F369393

General Info

Members Datasets Scaffolds Average Seq Length
260 138 520 270

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100037318|Ga0070707_1000373185
Length 290
Sequence MLAEEKREYTPGMIKLPAPTAWPMITALGITLLCAGLVTHLAVSVVGLILALRGAVGWFREVLPVERHELVRVRPPAERAQAIKLSPRTTTHLRAGEAGHRVRIPAEIHPYSSGVKGGLLGGAVMAIVACAYGLIAYHSVWYPLNLLAAAALPSMAHADLAQLKVFDGMAFFVALISHGAISILVGLLFAVLLPMFPSRRAAFWGSLTAPLFWSALVWATLKLVNPALDARIDWTWFIASQVVFGLVAGYVVHHTKTVETMQTWPLAARAGLEAPGLLEEKSQPEKGEWQ

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
93 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
132 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 0.38
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 21.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100037318 3300005468 Bacteria 4637
2 JGI24743J22301_10000220 3300001991 Bacteria 6007
3 JGI24033J26618_1000248 3300002155 Bacteria 6031
4 rootH1_10122231 3300003316 Bacteria 1774
5 rootH2_10006252 3300003320 Bacteria 43933
6 rootL2_10147361 3300003322 Bacteria 1911
7 rootL2_10221134 3300003322 Bacteria 2300
8 Ga0058859_10034956 3300004798 Bacteria 5704
9 Ga0058860_12225860 3300004801 Bacteria 1961
10 Ga0065704_10009431 3300005289 Bacteria 2272
11 Ga0065707_10015800 3300005295 Bacteria 2690
12 Ga0070690_100312247 3300005330 Bacteria 1130
13 Ga0070670_100583815 3300005331 Bacteria 999
14 Ga0070680_100110445 3300005336 Unclassified 2289
15 Ga0070661_100000325 3300005344 Bacteria 38388
16 Ga0070668_100342132 3300005347 Bacteria 1264
17 Ga0070675_100585524 3300005354 Bacteria 1011
18 Ga0070671_100115540 3300005355 Bacteria 2256
19 Ga0070671_100285097 3300005355 Bacteria 1405
20 Ga0070659_100027815 3300005366 Bacteria 4359
21 Ga0070703_10000262 3300005406 Bacteria 25349
22 Ga0070711_100000001 3300005439 Bacteria 370591
23 Ga0070711_100156146 3300005439 Bacteria 1725
24 Ga0070711_100537146 3300005439 Unclassified 968
25 Ga0070694_100083461 3300005444 Bacteria 2227
26 Ga0070694_100086937 3300005444 Bacteria 2186
27 Ga0070694_100575605 3300005444 Bacteria 904
28 Ga0070708_100109566 3300005445 Bacteria 2537
29 Ga0070681_10109854 3300005458 Bacteria 2697
30 Ga0070706_100000180 3300005467 Bacteria 80488
31 Ga0070706_100001428 3300005467 Bacteria 25259
32 Ga0070706_100205344 3300005467 Bacteria 1840
33 Ga0070706_100378808 3300005467 Unclassified 1318
34 Ga0070707_100035108 3300005468 Bacteria 4782
35 Ga0070707_100038480 3300005468 Bacteria 4568
36 Ga0070707_100159306 3300005468 Bacteria 2199
37 Ga0070707_100751999 3300005468 Bacteria 938
38 Ga0070698_100141730 3300005471 Unclassified 2354
39 Ga0070698_100165060 3300005471 Bacteria 2157
40 Ga0070698_100306790 3300005471 Bacteria 1518
41 Ga0070699_100193687 3300005518 Bacteria 1806
42 Ga0070679_100037385 3300005530 Bacteria 4822
43 Ga0070697_100271579 3300005536 Unclassified 1453
44 Ga0070695_100272550 3300005545 Bacteria 1240
45 Ga0070696_100004401 3300005546 Bacteria 9401
46 Ga0070696_100025569 3300005546 Unclassified 4015
47 Ga0070704_100421460 3300005549 Bacteria 1143
48 Ga0070664_100509918 3300005564 Bacteria 1109
49 Ga0068859_100677903 3300005617 Bacteria 1122
50 Ga0068862_100412389 3300005844 Unclassified 1266
51 Ga0068862_100428248 3300005844 Bacteria 1243
52 Ga0081455_10002358 3300005937 Bacteria 22548
53 Ga0081455_10017318 3300005937 Bacteria 6915
54 Ga0081455_10029685 3300005937 Bacteria 4982
55 Ga0081455_10071506 3300005937 Unclassified 2875
56 Ga0081538_10006839 3300005981 Bacteria 9940
57 Ga0081538_10014588 3300005981 Bacteria 6144
58 Ga0081538_10019131 3300005981 Bacteria 5107
59 Ga0081540_1004360 3300005983 Bacteria 10822
60 Ga0081540_1011404 3300005983 Bacteria 5941
61 Ga0081539_10002374 3300005985 Bacteria 26942
62 Ga0081539_10022890 3300005985 Bacteria 4114
63 Ga0070717_10090454 3300006028 Unclassified 2583
64 Ga0075362_10007128 3300006177 Bacteria 4212
65 Ga0075366_10006598 3300006195 Bacteria 6367
66 Ga0097621_100475913 3300006237 Bacteria 1128
67 Ga0075370_10046169 3300006353 Bacteria 2465
68 Ga0075428_100011759 3300006844 Bacteria 9745
69 Ga0075428_100034052 3300006844 Bacteria 5619
70 Ga0075428_100153003 3300006844 Bacteria 2506
71 Ga0075428_100227413 3300006844 Bacteria 2013
72 Ga0075428_100336695 3300006844 Unclassified 1621
73 Ga0075430_100077576 3300006846 Bacteria 2785
74 Ga0075430_100099543 3300006846 Unclassified 2428
75 Ga0075430_100344653 3300006846 Bacteria 1230
76 Ga0075431_100010225 3300006847 Bacteria 9435
77 Ga0075431_100180662 3300006847 Bacteria 2165
78 Ga0075431_100595704 3300006847 Unclassified 1090
79 Ga0075433_10038920 3300006852 Bacteria 4109
80 Ga0075433_10138174 3300006852 Bacteria 2166
81 Ga0075433_10237814 3300006852 Bacteria 1617
82 Ga0075434_100310272 3300006871 Bacteria 1598
83 Ga0075434_100915577 3300006871 Bacteria 892
84 Ga0075429_100010855 3300006880 Bacteria 7876
85 Ga0075429_100120636 3300006880 Bacteria 2292
86 Ga0075429_100307657 3300006880 Bacteria 1387
87 Ga0075436_100171094 3300006914 Unclassified 1534
88 Ga0097620_100677921 3300006931 Bacteria 1122
89 Ga0075435_100289300 3300007076 Bacteria 1400
90 Ga0111539_10020628 3300009094 Bacteria 8116
91 Ga0111539_10130722 3300009094 Unclassified 2940
92 Ga0111539_10133552 3300009094 Bacteria 2906
93 Ga0111539_10216384 3300009094 Bacteria 2231
94 Ga0111539_10252868 3300009094 Bacteria 2052
95 Ga0111539_10260172 3300009094 Bacteria 2020
96 Ga0111539_10381779 3300009094 Bacteria 1640
97 Ga0111539_10932124 3300009094 Bacteria 1010
98 Ga0114129_10007520 3300009147 Bacteria 15520
99 Ga0114129_10009635 3300009147 Bacteria 13780
100 Ga0114129_10012845 3300009147 Bacteria 11917
101 Ga0114129_10019368 3300009147 Bacteria 9692
102 Ga0114129_10026310 3300009147 Bacteria 8240
103 Ga0114129_10053086 3300009147 Bacteria 5685
104 Ga0114129_10127989 3300009147 Unclassified 3490
105 Ga0114129_10248474 3300009147 Unclassified 2389
106 Ga0114129_10289044 3300009147 Unclassified 2188
107 Ga0114129_10316224 3300009147 Bacteria 2077
108 Ga0114129_10391727 3300009147 Unclassified 1832
109 Ga0114129_10660136 3300009147 Bacteria 1349
110 Ga0114129_10770571 3300009147 Unclassified 1230
111 Ga0105243_10159261 3300009148 Bacteria 1945
112 Ga0105248_10103442 3300009177 Bacteria 3210
113 Ga0105249_10165379 3300009553 Unclassified 2141
114 Ga0105246_10319329 3300011119 Bacteria 1261
115 Ga0105246_10547926 3300011119 Bacteria 991
116 Ga0157374_10004788 3300013296 Bacteria 11354
117 Ga0157378_10028181 3300013297 Bacteria 4954
118 Ga0157378_10028292 3300013297 Bacteria 4944
119 Ga0157378_10037617 3300013297 Bacteria 4288
120 Ga0163162_10078416 3300013306 Unclassified 3369
121 Ga0163162_10166211 3300013306 Bacteria 2330
122 Ga0163162_10242627 3300013306 Bacteria 1933
123 Ga0163162_10760674 3300013306 Bacteria 1088
124 Ga0157375_10016110 3300013308 Bacteria 6704
125 Ga0157375_10264378 3300013308 Bacteria 1882
126 Ga0163163_10386509 3300014325 Bacteria 1457
127 Ga0157379_10077562 3300014968 Bacteria 2975
128 Ga0213876_10000089 3300021384 Bacteria 104386
129 Ga0213876_10000866 3300021384 Bacteria 20246
130 Ga0213876_10072936 3300021384 Unclassified 1813
131 Ga0207653_10000120 3300025885 Bacteria 55535
132 Ga0207684_10000388 3300025910 Bacteria 59094
133 Ga0207684_10001707 3300025910 Bacteria 23319
134 Ga0207707_10177175 3300025912 Unclassified 1862
135 Ga0207663_10000001 3300025916 Bacteria 591990
136 Ga0207663_10070759 3300025916 Bacteria 2249
137 Ga0207663_10273804 3300025916 Bacteria 1251
138 Ga0207660_10086800 3300025917 Unclassified 2311
139 Ga0207649_10000542 3300025920 Bacteria 26084
140 Ga0207646_10001728 3300025922 Bacteria 26558
141 Ga0207646_10098107 3300025922 Unclassified 2625
142 Ga0207646_10099119 3300025922 Bacteria 2612
143 Ga0207646_10190848 3300025922 Bacteria 1850
144 Ga0207681_10097318 3300025923 Bacteria 2115
145 Ga0207650_10357260 3300025925 Bacteria 1203
146 Ga0207711_10069921 3300025941 Bacteria 3044
147 Ga0207712_10131479 3300025961 Bacteria 1908
148 Ga0207668_10131329 3300025972 Unclassified 1913
149 Ga0207668_10201023 3300025972 Unclassified 1587
150 Ga0207683_10010159 3300026121 Bacteria 8032
151 Ga0207428_10049221 3300027907 Bacteria 3378
152 Ga0268264_10281144 3300028381 Bacteria 1559
153 Ga0268264_10530649 3300028381 Unclassified 1152
154 Ga0265332_10018142 3300031238 Bacteria 3103
155 Ga0265339_10040200 3300031249 Bacteria 2600
156 Ga0265331_10068484 3300031250 Unclassified 1663
157 Ga0265314_10000897 3300031711 Bacteria 35446
158 Ga0373926_0012016 3300035083 Bacteria 2923
159 Ga0373926_0186402 3300035083 Unclassified 796
160 Ga0373927_0016075 3300035695 Bacteria 4938
161 Ga0436364_0794978 3300037853 Bacteria 1206
162 Ga0436365_0807781 3300039437 Unclassified 3215
163 Ga0436365_1606334 3300039437 Bacteria 14480
164 Ga0436365_1738066 3300039437 Bacteria 103785
165 Ga0436360_0338760 3300039438 Unclassified 3426
166 Ga0436360_0830210 3300039438 Bacteria 2767
167 Ga0436361_0837727 3300039447 Unclassified 1844
168 Ga0436363_0781384 3300039450 Unclassified 1896
169 Ga0439448_0081402 3300042005 Bacteria 1088
170 Ga0439450_007603 3300042008 Bacteria 1992
171 Ga0451577_0480055 3300042876 Unclassified 1128
172 Ga0453684_0335649 3300044712 Unclassified 1708
173 Ga0451576_0815775 3300045051 Bacteria 980
174 Ga0495580_0103662 3300046472 Bacteria 1977
175 Ga0495586_0287960 3300046535 Unclassified 940
176 Ga0496109_0000210 3300048912 Bacteria 57283
177 Ga0501031_0020982 3300049568 Bacteria 4259
178 Ga0501032_0002528 3300049569 Bacteria 14310
179 Ga0501033_0000010 3300049570 Bacteria 270511
180 Ga0501033_0000047 3300049570 Bacteria 122884
181 Ga0501036_0251405 3300049572 Bacteria 1481
182 Ga0501037_0001477 3300049573 Bacteria 17207
183 Ga0501038_0000065 3300049574 Bacteria 86668
184 Ga0501038_0011700 3300049574 Bacteria 8005
185 Ga0501038_0146041 3300049574 Bacteria 1931
186 Ga0501039_0515172 3300049575 Bacteria 939
187 Ga0501043_0065172 3300049579 Bacteria 2860
188 Ga0501043_0073660 3300049579 Bacteria 2682
189 Ga0501047_0006268 3300049581 Bacteria 11179
190 Ga0501069_0089303 3300049585 Unclassified 1742
191 Ga0501070_0004878 3300049586 Bacteria 11463
192 Ga0501071_0037601 3300049587 Bacteria 3457
193 Ga0501071_0464060 3300049587 Bacteria 970
194 Ga0501072_0344441 3300049588 Bacteria 1184
195 Ga0501079_0399617 3300049741 Bacteria 1078
196 Ga0501080_0354806 3300049742 Bacteria 1324
197 Ga0501081_0281923 3300049743 Unclassified 1217
198 Ga0501035_0000004 3300049822 Bacteria 403650
199 Ga0501044_0001446 3300049823 Bacteria 27887
200 Ga0501044_0158696 3300049823 Bacteria 2240
201 Ga0501045_0198291 3300049824 Bacteria 1496
202 Ga0501045_0296311 3300049824 Bacteria 1204
203 nmdc:mga03683_293_c1 3300050489 Bacteria 14883
204 nmdc:mga0k408_104_c3 3300050493 Bacteria 36143
205 nmdc:mga0k408_67471_c1 3300050493 Bacteria 2085
206 nmdc:mga07m45_8083_c1 3300050496 Bacteria 5394
207 nmdc:mga05p37_106697_c1 3300050507 Bacteria 3446
208 nmdc:mga05p37_11534_c1 3300050507 Bacteria 10528
209 nmdc:mga05p37_125531_c1 3300050507 Bacteria 3152
210 nmdc:mga05p37_14578_c1 3300050507 Bacteria 9439
211 nmdc:mga05p37_148245_c1 3300050507 Bacteria 2872
212 nmdc:mga05p37_196235_c1 3300050507 Unclassified 2447
213 nmdc:mga05p37_28995_c1 3300050507 Bacteria 6754
214 nmdc:mga05p37_325_c1 3300050507 Bacteria 11900
215 nmdc:mga05p37_554965_c1 3300050507 Bacteria 1307
216 nmdc:mga05p37_576102_c1 3300050507 Unclassified 1276
217 nmdc:mga05p37_597222_c1 3300050507 Bacteria 1247
218 nmdc:mga05p37_76261_c1 3300050507 Bacteria 4128
219 nmdc:mga05p37_777440_c1 3300050507 Bacteria 1051
220 nmdc:mga05p37_978357_c1 3300050507 Unclassified 902
221 nmdc:mga09592_123872_c1 3300050508 Bacteria 2221
222 nmdc:mga09592_12752_c1 3300050508 Bacteria 6852
223 nmdc:mga09592_565712_c1 3300050508 Unclassified 976
224 nmdc:mga09592_82319_c1 3300050508 Unclassified 2743
225 nmdc:mga0qj67_179385_c1 3300050509 Bacteria 1720
226 nmdc:mga0qj67_224536_c1 3300050509 Unclassified 1524
227 nmdc:mga0qj67_281820_c1 3300050509 Unclassified 1347
228 nmdc:mga06r32_115153_c1 3300050510 Unclassified 2647
229 nmdc:mga06r32_144069_c1 3300050510 Unclassified 2360
230 nmdc:mga06r32_2530_c1 3300050510 Bacteria 16356
231 nmdc:mga08y16_32881_c1 3300050511 Bacteria 5452
232 nmdc:mga08y16_413757_c1 3300050511 Bacteria 1379
233 nmdc:mga08y16_78406_c1 3300050511 Bacteria 3444
234 nmdc:mga0n895_233116_c1 3300050512 Bacteria 1868
235 nmdc:mga0n895_23444_c1 3300050512 Bacteria 5800
236 nmdc:mga0n895_72263_c1 3300050512 Bacteria 3422
237 nmdc:mga0n895_80518_c1 3300050512 Unclassified 3245
238 nmdc:mga0n895_92644_c1 3300050512 Bacteria 3025
239 nmdc:mga0rr50_259581_c1 3300050513 Unclassified 1445
240 nmdc:mga0rr50_280230_c1 3300050513 Bacteria 1391
241 nmdc:mga0rr50_311051_c1 3300050513 Bacteria 1319
242 nmdc:mga0rr50_31840_c1 3300050513 Bacteria 3750
243 nmdc:mga0rr50_616918_c1 3300050513 Unclassified 925
244 nmdc:mga08x19_154254_c1 3300050514 Unclassified 1557
245 nmdc:mga08x19_386698_c1 3300050514 Unclassified 980
246 nmdc:mga0a205_13333_c1 3300050515 Bacteria 7647
247 nmdc:mga0a205_137470_c1 3300050515 Bacteria 2344
248 nmdc:mga0a205_228582_c1 3300050515 Bacteria 1744
249 nmdc:mga0a205_66565_c1 3300050515 Unclassified 3481
250 nmdc:mga0a205_66816_c1 3300050515 Bacteria 3474
251 nmdc:mga0a205_67019_c1 3300050515 Bacteria 3468
252 Ga0500555_000229 3300053103 Bacteria 25066
253 Ga0500556_0000203 3300053104 Bacteria 48653
254 Ga0500658_0254492 3300053134 Unclassified 807
255 Ga0500645_011025 3300053730 Unclassified 2967
256 Ga0501084_0099666 3300054114 Bacteria 2440
257 Ga0501084_0236373 3300054114 Bacteria 1542
258 Ga0501082_0064970 3300060353 Bacteria 3143
259 Ga0466962_0000034 3300061719 Bacteria 64306
260 Ga0530510_0181085 3300061734 Bacteria 1563
261 Ga0070707_100037318
262 JGI24743J22301_10000220
263 JGI24033J26618_1000248
264 rootH1_10122231
265 rootH2_10006252
266 rootL2_10147361
267 rootL2_10221134
268 Ga0058859_10034956
269 Ga0058860_12225860
270 Ga0065704_10009431
271 Ga0065707_10015800
272 Ga0070690_100312247
273 Ga0070670_100583815
274 Ga0070680_100110445
275 Ga0070661_100000325
276 Ga0070668_100342132
277 Ga0070675_100585524
278 Ga0070671_100115540
279 Ga0070671_100285097
280 Ga0070659_100027815
281 Ga0070703_10000262
282 Ga0070711_100000001
283 Ga0070711_100156146
284 Ga0070711_100537146
285 Ga0070694_100083461
286 Ga0070694_100086937
287 Ga0070694_100575605
288 Ga0070708_100109566
289 Ga0070681_10109854
290 Ga0070706_100000180
291 Ga0070706_100001428
292 Ga0070706_100205344
293 Ga0070706_100378808
294 Ga0070707_100035108
295 Ga0070707_100038480
296 Ga0070707_100159306
297 Ga0070707_100751999
298 Ga0070698_100141730
299 Ga0070698_100165060
300 Ga0070698_100306790
301 Ga0070699_100193687
302 Ga0070679_100037385
303 Ga0070697_100271579
304 Ga0070695_100272550
305 Ga0070696_100004401
306 Ga0070696_100025569
307 Ga0070704_100421460
308 Ga0070664_100509918
309 Ga0068859_100677903
310 Ga0068862_100412389
311 Ga0068862_100428248
312 Ga0081455_10002358
313 Ga0081455_10017318
314 Ga0081455_10029685
315 Ga0081455_10071506
316 Ga0081538_10006839
317 Ga0081538_10014588
318 Ga0081538_10019131
319 Ga0081540_1004360
320 Ga0081540_1011404
321 Ga0081539_10002374
322 Ga0081539_10022890
323 Ga0070717_10090454
324 Ga0075362_10007128
325 Ga0075366_10006598
326 Ga0097621_100475913
327 Ga0075370_10046169
328 Ga0075428_100011759
329 Ga0075428_100034052
330 Ga0075428_100153003
331 Ga0075428_100227413
332 Ga0075428_100336695
333 Ga0075430_100077576
334 Ga0075430_100099543
335 Ga0075430_100344653
336 Ga0075431_100010225
337 Ga0075431_100180662
338 Ga0075431_100595704
339 Ga0075433_10038920
340 Ga0075433_10138174
341 Ga0075433_10237814
342 Ga0075434_100310272
343 Ga0075434_100915577
344 Ga0075429_100010855
345 Ga0075429_100120636
346 Ga0075429_100307657
347 Ga0075436_100171094
348 Ga0097620_100677921
349 Ga0075435_100289300
350 Ga0111539_10020628
351 Ga0111539_10130722
352 Ga0111539_10133552
353 Ga0111539_10216384
354 Ga0111539_10252868
355 Ga0111539_10260172
356 Ga0111539_10381779
357 Ga0111539_10932124
358 Ga0114129_10007520
359 Ga0114129_10009635
360 Ga0114129_10012845
361 Ga0114129_10019368
362 Ga0114129_10026310
363 Ga0114129_10053086
364 Ga0114129_10127989
365 Ga0114129_10248474
366 Ga0114129_10289044
367 Ga0114129_10316224
368 Ga0114129_10391727
369 Ga0114129_10660136
370 Ga0114129_10770571
371 Ga0105243_10159261
372 Ga0105248_10103442
373 Ga0105249_10165379
374 Ga0105246_10319329
375 Ga0105246_10547926
376 Ga0157374_10004788
377 Ga0157378_10028181
378 Ga0157378_10028292
379 Ga0157378_10037617
380 Ga0163162_10078416
381 Ga0163162_10166211
382 Ga0163162_10242627
383 Ga0163162_10760674
384 Ga0157375_10016110
385 Ga0157375_10264378
386 Ga0163163_10386509
387 Ga0157379_10077562
388 Ga0213876_10000089
389 Ga0213876_10000866
390 Ga0213876_10072936
391 Ga0207653_10000120
392 Ga0207684_10000388
393 Ga0207684_10001707
394 Ga0207707_10177175
395 Ga0207663_10000001
396 Ga0207663_10070759
397 Ga0207663_10273804
398 Ga0207660_10086800
399 Ga0207649_10000542
400 Ga0207646_10001728
401 Ga0207646_10098107
402 Ga0207646_10099119
403 Ga0207646_10190848
404 Ga0207681_10097318
405 Ga0207650_10357260
406 Ga0207711_10069921
407 Ga0207712_10131479
408 Ga0207668_10131329
409 Ga0207668_10201023
410 Ga0207683_10010159
411 Ga0207428_10049221
412 Ga0268264_10281144
413 Ga0268264_10530649
414 Ga0265332_10018142
415 Ga0265339_10040200
416 Ga0265331_10068484
417 Ga0265314_10000897
418 Ga0373926_0012016
419 Ga0373926_0186402
420 Ga0373927_0016075
421 Ga0436364_0794978
422 Ga0436365_0807781
423 Ga0436365_1606334
424 Ga0436365_1738066
425 Ga0436360_0338760
426 Ga0436360_0830210
427 Ga0436361_0837727
428 Ga0436363_0781384
429 Ga0439448_0081402
430 Ga0439450_007603
431 Ga0451577_0480055
432 Ga0453684_0335649
433 Ga0451576_0815775
434 Ga0495580_0103662
435 Ga0495586_0287960
436 Ga0496109_0000210
437 Ga0501031_0020982
438 Ga0501032_0002528
439 Ga0501033_0000010
440 Ga0501033_0000047
441 Ga0501036_0251405
442 Ga0501037_0001477
443 Ga0501038_0000065
444 Ga0501038_0011700
445 Ga0501038_0146041
446 Ga0501039_0515172
447 Ga0501043_0065172
448 Ga0501043_0073660
449 Ga0501047_0006268
450 Ga0501069_0089303
451 Ga0501070_0004878
452 Ga0501071_0037601
453 Ga0501071_0464060
454 Ga0501072_0344441
455 Ga0501079_0399617
456 Ga0501080_0354806
457 Ga0501081_0281923
458 Ga0501035_0000004
459 Ga0501044_0001446
460 Ga0501044_0158696
461 Ga0501045_0198291
462 Ga0501045_0296311
463 nmdc:mga03683_293_c1
464 nmdc:mga0k408_104_c3
465 nmdc:mga0k408_67471_c1
466 nmdc:mga07m45_8083_c1
467 nmdc:mga05p37_106697_c1
468 nmdc:mga05p37_11534_c1
469 nmdc:mga05p37_125531_c1
470 nmdc:mga05p37_14578_c1
471 nmdc:mga05p37_148245_c1
472 nmdc:mga05p37_196235_c1
473 nmdc:mga05p37_28995_c1
474 nmdc:mga05p37_325_c1
475 nmdc:mga05p37_554965_c1
476 nmdc:mga05p37_576102_c1
477 nmdc:mga05p37_597222_c1
478 nmdc:mga05p37_76261_c1
479 nmdc:mga05p37_777440_c1
480 nmdc:mga05p37_978357_c1
481 nmdc:mga09592_123872_c1
482 nmdc:mga09592_12752_c1
483 nmdc:mga09592_565712_c1
484 nmdc:mga09592_82319_c1
485 nmdc:mga0qj67_179385_c1
486 nmdc:mga0qj67_224536_c1
487 nmdc:mga0qj67_281820_c1
488 nmdc:mga06r32_115153_c1
489 nmdc:mga06r32_144069_c1
490 nmdc:mga06r32_2530_c1
491 nmdc:mga08y16_32881_c1
492 nmdc:mga08y16_413757_c1
493 nmdc:mga08y16_78406_c1
494 nmdc:mga0n895_233116_c1
495 nmdc:mga0n895_23444_c1
496 nmdc:mga0n895_72263_c1
497 nmdc:mga0n895_80518_c1
498 nmdc:mga0n895_92644_c1
499 nmdc:mga0rr50_259581_c1
500 nmdc:mga0rr50_280230_c1
501 nmdc:mga0rr50_311051_c1
502 nmdc:mga0rr50_31840_c1
503 nmdc:mga0rr50_616918_c1
504 nmdc:mga08x19_154254_c1
505 nmdc:mga08x19_386698_c1
506 nmdc:mga0a205_13333_c1
507 nmdc:mga0a205_137470_c1
508 nmdc:mga0a205_228582_c1
509 nmdc:mga0a205_66565_c1
510 nmdc:mga0a205_66816_c1
511 nmdc:mga0a205_67019_c1
512 Ga0500555_000229
513 Ga0500556_0000203
514 Ga0500658_0254492
515 Ga0500645_011025
516 Ga0501084_0099666
517 Ga0501084_0236373
518 Ga0501082_0064970
519 Ga0466962_0000034
520 Ga0530510_0181085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hcr-assembly1.cif.gz_T cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.7346 17 68
7sau-assembly1.cif.gz_D structure of gldlm, the proton-powered motor that drives type ix protein secretion and gliding motility in schleiferia thermophila 0.6556 22 68
4de6-assembly1.cif.gz_A horse spleen apo-ferritin complex with arachidonic acid 0.5134 22 76
7sau-assembly1.cif.gz_D structure of gldlm, the proton-powered motor that drives type ix protein secretion and gliding motility in schleiferia thermophila 0.4544 22 68
6wve-assembly1.cif.gz_A chicken spcs1 0.4081 13 73
ID Description Score Start End Superfamily
af_A4IDR5_133_225_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8109 20 68 1.20.1280.290
2yevD02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6986 15 67 1.10.287.70
6hu9o01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5929 1 63 1.10.287.70
2yevD02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5294 15 67 1.10.287.70
6hu9o01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4908 1 63 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2V6BEB7-F1-model_v4 Cytochrome c oxidase polypeptide IV 0.8816 7 63 GO:0016020
AF-A0A3D0D173-F1-model_v4 Cytochrome aa3 subunit 4 0.8764 8 63 GO:0016020
AF-A0A4Z0ESC6-F1-model_v4 Cytochrome c oxidase polypeptide IV 0.8628 7 63
AF-A0A536CMJ2-F1-model_v4 Uncharacterized protein 0.8563 15 61 GO:0016020
AF-A0A3M1ELG9-F1-model_v4 DUF1440 domain-containing protein 0.8281 110 251 GO:0016020

Map