F367061

General Info

Members Datasets Scaffolds Average Seq Length
257 173 514 209

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100092071|Ga0070660_1000920712
Length 230
Sequence VSESRKRQPAELAESAGWVDAASSPNDKALQRVSPVRVLLVDDQALFREALAVLLGVRADIEVVGEAADGAEALHRAAELAPDVVLMDLHMPVLNGIAATRRMRVEHPAVRVIALTTFDDDEEVFAALRAGAVGYLLKDVSSVRLVEAVLAAARGESVLQPSVAAKVVARFAQLPDATAPPPPQPLVVPLSERELAVLRLLAEGETNVLAKLGARDRTQAALRARALDLL

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
161 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
162 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
165 2643221549 Agromyces sp. Root1464 Isolate Unclassified
166 2643221619 Agromyces sp. Root81 Isolate Unclassified
167 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
168 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
169 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
170 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
171 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
172 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
173 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 5.45
Rhizosphere 83.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100092071 3300005339 Bacteria 2392
2 JGI25406J46586_10033667 3300003203 Bacteria 1889
3 rootL2_10110159 3300003322 Bacteria 1396
4 JGI25407J50210_10004382 3300003373 Bacteria 3430
5 Ga0070658_10414157 3300005327 Bacteria 1158
6 Ga0070683_100000729 3300005329 Bacteria 24074
7 Ga0070683_100122377 3300005329 Bacteria 2458
8 Ga0070690_100101845 3300005330 Bacteria 1905
9 Ga0070670_100201252 3300005331 Bacteria 1730
10 Ga0068869_100046686 3300005334 Bacteria 3123
11 Ga0070680_100602180 3300005336 Bacteria 943
12 Ga0070682_100520885 3300005337 Bacteria 925
13 Ga0068868_100057492 3300005338 Bacteria 3073
14 Ga0070660_100397627 3300005339 Bacteria 1139
15 Ga0070692_10317816 3300005345 Bacteria 956
16 Ga0070668_100004505 3300005347 Bacteria 10329
17 Ga0070668_100183867 3300005347 Bacteria 1709
18 Ga0070675_100273575 3300005354 Bacteria 1483
19 Ga0070673_100393549 3300005364 Bacteria 1238
20 Ga0070688_100379273 3300005365 Bacteria 1042
21 Ga0070659_100348187 3300005366 Bacteria 1242
22 Ga0070667_100633043 3300005367 Bacteria 987
23 Ga0070714_100969209 3300005435 Bacteria 827
24 Ga0070700_100057105 3300005441 Bacteria 2449
25 Ga0070663_100007172 3300005455 Bacteria 6770
26 Ga0070663_100042507 3300005455 Bacteria 3194
27 Ga0070678_100204921 3300005456 Bacteria 1630
28 Ga0070678_100220682 3300005456 Bacteria 1575
29 Ga0070678_100328778 3300005456 Bacteria 1308
30 Ga0070681_10359532 3300005458 Bacteria 1366
31 Ga0070685_10012201 3300005466 Bacteria 4510
32 Ga0070685_10022967 3300005466 Bacteria 3408
33 Ga0070679_100008881 3300005530 Bacteria 9485
34 Ga0070684_100100220 3300005535 Bacteria 2586
35 Ga0070684_100307289 3300005535 Bacteria 1456
36 Ga0070684_100598506 3300005535 Bacteria 1025
37 Ga0068853_100164075 3300005539 Bacteria 2006
38 Ga0068853_100408335 3300005539 Bacteria 1272
39 Ga0070686_100319458 3300005544 Bacteria 1157
40 Ga0070665_100021518 3300005548 Bacteria 6483
41 Ga0070665_100249146 3300005548 Bacteria 1777
42 Ga0070664_100158779 3300005564 Bacteria 1999
43 Ga0070664_100166813 3300005564 Bacteria 1951
44 Ga0070664_100498212 3300005564 Bacteria 1122
45 Ga0070664_100610061 3300005564 Bacteria 1012
46 Ga0068857_100274873 3300005577 Bacteria 1549
47 Ga0068854_100434125 3300005578 Bacteria 1093
48 Ga0068856_100125145 3300005614 Bacteria 2574
49 Ga0070702_100094680 3300005615 Bacteria 1819
50 Ga0068859_100029094 3300005617 Bacteria 5544
51 Ga0068864_100043503 3300005618 Bacteria 3846
52 Ga0068864_100149226 3300005618 Bacteria 2116
53 Ga0068866_10034916 3300005718 Bacteria 2452
54 Ga0068866_10114123 3300005718 Bacteria 1512
55 Ga0068851_10031332 3300005834 Bacteria 2641
56 Ga0068858_100108551 3300005842 Bacteria 2591
57 Ga0068862_100155063 3300005844 Bacteria 2041
58 Ga0081538_10007395 3300005981 Bacteria 9511
59 Ga0081539_10005387 3300005985 Bacteria 13095
60 Ga0075428_100001598 3300006844 Bacteria 24223
61 Ga0075430_100102388 3300006846 Bacteria 2391
62 Ga0075431_100453315 3300006847 Bacteria 1278
63 Ga0097620_100029094 3300006931 Bacteria 5544
64 Ga0105245_10501948 3300009098 Bacteria 1229
65 Ga0105247_10404605 3300009101 Bacteria 973
66 Ga0114129_10400943 3300009147 Bacteria 1808
67 Ga0105243_10116843 3300009148 Bacteria 2242
68 Ga0105243_10606414 3300009148 Bacteria 1055
69 Ga0105248_10541708 3300009177 Bacteria 1313
70 Ga0105237_10211515 3300009545 Bacteria 1939
71 Ga0105238_10000305 3300009551 Bacteria 53695
72 Ga0105238_10081377 3300009551 Bacteria 3228
73 Ga0105249_10385022 3300009553 Bacteria 1429
74 Ga0105239_10349027 3300010375 Bacteria 1670
75 Ga0105246_10149842 3300011119 Bacteria 1764
76 Ga0157369_10150995 3300013105 Bacteria 2455
77 Ga0157378_10310369 3300013297 Bacteria 1529
78 Ga0163162_10433514 3300013306 Bacteria 1446
79 Ga0157372_10241467 3300013307 Bacteria 2096
80 Ga0163163_10173859 3300014325 Bacteria 2200
81 Ga0163163_10194791 3300014325 Bacteria 2075
82 Ga0163163_10236010 3300014325 Bacteria 1878
83 Ga0157380_10357523 3300014326 Bacteria 1369
84 Ga0157377_10159231 3300014745 Bacteria 1402
85 Ga0157379_10022258 3300014968 Bacteria 5614
86 Ga0157376_10273652 3300014969 Bacteria 1587
87 Ga0163161_10298208 3300017792 Bacteria 1269
88 Ga0207643_10082194 3300025908 Bacteria 1867
89 Ga0207707_10348309 3300025912 Bacteria 1277
90 Ga0207671_10613550 3300025914 Bacteria 867
91 Ga0207657_10004941 3300025919 Bacteria 14024
92 Ga0207649_10142791 3300025920 Bacteria 1640
93 Ga0207652_10107541 3300025921 Bacteria 2470
94 Ga0207694_10000969 3300025924 Bacteria 25254
95 Ga0207694_10069941 3300025924 Bacteria 2742
96 Ga0207687_10022342 3300025927 Bacteria 4208
97 Ga0207664_10785176 3300025929 Bacteria 857
98 Ga0207690_10206778 3300025932 Bacteria 1494
99 Ga0207690_10307557 3300025932 Bacteria 1242
100 Ga0207709_10242906 3300025935 Bacteria 1311
101 Ga0207670_10355905 3300025936 Bacteria 1160
102 Ga0207669_10038584 3300025937 Bacteria 2752
103 Ga0207689_10016548 3300025942 Bacteria 6242
104 Ga0207661_10003087 3300025944 Bacteria 11535
105 Ga0207661_10061337 3300025944 Bacteria 3038
106 Ga0207661_10246448 3300025944 Bacteria 1587
107 Ga0207679_10034353 3300025945 Bacteria 3576
108 Ga0207712_10148693 3300025961 Bacteria 1807
109 Ga0207668_10034493 3300025972 Bacteria 3361
110 Ga0207668_10107488 3300025972 Bacteria 2086
111 Ga0207668_10607159 3300025972 Bacteria 953
112 Ga0207640_10948131 3300025981 Bacteria 754
113 Ga0207658_10644696 3300025986 Bacteria 954
114 Ga0207639_10279313 3300026041 Bacteria 1468
115 Ga0207678_10000149 3300026067 Bacteria 57279
116 Ga0207678_10016918 3300026067 Bacteria 6403
117 Ga0207708_10022823 3300026075 Bacteria 4726
118 Ga0207708_10481655 3300026075 Bacteria 1037
119 Ga0207676_10035209 3300026095 Bacteria 3798
120 Ga0207676_10275123 3300026095 Bacteria 1526
121 Ga0207676_10533469 3300026095 Bacteria 1119
122 Ga0207674_10023105 3300026116 Bacteria 6668
123 Ga0207674_10026007 3300026116 Bacteria 6228
124 Ga0207675_100021414 3300026118 Bacteria 6023
125 Ga0207683_10030818 3300026121 Bacteria 4650
126 Ga0207683_10172155 3300026121 Bacteria 1961
127 Ga0207683_10495454 3300026121 Bacteria 1128
128 Ga0207698_11411880 3300026142 Bacteria 711
129 Ga0268266_10041317 3300028379 Bacteria 3934
130 Ga0268266_10316744 3300028379 Bacteria 1459
131 Ga0268266_10547486 3300028379 Bacteria 1108
132 Ga0307517_10210737 3300028786 Bacteria 1197
133 Ga0307515_10028283 3300028794 Bacteria 9532
134 Ga0307515_10053224 3300028794 Bacteria 5979
135 Ga0307512_10003179 3300030522 Bacteria 19479
136 Ga0307513_10011637 3300031456 Bacteria 10920
137 Ga0307513_10011882 3300031456 Bacteria 10786
138 Ga0307513_10246654 3300031456 Bacteria 1586
139 Ga0307509_10034056 3300031507 Bacteria 5600
140 Ga0307408_100008318 3300031548 Bacteria 6851
141 Ga0307408_100024675 3300031548 Bacteria 4109
142 Ga0307408_100066541 3300031548 Bacteria 2647
143 Ga0307408_100286088 3300031548 Bacteria 1375
144 Ga0307408_100848176 3300031548 Bacteria 833
145 Ga0307508_10005342 3300031616 Bacteria 12236
146 Ga0307405_10057368 3300031731 Bacteria 2446
147 Ga0307405_10092737 3300031731 Bacteria 2004
148 Ga0307405_10096820 3300031731 Bacteria 1969
149 Ga0316577_10068592 3300031733 Bacteria 1981
150 Ga0307413_10061676 3300031824 Bacteria 2315
151 Ga0307413_10120295 3300031824 Bacteria 1777
152 Ga0307518_10005926 3300031838 Bacteria 8776
153 Ga0307410_10056311 3300031852 Bacteria 2673
154 Ga0307410_10064354 3300031852 Bacteria 2519
155 Ga0307410_10515094 3300031852 Bacteria 986
156 Ga0326468_10001045 3300031889 Bacteria 2609
157 Ga0307406_10009682 3300031901 Bacteria 5417
158 Ga0307406_10067930 3300031901 Bacteria 2325
159 Ga0307406_10068470 3300031901 Bacteria 2317
160 Ga0307406_10110036 3300031901 Bacteria 1895
161 Ga0307407_10012337 3300031903 Bacteria 4103
162 Ga0307407_10071285 3300031903 Bacteria 2068
163 Ga0307407_10202803 3300031903 Bacteria 1330
164 Ga0307407_10234926 3300031903 Bacteria 1247
165 Ga0307412_10264354 3300031911 Bacteria 1343
166 Ga0307409_100074671 3300031995 Bacteria 2710
167 Ga0307409_100088127 3300031995 Bacteria 2532
168 Ga0307409_100176963 3300031995 Bacteria 1884
169 Ga0307409_100242868 3300031995 Bacteria 1641
170 Ga0307409_100245726 3300031995 Bacteria 1632
171 Ga0307409_100408943 3300031995 Bacteria 1298
172 Ga0307409_100435453 3300031995 Bacteria 1262
173 Ga0307416_100005793 3300032002 Bacteria 7659
174 Ga0307416_100007263 3300032002 Bacteria 7022
175 Ga0307416_100015221 3300032002 Bacteria 5304
176 Ga0307416_100211120 3300032002 Bacteria 1852
177 Ga0307416_100366290 3300032002 Bacteria 1465
178 Ga0307416_100468666 3300032002 Bacteria 1316
179 Ga0307414_10190913 3300032004 Bacteria 1657
180 Ga0307411_10028143 3300032005 Bacteria 3413
181 Ga0307411_10779314 3300032005 Bacteria 840
182 Ga0307415_100046047 3300032126 Bacteria 2928
183 Ga0307415_100095489 3300032126 Bacteria 2164
184 Ga0307415_100236923 3300032126 Bacteria 1473
185 Ga0307415_100307965 3300032126 Bacteria 1315
186 Ga0307507_10101967 3300033179 Bacteria 2397
187 Ga0307507_10243772 3300033179 Bacteria 1172
188 Ga0307510_10311291 3300033180 Bacteria 1034
189 Ga0395898_0058748 3300037466 Bacteria 3743
190 Ga0395901_0005632 3300038443 Bacteria 12674
191 Ga0439449_0049322 3300042007 Bacteria 1558
192 Ga0451577_0043081 3300042876 Bacteria 4044
193 Ga0466965_0089032 3300044683 Bacteria 1568
194 Ga0466966_0104669 3300044684 Bacteria 1747
195 Ga0466966_0186050 3300044684 Bacteria 1259
196 Ga0466966_0277024 3300044684 Bacteria 1009
197 Ga0466963_0124635 3300044694 Bacteria 1775
198 Ga0453684_0000001 3300044712 Bacteria 2623166
199 Ga0466970_0329484 3300044765 Bacteria 864
200 Ga0466957_0072965 3300044842 Bacteria 2126
201 Ga0466960_0041041 3300044901 Bacteria 2191
202 Ga0466960_0210178 3300044901 Bacteria 1067
203 Ga0466960_0271399 3300044901 Bacteria 948
204 Ga0466960_0316801 3300044901 Bacteria 882
205 Ga0466959_0227239 3300045049 Bacteria 1293
206 Ga0466967_0007737 3300045976 Bacteria 7791
207 Ga0466967_0118341 3300045976 Bacteria 2444
208 Ga0495629_0486874 3300046459 Bacteria 833
209 Ga0495606_0002684 3300046507 Bacteria 20142
210 Ga0495632_0191497 3300046519 Bacteria 934
211 Ga0495663_0059285 3300046525 Bacteria 1201
212 Ga0495587_0191248 3300046536 Bacteria 1158
213 Ga0495656_0076017 3300046615 Bacteria 1504
214 Ga0495668_0001064 3300046616 Bacteria 29038
215 Ga0495625_0001434 3300046660 Bacteria 29028
216 Ga0495604_0211503 3300047317 Bacteria 1340
217 Ga0495602_0027023 3300048088 Bacteria 5526
218 Ga0495626_0000753 3300048091 Bacteria 29873
219 Ga0496102_0226703 3300048905 Bacteria 1762
220 Ga0496104_0579280 3300048907 Bacteria 1033
221 Ga0496108_0158193 3300048911 Bacteria 1957
222 Ga0496108_0262953 3300048911 Bacteria 1502
223 Ga0496108_0294739 3300048911 Bacteria 1413
224 Ga0496109_0103024 3300048912 Bacteria 2649
225 Ga0496109_0686445 3300048912 Bacteria 961
226 Ga0496110_0391828 3300048913 Bacteria 1266
227 Ga0496111_0146510 3300048914 Bacteria 1751
228 Ga0496111_0480237 3300048914 Bacteria 916
229 Ga0496112_0149557 3300048915 Bacteria 2303
230 Ga0496112_0442189 3300048915 Bacteria 1238
231 Ga0496114_0195038 3300048917 Bacteria 1773
232 Ga0496114_0395594 3300048917 Bacteria 1224
233 Ga0501291_052336 3300049514 Bacteria 747
234 nmdc:mga05p37_595843_c1 3300050507 Bacteria 1248
235 nmdc:mga09592_46573_c1 3300050508 Bacteria 3653
236 nmdc:mga0qj67_249482_c1 3300050509 Bacteria 1440
237 nmdc:mga0qj67_51148_c1 3300050509 Bacteria 3266
238 nmdc:mga06r32_271489_c1 3300050510 Bacteria 1683
239 nmdc:mga06r32_346437_c1 3300050510 Bacteria 1470
240 nmdc:mga06r32_932967_c1 3300050510 Bacteria 823
241 Ga0500644_0112124 3300053088 Bacteria 1052
242 Ga0500651_0108251 3300053093 Bacteria 1698
243 Ga0500641_0091426 3300053096 Bacteria 1299
244 Ga0500650_0163647 3300053098 Bacteria 1025
245 Ga0500652_005317 3300053131 Bacteria 4045
246 Ga0500577_0150889 3300053142 Bacteria 986
247 Ga0466962_0328089 3300061719 Bacteria 760
248 2586060913 2585427649 Bacteria 9053857
249 2643767197 2643221549 Bacteria 4042819
250 2644112868 2643221619 Bacteria 4158469
251 2676483786 2675903059 Bacteria 8644972
252 2809590063 2808606522 Bacteria 9488490
253 2816505654 2816332139 Bacteria 9138787
254 2887482798 2887478801 Bacteria 8972725
255 2915768680 2915768154 Bacteria 8424322
256 8003320333 8003314358 Bacteria 10575343
257 8047714811 8047710418 Bacteria 11023148
258 Ga0070660_100092071
259 JGI25406J46586_10033667
260 rootL2_10110159
261 JGI25407J50210_10004382
262 Ga0070658_10414157
263 Ga0070683_100000729
264 Ga0070683_100122377
265 Ga0070690_100101845
266 Ga0070670_100201252
267 Ga0068869_100046686
268 Ga0070680_100602180
269 Ga0070682_100520885
270 Ga0068868_100057492
271 Ga0070660_100397627
272 Ga0070692_10317816
273 Ga0070668_100004505
274 Ga0070668_100183867
275 Ga0070675_100273575
276 Ga0070673_100393549
277 Ga0070688_100379273
278 Ga0070659_100348187
279 Ga0070667_100633043
280 Ga0070714_100969209
281 Ga0070700_100057105
282 Ga0070663_100007172
283 Ga0070663_100042507
284 Ga0070678_100204921
285 Ga0070678_100220682
286 Ga0070678_100328778
287 Ga0070681_10359532
288 Ga0070685_10012201
289 Ga0070685_10022967
290 Ga0070679_100008881
291 Ga0070684_100100220
292 Ga0070684_100307289
293 Ga0070684_100598506
294 Ga0068853_100164075
295 Ga0068853_100408335
296 Ga0070686_100319458
297 Ga0070665_100021518
298 Ga0070665_100249146
299 Ga0070664_100158779
300 Ga0070664_100166813
301 Ga0070664_100498212
302 Ga0070664_100610061
303 Ga0068857_100274873
304 Ga0068854_100434125
305 Ga0068856_100125145
306 Ga0070702_100094680
307 Ga0068859_100029094
308 Ga0068864_100043503
309 Ga0068864_100149226
310 Ga0068866_10034916
311 Ga0068866_10114123
312 Ga0068851_10031332
313 Ga0068858_100108551
314 Ga0068862_100155063
315 Ga0081538_10007395
316 Ga0081539_10005387
317 Ga0075428_100001598
318 Ga0075430_100102388
319 Ga0075431_100453315
320 Ga0097620_100029094
321 Ga0105245_10501948
322 Ga0105247_10404605
323 Ga0114129_10400943
324 Ga0105243_10116843
325 Ga0105243_10606414
326 Ga0105248_10541708
327 Ga0105237_10211515
328 Ga0105238_10000305
329 Ga0105238_10081377
330 Ga0105249_10385022
331 Ga0105239_10349027
332 Ga0105246_10149842
333 Ga0157369_10150995
334 Ga0157378_10310369
335 Ga0163162_10433514
336 Ga0157372_10241467
337 Ga0163163_10173859
338 Ga0163163_10194791
339 Ga0163163_10236010
340 Ga0157380_10357523
341 Ga0157377_10159231
342 Ga0157379_10022258
343 Ga0157376_10273652
344 Ga0163161_10298208
345 Ga0207643_10082194
346 Ga0207707_10348309
347 Ga0207671_10613550
348 Ga0207657_10004941
349 Ga0207649_10142791
350 Ga0207652_10107541
351 Ga0207694_10000969
352 Ga0207694_10069941
353 Ga0207687_10022342
354 Ga0207664_10785176
355 Ga0207690_10206778
356 Ga0207690_10307557
357 Ga0207709_10242906
358 Ga0207670_10355905
359 Ga0207669_10038584
360 Ga0207689_10016548
361 Ga0207661_10003087
362 Ga0207661_10061337
363 Ga0207661_10246448
364 Ga0207679_10034353
365 Ga0207712_10148693
366 Ga0207668_10034493
367 Ga0207668_10107488
368 Ga0207668_10607159
369 Ga0207640_10948131
370 Ga0207658_10644696
371 Ga0207639_10279313
372 Ga0207678_10000149
373 Ga0207678_10016918
374 Ga0207708_10022823
375 Ga0207708_10481655
376 Ga0207676_10035209
377 Ga0207676_10275123
378 Ga0207676_10533469
379 Ga0207674_10023105
380 Ga0207674_10026007
381 Ga0207675_100021414
382 Ga0207683_10030818
383 Ga0207683_10172155
384 Ga0207683_10495454
385 Ga0207698_11411880
386 Ga0268266_10041317
387 Ga0268266_10316744
388 Ga0268266_10547486
389 Ga0307517_10210737
390 Ga0307515_10028283
391 Ga0307515_10053224
392 Ga0307512_10003179
393 Ga0307513_10011637
394 Ga0307513_10011882
395 Ga0307513_10246654
396 Ga0307509_10034056
397 Ga0307408_100008318
398 Ga0307408_100024675
399 Ga0307408_100066541
400 Ga0307408_100286088
401 Ga0307408_100848176
402 Ga0307508_10005342
403 Ga0307405_10057368
404 Ga0307405_10092737
405 Ga0307405_10096820
406 Ga0316577_10068592
407 Ga0307413_10061676
408 Ga0307413_10120295
409 Ga0307518_10005926
410 Ga0307410_10056311
411 Ga0307410_10064354
412 Ga0307410_10515094
413 Ga0326468_10001045
414 Ga0307406_10009682
415 Ga0307406_10067930
416 Ga0307406_10068470
417 Ga0307406_10110036
418 Ga0307407_10012337
419 Ga0307407_10071285
420 Ga0307407_10202803
421 Ga0307407_10234926
422 Ga0307412_10264354
423 Ga0307409_100074671
424 Ga0307409_100088127
425 Ga0307409_100176963
426 Ga0307409_100242868
427 Ga0307409_100245726
428 Ga0307409_100408943
429 Ga0307409_100435453
430 Ga0307416_100005793
431 Ga0307416_100007263
432 Ga0307416_100015221
433 Ga0307416_100211120
434 Ga0307416_100366290
435 Ga0307416_100468666
436 Ga0307414_10190913
437 Ga0307411_10028143
438 Ga0307411_10779314
439 Ga0307415_100046047
440 Ga0307415_100095489
441 Ga0307415_100236923
442 Ga0307415_100307965
443 Ga0307507_10101967
444 Ga0307507_10243772
445 Ga0307510_10311291
446 Ga0395898_0058748
447 Ga0395901_0005632
448 Ga0439449_0049322
449 Ga0451577_0043081
450 Ga0466965_0089032
451 Ga0466966_0104669
452 Ga0466966_0186050
453 Ga0466966_0277024
454 Ga0466963_0124635
455 Ga0453684_0000001
456 Ga0466970_0329484
457 Ga0466957_0072965
458 Ga0466960_0041041
459 Ga0466960_0210178
460 Ga0466960_0271399
461 Ga0466960_0316801
462 Ga0466959_0227239
463 Ga0466967_0007737
464 Ga0466967_0118341
465 Ga0495629_0486874
466 Ga0495606_0002684
467 Ga0495632_0191497
468 Ga0495663_0059285
469 Ga0495587_0191248
470 Ga0495656_0076017
471 Ga0495668_0001064
472 Ga0495625_0001434
473 Ga0495604_0211503
474 Ga0495602_0027023
475 Ga0495626_0000753
476 Ga0496102_0226703
477 Ga0496104_0579280
478 Ga0496108_0158193
479 Ga0496108_0262953
480 Ga0496108_0294739
481 Ga0496109_0103024
482 Ga0496109_0686445
483 Ga0496110_0391828
484 Ga0496111_0146510
485 Ga0496111_0480237
486 Ga0496112_0149557
487 Ga0496112_0442189
488 Ga0496114_0195038
489 Ga0496114_0395594
490 Ga0501291_052336
491 nmdc:mga05p37_595843_c1
492 nmdc:mga09592_46573_c1
493 nmdc:mga0qj67_249482_c1
494 nmdc:mga0qj67_51148_c1
495 nmdc:mga06r32_271489_c1
496 nmdc:mga06r32_346437_c1
497 nmdc:mga06r32_932967_c1
498 Ga0500644_0112124
499 Ga0500651_0108251
500 Ga0500641_0091426
501 Ga0500650_0163647
502 Ga0500652_005317
503 Ga0500577_0150889
504 Ga0466962_0328089
505 2586060913
506 2643767197
507 2644112868
508 2676483786
509 2809590063
510 2816505654
511 2887482798
512 2915768680
513 8003320333
514 8047714811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

38

150

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve6-assembly1.cif.gz_B n-terminal domain of vrar 0.9745 10 140
3eul-assembly2.cif.gz_B structure of the signal receiver domain of the putative response regulator narl from mycobacterium tuberculosis 0.9647 8 130
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9632 8 121
7ssi-assembly1.cif.gz_C crystal structure of the desk:desr-q10a complex in the phosphotransfer state 0.9589 8 137
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9579 8 121
ID Description Score Start End Superfamily
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.966 10 127 3.40.50.2300
4if4D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9658 10 147 3.40.50.2300
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9579 8 121 3.40.50.2300
1qmpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9537 10 128 3.40.50.2300
4le0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9517 10 137 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y9IGP0-F1-model_v4 deleted 0.9923 8 150
AF-A0A4Q3SH94-F1-model_v4 Response regulator transcription factor 0.9875 9 146 GO:0000160
GO:0003677
AF-A0A7C4SVK3-F1-model_v4 Response regulator transcription factor 0.986 8 138 GO:0000160
GO:0003677
AF-A0A3R9WAX4-F1-model_v4 DNA-binding response regulator 0.9851 10 143 GO:0000160
GO:0003677
AF-A0A066YUJ2-F1-model_v4 LuxR family transcriptional regulator 0.9837 9 151 GO:0000160
GO:0003677

Map