705_10410459 3300025909 Bacteria 1048
65 Ga0207684_10000227 3300025910 Bacteria 86625
66 Ga0207684_10141566 3300025910 Bacteria 2067
67 Ga0207693_10012745 3300025915 Bacteria 6787
68 Ga0207693_10054978 3300025915 Bacteria 3123
69 Ga0207663_10039539 3300025916 Bacteria 2859
70 Ga0207663_10123012 3300025916 Bacteria 1780
71 Ga0207657_10247531 3300025919 Bacteria 1422
72 Ga0207652_10397765 3300025921 Bacteria 1243
73 Ga0207646_10000179 3300025922 Bacteria 86647
74 Ga0207646_10168062 3300025922 Bacteria 1980
75 Ga0207700_10128584 3300025928 Bacteria 2065
76 Ga0207664_10086153 3300025929 Bacteria 2565
77 Ga0207665_10002040 3300025939 Bacteria 13586
78 Ga0207691_11082944 3300025940 Bacteria 667
79 Ga0207639_10049631 3300026041 Bacteria 3183
80 Ga0207683_11266603 3300026121 Bacteria 683
81 Ga0209588_1019705 3300027671 Bacteria 2108
82 Ga0207428_10337277 3300027907 Unclassified 1111
83 Ga0268266_10788408 3300028379 Bacteria 918
84 Ga0307517_10000647 3300028786 Bacteria 59721
85 Ga0307515_10291006 3300028794 Bacteria 1329
86 Ga0265330_10006955 3300031235 Bacteria 5556
87 Ga0265330_10017954 3300031235 Bacteria 3252
88 Ga0265332_10209453 3300031238 Bacteria 809
89 Ga0265328_10111886 3300031239 Bacteria 1015
90 Ga0265328_10255747 3300031239 Bacteria 671
91 Ga0265325_10028185 3300031241 Bacteria 3029
92 Ga0265340_10000872 3300031247 Bacteria 17097
93 Ga0265316_10128714 3300031344 Bacteria 1908
94 Ga0265316_10162488 3300031344 Bacteria 1669
95 Ga0307513_10058513 3300031456 Bacteria 4095
96 Ga0307513_10324351 3300031456 Bacteria 1297
97 Ga0307508_10000350 3300031616 Bacteria 55985
98 Ga0307508_10076496 3300031616 Bacteria 2925
99 Ga0307508_10139502 3300031616 Bacteria 2028
100 Ga0316575_10037666 3300031665 Bacteria 1905
101 Ga0316575_10040848 3300031665 Unclassified 1834
102 Ga0316579_10005481 3300031691 Bacteria 5126
103 Ga0265342_10080171 3300031712 Bacteria 1887
104 Ga0316576_10025254 3300031727 Bacteria 4157
105 Ga0316576_10026340 3300031727 Unclassified 4080
106 Ga0316576_10028991 3300031727 Unclassified 3907
107 Ga0316576_10033395 3300031727 Bacteria 3662
108 Ga0316576_10108379 3300031727 Bacteria 2081
109 Ga0316578_10000136 3300031728 Bacteria 18803
110 Ga0316578_10012563 3300031728 Unclassified 4469
111 Ga0316578_10043442 3300031728 Bacteria 2610
112 Ga0316578_10111202 3300031728 Bacteria 1645
113 Ga0316578_10143087 3300031728 Unclassified 1440
114 Ga0307405_10358959 3300031731 Bacteria 1127
115 Ga0316577_10012737 3300031733 Bacteria 4585
116 Ga0316577_10147484 3300031733 Bacteria 1326
117 Ga0316577_10313772 3300031733 Bacteria 889
118 Ga0307407_10080068 3300031903 Bacteria 1973
119 Ga0316583_10000312 3300032133 Bacteria 13665
120 Ga0316585_10000420 3300032137 Bacteria 9872
121 Ga0316585_10001957 3300032137 Bacteria 5504
122 Ga0316585_10012212 3300032137 Bacteria 2541
123 Ga0316585_10196121 3300032137 Bacteria 667
124 Ga0316580_10010267 3300032139 Bacteria 2825
125 Ga0316580_10027625 3300032139 Unclassified 1754
126 Ga0307510_10301792 3300033180 Bacteria 1063
127 Ga0307510_10513391 3300033180 Bacteria 642
128 Ga0316592_1000030 3300033524 Bacteria 11241
129 Ga0316588_1077221 3300033528 Bacteria 822
130 Ga0316596_1003285 3300033541 Unclassified 3524
131 Ga0316215_1003637 3300033544 Bacteria 1473
132 Ga0373958_0061899 3300034819 Bacteria 813
133 Ga0373926_0000005 3300035083 Bacteria 40279
134 Ga0373932_0088676 3300035112 Bacteria 989
135 Ga0373936_0017778 3300035113 Bacteria 2739
136 Ga0316574_0000199 3300035398 Bacteria 20959
137 Ga0316574_0049097 3300035398 Bacteria 2623
138 Ga0316574_0058420 3300035398 Bacteria 2416
139 Ga0316574_0064689 3300035398 Bacteria 2302
140 Ga0373931_0014015 3300035691 Bacteria 3912
141 Ga0373937_1323976 3300036401 Bacteria 668
142 Ga0316582_0002148 3300036647 Bacteria 9128
143 Ga0316582_0039108 3300036647 Unclassified 2952
144 Ga0316582_0076214 3300036647 Bacteria 2180
145 Ga0316582_0092343 3300036647 Bacteria 1994
146 Ga0316584_0000011 3300036712 Bacteria 64507
147 Ga0316584_0006854 3300036712 Bacteria 7737
148 Ga0316584_0036811 3300036712 Bacteria 3632
149 Ga0316584_0130221 3300036712 Bacteria 1879
150 Ga0316584_0230673 3300036712 Bacteria 1357
151 Ga0395900_0729839 3300037418 Bacteria 922
152 Ga0395898_0238597 3300037466 Bacteria 1734
153 Ga0316581_0001096 3300037588 Bacteria 5870
154 Ga0316581_0066586 3300037588 Bacteria 1106
155 Ga0395901_0972202 3300038443 Bacteria 826
156 Ga0436365_0178323 3300039437 Bacteria 986
157 Ga0436365_0456596 3300039437 Bacteria 1970
158 Ga0436360_1024275 3300039438 Bacteria 2082
159 Ga0436361_0051867 3300039447 Bacteria 1910
160 Ga0439461_0118905 3300041410 Bacteria 659
161 Ga0439465_0040091 3300041413 Bacteria 1513
162 Ga0451795_1053316 3300041456 Bacteria 879
163 Ga0451798_1105354 3300041458 Bacteria 819
164 Ga0451853_3248860 3300041512 Bacteria 749
165 Ga0466965_0193034 3300044683 Bacteria 1078
166 Ga0466966_0483651 3300044684 Bacteria 744
167 Ga0466961_0161243 3300044693 Bacteria 1398
168 Ga0453684_0981609 3300044712 Bacteria 899
169 Ga0466970_0104625 3300044765 Bacteria 1543
170 Ga0466960_0101781 3300044901 Bacteria 1480
171 Ga0466959_0303206 3300045049 Bacteria 1094
172 Ga0451576_0000814 3300045051 Bacteria 61027
173 Ga0466967_0000435 3300045976 Bacteria 19932
174 Ga0466967_0105059 3300045976 Bacteria 2587
175 Ga0466967_0565190 3300045976 Bacteria 1120
176 Ga0495592_0261776 3300046454 Bacteria 1139
177 Ga0495651_0325848 3300046462 Bacteria 1022
178 Ga0495651_0403630 3300046462 Bacteria 892
179 Ga0495608_0563982 3300046511 Bacteria 685
180 Ga0495587_0073335 3300046536 Bacteria 1989
181 Ga0495625_0179153 3300046660 Bacteria 1411
182 Ga0495623_0173669 3300046679 Bacteria 1257
183 Ga0495675_0387037 3300047444 Bacteria 817
184 Ga0495684_0016155 3300047471 Bacteria 5748
185 Ga0496105_1039751 3300048908 Bacteria 611
186 Ga0496115_0128931 3300048918 Bacteria 2084
187 Ga0496125_0000731 3300048928 Bacteria 54449
188 Ga0496126_0251379 3300048929 Bacteria 1473
189 Ga0495682_0180699 3300049460 Bacteria 750
190 Ga0501034_1629886 3300049571 Bacteria 518
191 Ga0501039_0430979 3300049575 Bacteria 1036
192 Ga0501069_0023516 3300049585 Bacteria 3361
193 Ga0501070_0004335 3300049586 Bacteria 12196
194 Ga0501070_0071405 3300049586 Bacteria 2874
195 Ga0501070_0217096 3300049586 Bacteria 1569
196 Ga0501072_1134620 3300049588 Bacteria 608
197 Ga0501073_1240478 3300049589 Bacteria 511
198 Ga0501075_0200552 3300049591 Bacteria 1522
199 Ga0501075_0600204 3300049591 Bacteria 840
200 Ga0501080_0119058 3300049742 Bacteria 2448
201 nmdc:mga03683_349209_c1 3300050489 Bacteria 700
202 nmdc:mga03n38_97284_c1 3300050490 Bacteria 1413
203 nmdc:mga09592_6774_c1 3300050508 Bacteria 9322
204 nmdc:mga0qj67_807434_c1 3300050509 Bacteria 742
205 nmdc:mga08y16_645078_c1 3300050511 Bacteria 1063
206 nmdc:mga0n895_35929_c1 3300050512 Bacteria 4781
207 nmdc:mga0rr50_7424_c1 3300050513 Bacteria 6762
208 nmdc:mga0a205_1574_c1 3300050515 Bacteria 19553
209 Ga0495601_0000320 3300053077 Bacteria 25441
210 Ga0500635_0009125 3300053080 Bacteria 2742
211 Ga0500635_0155770 3300053080 Bacteria 874
212 Ga0495619_0126389 3300053085 Bacteria 1755
213 Ga0500644_0075912 3300053088 Bacteria 1223
214 Ga0500647_0108095 3300053091 Bacteria 1324
215 Ga0500566_0000016 3300053094 Bacteria 102316
216 Ga0500640_004666 3300053095 Bacteria 5006
217 Ga0500555_016680 3300053103 Bacteria 2117
218 Ga0500572_000329 3300053111 Bacteria 16973
219 Ga0500608_005829 3300053122 Bacteria 4943
220 Ga0500614_000573 3300053123 Bacteria 9502
221 Ga0500559_0007333 3300053136 Bacteria 4894
222 Ga0500590_016198 3300053148 Bacteria 3853
223 Ga0500603_000062 3300053150 Bacteria 25022
224 Ga0500624_013770 3300053157 Bacteria 1215
225 Ga0500630_000704 3300053159 Bacteria 15304
226 Ga0500639_000049 3300053163 Bacteria 56267
227 Ga0500637_0034334 3300053178 Bacteria 2837
228 Ga0500596_006500 3300053735 Bacteria 1972
229 Ga0530510_0355724 3300061734 Bacteria 1100
230 2512959406 2512875024 Bacteria 7195110
231 2513693491 2513237101 Bacteria 7952346
232 2644731158 2643221733 Bacteria 5690728
233 2723848382 2721755755 Bacteria 8322773
234 2793082804
235 2828307433 2828305725 Bacteria 4916900
236 2837271611 2837268691 Bacteria 7850704
237 2841739120 2841734538 Bacteria 6784580
238 2841761706 2841760612 Bacteria 6454112
239 2841916102 2841911363 Bacteria 6173697
240 2841921229 2841917233 Bacteria 6173500
241 2844104731 2844104063 Bacteria 6440972
242 2851184724 2851182111 Bacteria 6047226
243 2851247719 2851246043 Bacteria 6439203
244 2874608651 2874604998 Bacteria 7834745
245 2878745139 2878738818 Bacteria 7136951
246 2878796583 2878788777 Bacteria 6567085
247 2889037044 2889033259 Bacteria 9099371
248 2889790966 2889790730 Bacteria 5689708
249 2889915349 2889914905 Bacteria 5702301
250 2922363578 2922361189 Bacteria 7436256
251 2924783276 2924776078 Bacteria 7492003
252 2996337459 2996336353 Bacteria 5511628
253 2996350093 2996348954 Bacteria 7239054
254 3004276792 3004275668 Bacteria 7114440
255 8004640894 8004640170 Bacteria 6723001
256 8006988876 8006984368 Bacteria 9651211
257 8006999675 8006994254 Bacteria 8309700
258 8055069612 8055066027 Bacteria 9479577
259 8056676849 8056673599 Bacteria 7871253
260 8057530171 8057529695 Bacteria 6306553
261 Ga0316574_0220062
262 LJQas_1002407
263 JGI25406J46586_10000396
264 JGI25153J46596_10003187
265 Ga0055526_1008451
266 Ga0055524_1006847
267 JGI25405J52794_10001397
268 Ga0065165_1000026
269 Ga0070658_10388873
270 Ga0070668_100409693
271 Ga0070674_100354800
272 Ga0070709_10000191
273 Ga0070709_10002454
274 Ga0070714_100123239
275 Ga0070714_100154055
276 Ga0070701_10046380
277 Ga0070708_100000129
278 Ga0070708_100488816
279 Ga0070706_100000156
280 Ga0070706_100089512
281 Ga0070707_100000078
282 Ga0070707_100004183
283 Ga0070699_100000254
284 Ga0070699_100295351
285 Ga0070679_100194660
286 Ga0070679_101077176
287 Ga0068853_100036813
288 Ga0070696_101376674
289 Ga0070665_100160544
290 Ga0070665_101089098
291 Ga0070704_100007115
292 Ga0068864_100464812
293 Ga0068858_100311343
294 Ga0070717_10265017
295 Ga0070716_100004226
296 Ga0070712_100010470
297 Ga0070712_100086434
298 Ga0070712_100454240
299 Ga0075362_10382089
300 Ga0075367_10166847
301 Ga0075433_10002817
302 Ga0075434_100001572
303 Ga0075429_100008939
304 Ga0075436_100109850
305 Ga0099794_10077956
306 Ga0099794_10269090
307 Ga0099795_10024349
308 Ga0111539_11402934
309 Ga0111539_11509915
310 Ga0105238_10122007
311 Ga0099796_10210810
312 Ga0105239_10102386
313 Ga0157371_10954715
314 Ga0157369_10534928
315 Ga0157376_11922637
316 Ga0163161_10273134
317 Ga0214545_1039437
318 Ga0214543_1039183
319 Ga0213871_10042849
320 Ga0209025_1035768
321 Ga0209025_1037037
322 Ga0209256_1000460
323 Ga0207699_10005066
324 Ga0207705_10410459
325 Ga0207684_10000227
326 Ga0207684_10141566
327 Ga0207693_10012745
328 Ga0207693_10054978
329 Ga0207663_10039539
330 Ga0207663_10123012
331 Ga0207657_10247531
332 Ga0207652_10397765
333 Ga0207646_10000179
334 Ga0207646_10168062
335 Ga0207700_10128584
336 Ga0207664_10086153
337 Ga0207665_10002040
338 Ga0207691_11082944
339 Ga0207639_10049631
340 Ga0207683_11266603
341 Ga0209588_1019705
342 Ga0207428_10337277
343 Ga0268266_10788408
344 Ga0307517_10000647
345 Ga0307515_10291006
346 Ga0265330_10006955
347 Ga0265330_10017954
348 Ga0265332_10209453
349 Ga0265328_10111886
350 Ga0265328_10255747
351 Ga0265325_10028185
352 Ga0265340_10000872
353 Ga0265316_10128714
354 Ga0265316_10162488
355 Ga0307513_10058513
356 Ga0307513_10324351
357 Ga0307508_10000350
358 Ga0307508_10076496
359 Ga0307508_10139502
360 Ga0316575_10037666
361 Ga0316575_10040848
362 Ga0316579_10005481
363 Ga0265342_10080171
364 Ga0316576_10025254
365 Ga0316576_10026340
366 Ga0316576_10028991
367 Ga0316576_10033395
368 Ga0316576_10108379
369 Ga0316578_10000136
370 Ga0316578_10012563
371 Ga0316578_10043442
372 Ga0316578_10111202
373 Ga0316578_10143087
374 Ga0307405_10358959
375 Ga0316577_10012737
376 Ga0316577_10147484
377 Ga0316577_10313772
378 Ga0307407_10080068
379 Ga0316583_10000312
380 Ga0316585_10000420
381 Ga0316585_10001957
382 Ga0316585_10012212
383 Ga0316585_10196121
384 Ga0316580_10010267
385 Ga0316580_10027625
386 Ga0307510_10301792
387 Ga0307510_10513391
388 Ga0316592_1000030
389 Ga0316588_1077221
390 Ga0316596_1003285
391 Ga0316215_1003637
392 Ga0373958_0061899
393 Ga0373926_0000005
394 Ga0373932_0088676
395 Ga0373936_0017778
396 Ga0316574_0000199
397 Ga0316574_0049097
398 Ga0316574_0058420
399 Ga0316574_0064689
400 Ga0373931_0014015
401 Ga0373937_1323976
402 Ga0316582_0002148
403 Ga0316582_0039108
404 Ga0316582_0076214
405 Ga0316582_0092343
406 Ga0316584_0000011
407 Ga0316584_0006854
408 Ga0316584_0036811
409 Ga0316584_0130221
410 Ga0316584_0230673
411 Ga0395900_0729839
412 Ga0395898_0238597
413 Ga0316581_0001096
414 Ga0316581_0066586
415 Ga0395901_0972202
416 Ga0436365_0178323
417 Ga0436365_0456596
418 Ga0436360_1024275
419 Ga0436361_0051867
420 Ga0439461_0118905
421 Ga0439465_0040091
422 Ga0451795_1053316
423 Ga0451798_1105354
424 Ga0451853_3248860
425 Ga0466965_0193034
426 Ga0466966_0483651
427 Ga0466961_0161243
428 Ga0453684_0981609
429 Ga0466970_0104625
430 Ga0466960_0101781
431 Ga0466959_0303206
432 Ga0451576_0000814
433 Ga0466967_0000435
434 Ga0466967_0105059
435 Ga0466967_0565190
436 Ga0495592_0261776
437 Ga0495651_0325848
438 Ga0495651_0403630
439 Ga0495608_0563982
440 Ga0495587_0073335
441 Ga0495625_0179153
442 Ga0495623_0173669
443 Ga0495675_0387037
444 Ga0495684_0016155
445 Ga0496105_1039751
446 Ga0496115_0128931
447 Ga0496125_0000731
448 Ga0496126_0251379
449 Ga0495682_0180699
450 Ga0501034_1629886
451 Ga0501039_0430979
452 Ga0501069_0023516
453 Ga0501070_0004335
454 Ga0501070_0071405
455 Ga0501070_0217096
456 Ga0501072_1134620
457 Ga0501073_1240478
458 Ga0501075_0200552
459 Ga0501075_0600204
460 Ga0501080_0119058
461 nmdc:mga03683_349209_c1
462 nmdc:mga03n38_97284_c1
463 nmdc:mga09592_6774_c1
464 nmdc:mga0qj67_807434_c1
465 nmdc:mga08y16_645078_c1
466 nmdc:mga0n895_35929_c1
467 nmdc:mga0rr50_7424_c1
468 nmdc:mga0a205_1574_c1
469 Ga0495601_0000320
470 Ga0500635_0009125
471 Ga0500635_0155770
472 Ga0495619_0126389
473 Ga0500644_0075912
474 Ga0500647_0108095
475 Ga0500566_0000016
476 Ga0500640_004666
477 Ga0500555_016680
478 Ga0500572_000329
479 Ga0500608_005829
480 Ga0500614_000573
481 Ga0500559_0007333
482 Ga0500590_016198
483 Ga0500603_000062
484 Ga0500624_013770
485 Ga0500630_000704
486 Ga0500639_000049
487 Ga0500637_0034334
488 Ga0500596_006500
489 Ga0530510_0355724
490 2512959406
491 2513693491
492 2644731158
493 2723848382
494 2793082804
495 2828307433
496 2837271611
497 2841739120
498 2841761706
499 2841916102
500 2841921229
501 2844104731
502 2851184724
503 2851247719
504 2874608651
505 2878745139
506 2878796583
507 2889037044
508 2889790966
509 2889915349
510 2922363578
511 2924783276
512 2996337459
513 2996350093
514 3004276792
515 8004640894
516 8006988876
517 8006999675
518 8055069612
519 8056676849
520 8057530171

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

81

160

0.95

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

7

98

0.8

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

13

84

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.9689 1 156
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9684 2 155
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9605 3 154
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9595 4 154
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.9569 1 156
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9877 2 76 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9826 2 78 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9714 4 78 3.10.20.30
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9713 80 156 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9689 2 78 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A496QRI9-F1-model_v4 (2Fe-2S)-binding protein 0.9897 2 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A524AJA0-F1-model_v4 (2Fe-2S)-binding protein 0.9891 2 152 GO:0016491
GO:0046872
GO:0051537
AF-X1I5A9-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9889 2 148 GO:0016491
GO:0046872
GO:0051537
AF-A0A1T5M4K3-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9887 4 148 GO:0016491
GO:0046872
GO:0051537
AF-A0A0S7BW29-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase, small subunit, CoxS/CutS family 0.9882 1 154 GO:0016491
GO:0046872
GO:0051537

Map