F367196

General Info

Members Datasets Scaffolds Average Seq Length
257 169 514 153

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10030883|Ga0075368_100308833
Length 186
Sequence VAPADRSDRHRHGNSSRIIADPASFVEGREPVRVPRLLIVHHTPSPAVHALLDAARTGATDPSIEGVEVVARAALAATAVDVLEADGYLLGTPANLGYVSGALKHFFDQIYYPCLEDTQGRPYGLFVHGGSDTTGAVKAVEKITTGLRWNLAQPVLEVTGAPDKAALDQAWELGAALAALLSEDLA

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
69 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
70 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
71 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
72 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
73 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
96 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
97 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
98 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
99 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
169 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 0
Rhizoplane 1.95
Rhizosphere 85.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10030883 3300006042 Bacteria 2076
2 Ga0070676_11398503 3300005328 Bacteria 537
3 Ga0070690_100434784 3300005330 Bacteria 970
4 Ga0070670_100331736 3300005331 Bacteria 1334
5 Ga0070670_101025021 3300005331 Bacteria 751
6 Ga0068869_100551468 3300005334 Bacteria 968
7 Ga0068868_100105011 3300005338 Bacteria 2290
8 Ga0070668_100482849 3300005347 Bacteria 1070
9 Ga0070714_100153570 3300005435 Bacteria 2077
10 Ga0070714_100584905 3300005435 Bacteria 1071
11 Ga0070714_100749559 3300005435 Bacteria 944
12 Ga0070700_100490354 3300005441 Bacteria 943
13 Ga0070708_100039203 3300005445 Bacteria 4143
14 Ga0070678_100719702 3300005456 Bacteria 901
15 Ga0070681_10399572 3300005458 Bacteria 1285
16 Ga0068867_100357626 3300005459 Bacteria 1220
17 Ga0070698_100232804 3300005471 Bacteria 1775
18 Ga0070679_100503546 3300005530 Bacteria 1155
19 Ga0070679_101610414 3300005530 Bacteria 597
20 Ga0070697_100648690 3300005536 Bacteria 929
21 Ga0068853_100726838 3300005539 Bacteria 948
22 Ga0068855_100348673 3300005563 Bacteria 1631
23 Ga0068855_101104305 3300005563 Bacteria 829
24 Ga0081455_10031337 3300005937 Bacteria 4813
25 Ga0081538_10000670 3300005981 Bacteria 37668
26 Ga0081538_10100557 3300005981 Bacteria 1458
27 Ga0075365_10002788 3300006038 Bacteria 8737
28 Ga0075365_10005943 3300006038 Bacteria 6651
29 Ga0075365_10196412 3300006038 Bacteria 1413
30 Ga0075365_10788139 3300006038 Bacteria 671
31 Ga0075364_10100084 3300006051 Bacteria 1930
32 Ga0075364_10104505 3300006051 Bacteria 1887
33 Ga0075367_10078511 3300006178 Bacteria 1994
34 Ga0075367_10561332 3300006178 Bacteria 725
35 Ga0075428_100221192 3300006844 Bacteria 2044
36 Ga0075431_100001195 3300006847 Bacteria 23439
37 Ga0075431_100710434 3300006847 Bacteria 982
38 Ga0075429_100003839 3300006880 Bacteria 12830
39 Ga0075436_100693743 3300006914 Bacteria 754
40 Ga0111539_10248406 3300009094 Bacteria 2072
41 Ga0114129_10357817 3300009147 Bacteria 1932
42 Ga0114129_10530128 3300009147 Bacteria 1534
43 Ga0114129_11229049 3300009147 Bacteria 932
44 Ga0105249_11555792 3300009553 Bacteria 734
45 Ga0157369_11715232 3300013105 Bacteria 638
46 Ga0157378_10372978 3300013297 Bacteria 1399
47 Ga0157378_10547037 3300013297 Bacteria 1162
48 Ga0157378_11496667 3300013297 Bacteria 719
49 Ga0157378_11880303 3300013297 Bacteria 647
50 Ga0157372_10723160 3300013307 Bacteria 1158
51 Ga0157372_10889595 3300013307 Bacteria 1033
52 Ga0213874_10222625 3300021377 Bacteria 686
53 Ga0213876_10008576 3300021384 Bacteria 5534
54 Ga0213875_10071353 3300021388 Bacteria 1621
55 Ga0207645_10541298 3300025907 Bacteria 789
56 Ga0207643_10575425 3300025908 Bacteria 724
57 Ga0207705_10438356 3300025909 Bacteria 1012
58 Ga0207707_10407784 3300025912 Bacteria 1166
59 Ga0207707_10565970 3300025912 Bacteria 965
60 Ga0207707_11002642 3300025912 Bacteria 685
61 Ga0207659_10302057 3300025926 Bacteria 1315
62 Ga0207664_10183657 3300025929 Bacteria 1796
63 Ga0207664_11317309 3300025929 Bacteria 642
64 Ga0207691_10168962 3300025940 Bacteria 1916
65 Ga0207667_10592093 3300025949 Bacteria 1119
66 Ga0207667_10593062 3300025949 Bacteria 1118
67 Ga0207668_10069720 3300025972 Bacteria 2504
68 Ga0207668_10092717 3300025972 Bacteria 2224
69 Ga0207640_11525979 3300025981 Bacteria 601
70 Ga0207677_10182071 3300026023 Bacteria 1654
71 Ga0207648_10494275 3300026089 Bacteria 1119
72 Ga0207675_102220858 3300026118 Bacteria 564
73 Ga0207683_10032845 3300026121 Bacteria 4508
74 Ga0207683_10515700 3300026121 Bacteria 1105
75 Ga0209813_10027475 3300027866 Bacteria 1652
76 Ga0207428_10335321 3300027907 Bacteria 1115
77 Ga0307515_10087566 3300028794 Bacteria 3950
78 Ga0307513_10170799 3300031456 Bacteria 2052
79 Ga0316579_10014704 3300031691 Bacteria 3390
80 Ga0316579_10077046 3300031691 Bacteria 1585
81 Ga0316576_10012396 3300031727 Bacteria 5628
82 Ga0316578_10005632 3300031728 Bacteria 6098
83 Ga0316578_10072988 3300031728 Bacteria 2033
84 Ga0316577_10095982 3300031733 Bacteria 1660
85 Ga0307413_10737224 3300031824 Bacteria 822
86 Ga0307410_10133790 3300031852 Bacteria 1825
87 Ga0307410_11264270 3300031852 Bacteria 645
88 Ga0326468_10007937 3300031889 Bacteria 1018
89 Ga0307406_10647045 3300031901 Bacteria 877
90 Ga0307406_11526006 3300031901 Bacteria 588
91 Ga0307407_10106597 3300031903 Bacteria 1751
92 Ga0307407_10648229 3300031903 Bacteria 791
93 Ga0307409_101946725 3300031995 Bacteria 617
94 Ga0307416_100399100 3300032002 Bacteria 1412
95 Ga0307414_10826994 3300032004 Bacteria 846
96 Ga0307415_100022501 3300032126 Bacteria 3891
97 Ga0316583_10052955 3300032133 Bacteria 1427
98 Ga0316585_10016726 3300032137 Bacteria 2211
99 Ga0316585_10026440 3300032137 Bacteria 1806
100 Ga0316580_10011045 3300032139 Bacteria 2736
101 Ga0316580_10191255 3300032139 Bacteria 630
102 Ga0373928_0000670 3300035084 Bacteria 6717
103 Ga0373929_0002956 3300035085 Bacteria 3094
104 Ga0373932_0001333 3300035112 Bacteria 6925
105 Ga0373943_0021561 3300035170 Bacteria 2976
106 Ga0316574_0013800 3300035398 Bacteria 4653
107 Ga0316574_0101122 3300035398 Bacteria 1845
108 Ga0373931_0000032 3300035691 Bacteria 96498
109 Ga0373935_0272684 3300035692 Bacteria 1189
110 Ga0373947_0023629 3300035725 Bacteria 3578
111 Ga0316582_0044335 3300036647 Bacteria 2795
112 Ga0316584_0000987 3300036712 Bacteria 16361
113 Ga0316584_0119328 3300036712 Bacteria 1971
114 Ga0373925_0065651 3300037068 Bacteria 2734
115 Ga0395898_0122582 3300037466 Bacteria 2491
116 Ga0395905_1065962 3300037471 Bacteria 711
117 Ga0316581_0000038 3300037588 Bacteria 14543
118 Ga0436364_0409895 3300037853 Bacteria 1633
119 Ga0395901_1010311 3300038443 Bacteria 807
120 Ga0436365_0078484 3300039437 Bacteria 3508
121 Ga0436365_1378611 3300039437 Bacteria 178407
122 Ga0436363_0249723 3300039450 Bacteria 869
123 Ga0436362_0166685 3300039453 Bacteria 7946
124 Ga0451789_1319443 3300041443 Bacteria 583
125 Ga0451837_0666251 3300041494 Bacteria 2213
126 Ga0451845_0651163 3300041501 Bacteria 898
127 Ga0451853_3120928 3300041512 Bacteria 736
128 Ga0439448_0185018 3300042005 Bacteria 728
129 Ga0439450_002152 3300042008 Bacteria 3042
130 Ga0439455_0088156 3300042012 Bacteria 849
131 Ga0439463_010780 3300042016 Bacteria 2247
132 Ga0439460_0019878 3300042461 Bacteria 1822
133 Ga0439440_0101651 3300042993 Bacteria 783
134 Ga0466969_0095528 3300044656 Bacteria 1404
135 Ga0466972_0004020 3300044658 Bacteria 7331
136 Ga0466965_0004539 3300044683 Bacteria 6177
137 Ga0466968_0113644 3300044735 Bacteria 1219
138 Ga0466968_0332823 3300044735 Bacteria 735
139 Ga0466960_0004677 3300044901 Bacteria 5366
140 Ga0466958_0114818 3300045836 Bacteria 1682
141 Ga0466967_0004474 3300045976 Bacteria 9434
142 Ga0466967_0034057 3300045976 Bacteria 4319
143 Ga0466967_0356483 3300045976 Bacteria 1416
144 Ga0495651_0678381 3300046462 Bacteria 644
145 Ga0495630_0178252 3300046517 Bacteria 1620
146 Ga0495630_0438067 3300046517 Bacteria 1001
147 Ga0495667_0245789 3300046559 Bacteria 1139
148 Ga0495657_0111540 3300046675 Bacteria 1732
149 Ga0495657_0406434 3300046675 Bacteria 801
150 Ga0495658_0338293 3300046683 Bacteria 956
151 Ga0495613_0269350 3300046689 Bacteria 1185
152 Ga0495624_0140606 3300046690 Bacteria 1479
153 Ga0495604_0475657 3300047317 Bacteria 813
154 Ga0495680_0501133 3300047322 Bacteria 824
155 Ga0495673_0245730 3300047469 Bacteria 655
156 Ga0495684_0735271 3300047471 Bacteria 651
157 Ga0496101_1369971 3300048904 Bacteria 552
158 Ga0496108_0234413 3300048911 Bacteria 1596
159 Ga0496109_0079254 3300048912 Bacteria 3026
160 Ga0496109_0517090 3300048912 Bacteria 1127
161 Ga0496126_0103632 3300048929 Bacteria 2486
162 Ga0496126_0387809 3300048929 Bacteria 1136
163 Ga0501031_0034920 3300049568 Bacteria 3281
164 Ga0501033_0002373 3300049570 Bacteria 16050
165 Ga0501033_0041348 3300049570 Bacteria 3440
166 Ga0501033_0822682 3300049570 Bacteria 627
167 Ga0501034_0079323 3300049571 Bacteria 3287
168 Ga0501034_0500588 3300049571 Bacteria 1129
169 Ga0501036_0010091 3300049572 Bacteria 7783
170 Ga0501036_0018028 3300049572 Bacteria 5910
171 Ga0501037_0040901 3300049573 Bacteria 3411
172 Ga0501037_0158618 3300049573 Bacteria 1614
173 Ga0501037_0509867 3300049573 Bacteria 815
174 Ga0501037_0854416 3300049573 Bacteria 598
175 Ga0501038_0023779 3300049574 Bacteria 5474
176 Ga0501040_0004726 3300049576 Bacteria 8843
177 Ga0501040_0324409 3300049576 Bacteria 1101
178 Ga0501041_0003216 3300049577 Bacteria 9389
179 Ga0501041_0008661 3300049577 Bacteria 5993
180 Ga0501042_0007827 3300049578 Bacteria 7024
181 Ga0501042_0180065 3300049578 Bacteria 1525
182 Ga0501046_0015010 3300049580 Bacteria 6516
183 Ga0501047_0286021 3300049581 Bacteria 1493
184 Ga0501047_0526867 3300049581 Bacteria 1007
185 Ga0501048_0051532 3300049582 Bacteria 2930
186 Ga0501048_0312974 3300049582 Bacteria 1118
187 Ga0501068_0022353 3300049584 Bacteria 3698
188 Ga0501069_0023571 3300049585 Bacteria 3357
189 Ga0501070_0005619 3300049586 Bacteria 10690
190 Ga0501071_0178724 3300049587 Bacteria 1589
191 Ga0501071_0213558 3300049587 Bacteria 1451
192 Ga0501072_0000818 3300049588 Bacteria 22875
193 Ga0501072_0043331 3300049588 Bacteria 3537
194 Ga0501072_0571074 3300049588 Bacteria 892
195 Ga0501072_0719144 3300049588 Bacteria 784
196 Ga0501073_0674184 3300049589 Bacteria 713
197 Ga0501074_0028437 3300049590 Bacteria 4052
198 Ga0501074_0202341 3300049590 Bacteria 1415
199 Ga0501075_0013631 3300049591 Bacteria 5805
200 Ga0501075_1294250 3300049591 Bacteria 552
201 Ga0501076_0002912 3300049592 Bacteria 11860
202 Ga0501076_0031171 3300049592 Bacteria 4157
203 Ga0501076_0045951 3300049592 Bacteria 3449
204 Ga0501076_0536440 3300049592 Bacteria 965
205 Ga0501077_0001826 3300049593 Bacteria 12871
206 Ga0501077_0023031 3300049593 Bacteria 3950
207 Ga0501077_0120086 3300049593 Bacteria 1665
208 Ga0501077_0554613 3300049593 Bacteria 737
209 Ga0501079_0007903 3300049741 Bacteria 8061
210 Ga0501079_0088912 3300049741 Bacteria 2392
211 Ga0501079_1471740 3300049741 Bacteria 536
212 Ga0501080_0005858 3300049742 Bacteria 11001
213 Ga0501080_0151148 3300049742 Bacteria 2146
214 Ga0501080_0531133 3300049742 Bacteria 1049
215 Ga0501081_0063881 3300049743 Bacteria 2555
216 Ga0501081_0654126 3300049743 Bacteria 788
217 Ga0501083_0214771 3300049744 Bacteria 1254
218 Ga0501083_0358045 3300049744 Bacteria 949
219 Ga0501044_0308392 3300049823 Bacteria 1510
220 Ga0501044_0806201 3300049823 Bacteria 818
221 Ga0501045_0009448 3300049824 Bacteria 6823
222 Ga0501045_0090162 3300049824 Bacteria 2265
223 nmdc:mga00v17_718572_c1 3300050491 Bacteria 640
224 nmdc:mga00v17_72900_c1 3300050491 Bacteria 2131
225 nmdc:mga0yw44_300036_c1 3300050492 Bacteria 1076
226 nmdc:mga0yw44_370_c1 3300050492 Bacteria 15687
227 nmdc:mga0yw44_843_c1 3300050492 Bacteria 11462
228 nmdc:mga0k408_680661_c1 3300050493 Bacteria 603
229 nmdc:mga04h51_21086_c1 3300050495 Bacteria 1956
230 nmdc:mga05p37_865145_c1 3300050507 Bacteria 980
231 nmdc:mga05p37_950435_c1 3300050507 Bacteria 920
232 nmdc:mga09592_3849_c1 3300050508 Bacteria 12085
233 nmdc:mga0qj67_565256_c1 3300050509 Bacteria 911
234 nmdc:mga06r32_1221034_c1 3300050510 Bacteria 697
235 nmdc:mga06r32_360782_c1 3300050510 Bacteria 1437
236 nmdc:mga06r32_43300_c1 3300050510 Bacteria 4284
237 nmdc:mga06r32_548347_c1 3300050510 Bacteria 1130
238 nmdc:mga06r32_90413_c1 3300050510 Bacteria 2991
239 nmdc:mga06r32_920_c1 3300050510 Bacteria 26138
240 nmdc:mga08y16_895591_c1 3300050511 Bacteria 874
241 nmdc:mga08x19_580200_c1 3300050514 Bacteria 794
242 nmdc:mga0sz30_109935_c1 3300050516 Bacteria 1208
243 Ga0495601_0059102 3300053077 Bacteria 2430
244 Ga0495619_0008214 3300053085 Bacteria 6602
245 Ga0495619_0186815 3300053085 Bacteria 1434
246 Ga0495619_0361359 3300053085 Bacteria 1004
247 Ga0500566_0001132 3300053094 Bacteria 15471
248 Ga0501084_0001617 3300054114 Bacteria 17846
249 Ga0501084_0372082 3300054114 Bacteria 1207
250 Ga0501082_0008444 3300060353 Bacteria 8883
251 Ga0501082_0752616 3300060353 Bacteria 853
252 Ga0466962_0252008 3300061719 Bacteria 868
253 Ga0530510_0001866 3300061734 Bacteria 14407
254 Ga0530510_0034023 3300061734 Bacteria 3670
255 Ga0530510_0328648 3300061734 Bacteria 1147
256 2676489909 2675903060 Bacteria 10051191
257 2753074288 2751185734 Bacteria 8863695
258 Ga0075368_10030883
259 Ga0070676_11398503
260 Ga0070690_100434784
261 Ga0070670_100331736
262 Ga0070670_101025021
263 Ga0068869_100551468
264 Ga0068868_100105011
265 Ga0070668_100482849
266 Ga0070714_100153570
267 Ga0070714_100584905
268 Ga0070714_100749559
269 Ga0070700_100490354
270 Ga0070708_100039203
271 Ga0070678_100719702
272 Ga0070681_10399572
273 Ga0068867_100357626
274 Ga0070698_100232804
275 Ga0070679_100503546
276 Ga0070679_101610414
277 Ga0070697_100648690
278 Ga0068853_100726838
279 Ga0068855_100348673
280 Ga0068855_101104305
281 Ga0081455_10031337
282 Ga0081538_10000670
283 Ga0081538_10100557
284 Ga0075365_10002788
285 Ga0075365_10005943
286 Ga0075365_10196412
287 Ga0075365_10788139
288 Ga0075364_10100084
289 Ga0075364_10104505
290 Ga0075367_10078511
291 Ga0075367_10561332
292 Ga0075428_100221192
293 Ga0075431_100001195
294 Ga0075431_100710434
295 Ga0075429_100003839
296 Ga0075436_100693743
297 Ga0111539_10248406
298 Ga0114129_10357817
299 Ga0114129_10530128
300 Ga0114129_11229049
301 Ga0105249_11555792
302 Ga0157369_11715232
303 Ga0157378_10372978
304 Ga0157378_10547037
305 Ga0157378_11496667
306 Ga0157378_11880303
307 Ga0157372_10723160
308 Ga0157372_10889595
309 Ga0213874_10222625
310 Ga0213876_10008576
311 Ga0213875_10071353
312 Ga0207645_10541298
313 Ga0207643_10575425
314 Ga0207705_10438356
315 Ga0207707_10407784
316 Ga0207707_10565970
317 Ga0207707_11002642
318 Ga0207659_10302057
319 Ga0207664_10183657
320 Ga0207664_11317309
321 Ga0207691_10168962
322 Ga0207667_10592093
323 Ga0207667_10593062
324 Ga0207668_10069720
325 Ga0207668_10092717
326 Ga0207640_11525979
327 Ga0207677_10182071
328 Ga0207648_10494275
329 Ga0207675_102220858
330 Ga0207683_10032845
331 Ga0207683_10515700
332 Ga0209813_10027475
333 Ga0207428_10335321
334 Ga0307515_10087566
335 Ga0307513_10170799
336 Ga0316579_10014704
337 Ga0316579_10077046
338 Ga0316576_10012396
339 Ga0316578_10005632
340 Ga0316578_10072988
341 Ga0316577_10095982
342 Ga0307413_10737224
343 Ga0307410_10133790
344 Ga0307410_11264270
345 Ga0326468_10007937
346 Ga0307406_10647045
347 Ga0307406_11526006
348 Ga0307407_10106597
349 Ga0307407_10648229
350 Ga0307409_101946725
351 Ga0307416_100399100
352 Ga0307414_10826994
353 Ga0307415_100022501
354 Ga0316583_10052955
355 Ga0316585_10016726
356 Ga0316585_10026440
357 Ga0316580_10011045
358 Ga0316580_10191255
359 Ga0373928_0000670
360 Ga0373929_0002956
361 Ga0373932_0001333
362 Ga0373943_0021561
363 Ga0316574_0013800
364 Ga0316574_0101122
365 Ga0373931_0000032
366 Ga0373935_0272684
367 Ga0373947_0023629
368 Ga0316582_0044335
369 Ga0316584_0000987
370 Ga0316584_0119328
371 Ga0373925_0065651
372 Ga0395898_0122582
373 Ga0395905_1065962
374 Ga0316581_0000038
375 Ga0436364_0409895
376 Ga0395901_1010311
377 Ga0436365_0078484
378 Ga0436365_1378611
379 Ga0436363_0249723
380 Ga0436362_0166685
381 Ga0451789_1319443
382 Ga0451837_0666251
383 Ga0451845_0651163
384 Ga0451853_3120928
385 Ga0439448_0185018
386 Ga0439450_002152
387 Ga0439455_0088156
388 Ga0439463_010780
389 Ga0439460_0019878
390 Ga0439440_0101651
391 Ga0466969_0095528
392 Ga0466972_0004020
393 Ga0466965_0004539
394 Ga0466968_0113644
395 Ga0466968_0332823
396 Ga0466960_0004677
397 Ga0466958_0114818
398 Ga0466967_0004474
399 Ga0466967_0034057
400 Ga0466967_0356483
401 Ga0495651_0678381
402 Ga0495630_0178252
403 Ga0495630_0438067
404 Ga0495667_0245789
405 Ga0495657_0111540
406 Ga0495657_0406434
407 Ga0495658_0338293
408 Ga0495613_0269350
409 Ga0495624_0140606
410 Ga0495604_0475657
411 Ga0495680_0501133
412 Ga0495673_0245730
413 Ga0495684_0735271
414 Ga0496101_1369971
415 Ga0496108_0234413
416 Ga0496109_0079254
417 Ga0496109_0517090
418 Ga0496126_0103632
419 Ga0496126_0387809
420 Ga0501031_0034920
421 Ga0501033_0002373
422 Ga0501033_0041348
423 Ga0501033_0822682
424 Ga0501034_0079323
425 Ga0501034_0500588
426 Ga0501036_0010091
427 Ga0501036_0018028
428 Ga0501037_0040901
429 Ga0501037_0158618
430 Ga0501037_0509867
431 Ga0501037_0854416
432 Ga0501038_0023779
433 Ga0501040_0004726
434 Ga0501040_0324409
435 Ga0501041_0003216
436 Ga0501041_0008661
437 Ga0501042_0007827
438 Ga0501042_0180065
439 Ga0501046_0015010
440 Ga0501047_0286021
441 Ga0501047_0526867
442 Ga0501048_0051532
443 Ga0501048_0312974
444 Ga0501068_0022353
445 Ga0501069_0023571
446 Ga0501070_0005619
447 Ga0501071_0178724
448 Ga0501071_0213558
449 Ga0501072_0000818
450 Ga0501072_0043331
451 Ga0501072_0571074
452 Ga0501072_0719144
453 Ga0501073_0674184
454 Ga0501074_0028437
455 Ga0501074_0202341
456 Ga0501075_0013631
457 Ga0501075_1294250
458 Ga0501076_0002912
459 Ga0501076_0031171
460 Ga0501076_0045951
461 Ga0501076_0536440
462 Ga0501077_0001826
463 Ga0501077_0023031
464 Ga0501077_0120086
465 Ga0501077_0554613
466 Ga0501079_0007903
467 Ga0501079_0088912
468 Ga0501079_1471740
469 Ga0501080_0005858
470 Ga0501080_0151148
471 Ga0501080_0531133
472 Ga0501081_0063881
473 Ga0501081_0654126
474 Ga0501083_0214771
475 Ga0501083_0358045
476 Ga0501044_0308392
477 Ga0501044_0806201
478 Ga0501045_0009448
479 Ga0501045_0090162
480 nmdc:mga00v17_718572_c1
481 nmdc:mga00v17_72900_c1
482 nmdc:mga0yw44_300036_c1
483 nmdc:mga0yw44_370_c1
484 nmdc:mga0yw44_843_c1
485 nmdc:mga0k408_680661_c1
486 nmdc:mga04h51_21086_c1
487 nmdc:mga05p37_865145_c1
488 nmdc:mga05p37_950435_c1
489 nmdc:mga09592_3849_c1
490 nmdc:mga0qj67_565256_c1
491 nmdc:mga06r32_1221034_c1
492 nmdc:mga06r32_360782_c1
493 nmdc:mga06r32_43300_c1
494 nmdc:mga06r32_548347_c1
495 nmdc:mga06r32_90413_c1
496 nmdc:mga06r32_920_c1
497 nmdc:mga08y16_895591_c1
498 nmdc:mga08x19_580200_c1
499 nmdc:mga0sz30_109935_c1
500 Ga0495601_0059102
501 Ga0495619_0008214
502 Ga0495619_0186815
503 Ga0495619_0361359
504 Ga0500566_0001132
505 Ga0501084_0001617
506 Ga0501084_0372082
507 Ga0501082_0008444
508 Ga0501082_0752616
509 Ga0466962_0252008
510 Ga0530510_0001866
511 Ga0530510_0034023
512 Ga0530510_0328648
513 2676489909
514 2753074288

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

51

166

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wid-assembly2.cif.gz_B structure of a flavodoxin from the domain archaea 0.8876 3 150
2rg1-assembly1.cif.gz_B-2 crystal structure of e. coli wrba apoprotein 0.8864 2 149
3b6m-assembly1.cif.gz_B-2 wrba from escherichia coli, second crystal form 0.8855 2 149
2ark-assembly2.cif.gz_E structure of a flavodoxin from aquifex aeolicus 0.8827 1 149
4la4-assembly1.cif.gz_A crystal structure of native pnpb 0.8786 1 149
ID Description Score Start End Superfamily
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9934 1 148 3.40.50.360
af_O33313_1_149_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9802 1 148 3.40.50.360
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8786 1 149 3.40.50.360
4la4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8677 1 149 3.40.50.360
af_Q58142_244_391_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8624 3 145 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A6G2SCH0-F1-model_v4 deleted 0.9998 2 148
AF-A0A2V2QR17-F1-model_v4 deleted 0.9997 2 148
AF-A0A7X0LEL9-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 0.9989 2 148 GO:0016491
AF-A0A560WMQ2-F1-model_v4 NADPH-dependent FMN reductase 0.9985 2 150
AF-A0A438AXZ1-F1-model_v4 Flavodoxin family protein 0.9982 1 148

Map