F365850

General Info

Members Datasets Scaffolds Average Seq Length
255 137 510 121

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0023141|Ga0316582_0023141_3247_3675
Length 142
Sequence MKKRHLTSRPPSKQQAYDSMSDLNDPRVLFAAERTLLAWNRTSISLMAFGFVVERFGLFLEITGRDEIKVFQRHISFFVGISFVLLAAFTAIYSIWQHKRILKTIRPVEIPPGYNLKAGMFINAIIGVLGIALSIYLIRGFL

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
27 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
33 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
34 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
35 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
36 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
42 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
43 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
56 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
57 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
58 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
72 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
73 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
90 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
126 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
127 2643221660 Methylibium sp. Root1272 Isolate Unclassified
128 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
129 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
130 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
131 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
132 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
133 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
134 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
135 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
136 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
137 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.94
Metatranscriptomes 2.35
Isolates 4.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 0
Rhizosphere 95.69
Stem 0
Stem Tuber 0
Unclassified 13.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0023141 3300036647 Bacteria 3699
2 Ga0065707_10083672 3300005295 Bacteria 8492
3 Ga0065707_10170776 3300005295 Bacteria 1486
4 Ga0070690_100676947 3300005330 Bacteria 790
5 Ga0070680_100096279 3300005336 Bacteria 2454
6 Ga0070680_100590912 3300005336 Bacteria 953
7 Ga0070689_101291115 3300005340 Bacteria 657
8 Ga0070689_101992011 3300005340 Bacteria 531
9 Ga0070691_10056174 3300005341 Bacteria 1886
10 Ga0070671_100699229 3300005355 Bacteria 879
11 Ga0070701_11049408 3300005438 Bacteria 571
12 Ga0070705_100044814 3300005440 Bacteria 2542
13 Ga0070705_100319323 3300005440 Bacteria 1120
14 Ga0070694_100011467 3300005444 Bacteria 5490
15 Ga0070694_100347595 3300005444 Bacteria 1148
16 Ga0070694_100479077 3300005444 Bacteria 987
17 Ga0070694_100539940 3300005444 Bacteria 932
18 Ga0070707_101560290 3300005468 Bacteria 627
19 Ga0070695_100027194 3300005545 Bacteria 3543
20 Ga0070695_100162435 3300005545 Bacteria 1569
21 Ga0070695_101746707 3300005545 Bacteria 521
22 Ga0070696_100003299 3300005546 Bacteria 10773
23 Ga0070696_100047774 3300005546 Bacteria 2970
24 Ga0070704_101392570 3300005549 Bacteria 643
25 Ga0068856_100829848 3300005614 Bacteria 944
26 Ga0070702_100432902 3300005615 Bacteria 950
27 Ga0070717_10733410 3300006028 Bacteria 898
28 Ga0070715_10013410 3300006163 Bacteria 3010
29 Ga0070716_100068525 3300006173 Bacteria 2076
30 Ga0075428_100137390 3300006844 Bacteria 2657
31 Ga0075430_100146558 3300006846 Bacteria 1966
32 Ga0075429_100128499 3300006880 Bacteria 2217
33 Ga0111539_10254835 3300009094 Bacteria 2043
34 Ga0111539_10508858 3300009094 Bacteria 1402
35 Ga0111539_13226904 3300009094 Unclassified 526
36 Ga0114129_10655104 3300009147 Bacteria 1355
37 Ga0157370_10130691 3300013104 Bacteria 2342
38 Ga0209233_1002480 3300025261 Bacteria 6758
39 Ga0207685_10007759 3300025905 Bacteria 3013
40 Ga0207660_10285846 3300025917 Bacteria 1310
41 Ga0207660_10490405 3300025917 Bacteria 996
42 Ga0207665_10175989 3300025939 Bacteria 1548
43 Ga0207702_10118657 3300026078 Bacteria 2364
44 Ga0209995_1009098 3300027471 Bacteria 1606
45 Ga0207428_10352184 3300027907 Bacteria 1083
46 Ga0207428_10539090 3300027907 Bacteria 845
47 Ga0265334_10000014 3300028573 Bacteria 154345
48 Ga0265336_10000838 3300028666 Bacteria 16013
49 Ga0265324_10000762 3300029957 Bacteria 21254
50 Ga0265324_10064981 3300029957 Bacteria 1245
51 Ga0265324_10137943 3300029957 Unclassified 828
52 Ga0265328_10002977 3300031239 Bacteria 7565
53 Ga0265325_10000153 3300031241 Bacteria 48971
54 Ga0265331_10015164 3300031250 Bacteria 4080
55 Ga0265331_10193461 3300031250 Bacteria 917
56 Ga0265327_10005791 3300031251 Bacteria 10167
57 Ga0265316_10072947 3300031344 Bacteria 2644
58 Ga0265316_10324588 3300031344 Bacteria 1118
59 Ga0307408_100281446 3300031548 Unclassified 1385
60 Ga0307408_101489450 3300031548 Bacteria 640
61 Ga0316575_10007330 3300031665 Unclassified 3990
62 Ga0316579_10004073 3300031691 Bacteria 5771
63 Ga0316579_10006700 3300031691 Unclassified 4715
64 Ga0316579_10114148 3300031691 Bacteria 1297
65 Ga0265314_10070947 3300031711 Bacteria 2332
66 Ga0265314_10085806 3300031711 Bacteria 2063
67 Ga0265342_10318382 3300031712 Bacteria 816
68 Ga0316576_10018839 3300031727 Bacteria 4720
69 Ga0316576_10756786 3300031727 Unclassified 701
70 Ga0316576_11254771 3300031727 Unclassified 522
71 Ga0316578_10011721 3300031728 Bacteria 4601
72 Ga0316578_10020263 3300031728 Bacteria 3672
73 Ga0316578_10184013 3300031728 Bacteria 1259
74 Ga0316578_10223530 3300031728 Bacteria 1132
75 Ga0316578_10256149 3300031728 Bacteria 1049
76 Ga0316578_10265558 3300031728 Unclassified 1029
77 Ga0316578_10284817 3300031728 Bacteria 989
78 Ga0316578_10529554 3300031728 Unclassified 693
79 Ga0307516_10084132 3300031730 Bacteria 3021
80 Ga0307405_10437160 3300031731 Unclassified 1034
81 Ga0316577_10022575 3300031733 Unclassified 3494
82 Ga0316577_10041517 3300031733 Bacteria 2574
83 Ga0316577_10220236 3300031733 Bacteria 1073
84 Ga0316577_10494055 3300031733 Unclassified 696
85 Ga0316577_10881458 3300031733 Unclassified 507
86 Ga0307412_10576963 3300031911 Bacteria 949
87 Ga0307409_101586830 3300031995 Bacteria 682
88 Ga0307411_10044570 3300032005 Bacteria 2847
89 Ga0307415_101267083 3300032126 Bacteria 697
90 Ga0316583_10056333 3300032133 Unclassified 1381
91 Ga0316583_10218721 3300032133 Unclassified 660
92 Ga0316585_10007261 3300032137 Bacteria 3189
93 Ga0316585_10008319 3300032137 Unclassified 3009
94 Ga0316585_10030961 3300032137 Bacteria 1680
95 Ga0316585_10092818 3300032137 Bacteria 987
96 Ga0316585_10174454 3300032137 Bacteria 710
97 Ga0316585_10237044 3300032137 Bacteria 604
98 Ga0316580_10006450 3300032139 Bacteria 3466
99 Ga0316580_10144468 3300032139 Unclassified 730
100 Ga0316593_10045003 3300032168 Bacteria 1478
101 Ga0316593_10109515 3300032168 Bacteria 986
102 Ga0316593_10284153 3300032168 Unclassified 624
103 Ga0316592_1000623 3300033524 Bacteria 5140
104 Ga0316588_1000236 3300033528 Bacteria 6616
105 Ga0316596_1161573 3300033541 Unclassified 617
106 Ga0373949_0053682 3300035090 Bacteria 1021
107 Ga0373956_0499724 3300035119 Unclassified 580
108 Ga0316574_0015117 3300035398 Bacteria 4475
109 Ga0316574_0018386 3300035398 Bacteria 4106
110 Ga0316574_0088102 3300035398 Unclassified 1977
111 Ga0316574_0114732 3300035398 Bacteria 1727
112 Ga0316574_0199055 3300035398 Bacteria 1287
113 Ga0316574_0200314 3300035398 Bacteria 1282
114 Ga0373924_0128319 3300035410 Bacteria 1103
115 Ga0373931_1280395 3300035691 Bacteria 504
116 Ga0373937_0114206 3300036401 Bacteria 2514
117 Ga0373937_0125072 3300036401 Bacteria 2398
118 Ga0373937_0243112 3300036401 Bacteria 1696
119 Ga0316582_0000719 3300036647 Bacteria 13135
120 Ga0316582_0013726 3300036647 Bacteria 4570
121 Ga0316582_0019157 3300036647 Bacteria 3999
122 Ga0316582_0028403 3300036647 Bacteria 3389
123 Ga0316582_0034073 3300036647 Bacteria 3133
124 Ga0316582_0052102 3300036647 Unclassified 2600
125 Ga0316582_0083893 3300036647 Bacteria 2086
126 Ga0316582_0100283 3300036647 Unclassified 1917
127 Ga0316582_0106154 3300036647 Bacteria 1865
128 Ga0316582_0112453 3300036647 Unclassified 1814
129 Ga0316582_0361384 3300036647 Bacteria 999
130 Ga0316582_0441990 3300036647 Unclassified 896
131 Ga0316582_0476231 3300036647 Unclassified 860
132 Ga0316582_1072725 3300036647 Unclassified 549
133 Ga0316584_0006544 3300036712 Bacteria 7893
134 Ga0316584_0011509 3300036712 Bacteria 6219
135 Ga0316584_0012656 3300036712 Bacteria 5951
136 Ga0316584_0014889 3300036712 Bacteria 5556
137 Ga0316584_0027684 3300036712 Unclassified 4173
138 Ga0316584_0053091 3300036712 Bacteria 3032
139 Ga0316584_0285106 3300036712 Bacteria 1199
140 Ga0316584_0381927 3300036712 Bacteria 1006
141 Ga0316584_0498860 3300036712 Bacteria 855
142 Ga0316584_0622634 3300036712 Bacteria 746
143 Ga0373925_0222774 3300037068 Bacteria 1506
144 Ga0395899_0000183 3300037312 Bacteria 91818
145 Ga0395899_0690085 3300037312 Unclassified 641
146 Ga0316581_0012890 3300037588 Bacteria 2361
147 Ga0316581_0100549 3300037588 Unclassified 890
148 Ga0242420_063603 3300038996 Bacteria 740
149 Ga0439441_142703 3300042001 Bacteria 560
150 Ga0451577_0000085 3300042876 Bacteria 211141
151 Ga0451577_0006621 3300042876 Bacteria 11511
152 Ga0451577_0010882 3300042876 Bacteria 8643
153 Ga0451577_0038015 3300042876 Bacteria 4330
154 Ga0451577_0746431 3300042876 Bacteria 885
155 Ga0451577_1256867 3300042876 Bacteria 659
156 Ga0466972_0054637 3300044658 Bacteria 1921
157 Ga0453683_0000047 3300044673 Bacteria 207763
158 Ga0453683_0126732 3300044673 Bacteria 1608
159 Ga0453683_0901553 3300044673 Bacteria 584
160 Ga0453684_0000273 3300044712 Bacteria 222658
161 Ga0453684_0000302 3300044712 Bacteria 207763
162 Ga0453684_0002114 3300044712 Bacteria 50142
163 Ga0453684_0007293 3300044712 Bacteria 20461
164 Ga0453684_0427434 3300044712 Bacteria 1478
165 Ga0453684_1107343 3300044712 Bacteria 836
166 Ga0453684_1509755 3300044712 Bacteria 693
167 Ga0453684_2438176 3300044712 Bacteria 517
168 Ga0466968_0005266 3300044735 Bacteria 4846
169 Ga0466968_0005841 3300044735 Bacteria 4619
170 Ga0451576_0000006 3300045051 Bacteria 949698
171 Ga0451576_0000116 3300045051 Bacteria 207763
172 Ga0451576_0002118 3300045051 Bacteria 30850
173 Ga0451576_0009737 3300045051 Bacteria 11112
174 Ga0451576_0071911 3300045051 Bacteria 3600
175 Ga0451576_0742973 3300045051 Bacteria 1031
176 Ga0466967_0892101 3300045976 Bacteria 884
177 Ga0495592_0887197 3300046454 Bacteria 525
178 Ga0495651_0101229 3300046462 Unclassified 2145
179 Ga0495652_0070250 3300046529 Bacteria 2928
180 Ga0495667_0588236 3300046559 Unclassified 694
181 Ga0495623_0231800 3300046679 Bacteria 1047
182 Ga0495680_0002094 3300047322 Bacteria 20728
183 Ga0495675_0002646 3300047444 Bacteria 10729
184 Ga0495675_0278733 3300047444 Bacteria 997
185 Ga0496126_0013384 3300048929 Bacteria 8350
186 Ga0501292_049474 3300049515 Bacteria 742
187 Ga0501299_108910 3300049522 Bacteria 653
188 Ga0501031_0239346 3300049568 Unclassified 1180
189 Ga0501031_0252222 3300049568 Bacteria 1147
190 Ga0501031_0553264 3300049568 Bacteria 741
191 Ga0501032_0428007 3300049569 Bacteria 849
192 Ga0501033_0150503 3300049570 Bacteria 1679
193 Ga0501034_1177954 3300049571 Bacteria 645
194 Ga0501036_0009903 3300049572 Bacteria 7849
195 Ga0501036_1307544 3300049572 Bacteria 589
196 Ga0501037_0423341 3300049573 Bacteria 911
197 Ga0501038_0022129 3300049574 Bacteria 5699
198 Ga0501039_0020423 3300049575 Bacteria 5076
199 Ga0501039_0067324 3300049575 Bacteria 2781
200 Ga0501041_0014604 3300049577 Bacteria 4662
201 Ga0501041_0053114 3300049577 Bacteria 2471
202 Ga0501042_0148781 3300049578 Bacteria 1688
203 Ga0501042_0248492 3300049578 Bacteria 1283
204 Ga0501043_0358466 3300049579 Bacteria 1107
205 Ga0501046_0326818 3300049580 Bacteria 1117
206 Ga0501048_0731390 3300049582 Bacteria 711
207 Ga0501048_0804803 3300049582 Bacteria 675
208 Ga0501068_0497987 3300049584 Bacteria 790
209 Ga0501071_0008708 3300049587 Bacteria 6714
210 Ga0501071_0308121 3300049587 Bacteria 1201
211 Ga0501071_0455254 3300049587 Bacteria 980
212 Ga0501071_0617033 3300049587 Bacteria 834
213 Ga0501071_0788483 3300049587 Bacteria 732
214 Ga0501072_0003338 3300049588 Bacteria 12073
215 Ga0501072_0112665 3300049588 Bacteria 2166
216 Ga0501072_0260249 3300049588 Unclassified 1381
217 Ga0501073_0101182 3300049589 Bacteria 2001
218 Ga0501075_0004871 3300049591 Bacteria 9147
219 Ga0501075_0027115 3300049591 Bacteria 4221
220 Ga0501075_0045452 3300049591 Bacteria 3296
221 Ga0501075_0419923 3300049591 Bacteria 1020
222 Ga0501076_0001756 3300049592 Bacteria 14654
223 Ga0501076_0073106 3300049592 Bacteria 2745
224 Ga0501076_0777227 3300049592 Bacteria 790
225 Ga0501077_0014830 3300049593 Bacteria 4899
226 Ga0501236_019507 3300049670 Unclassified 990
227 Ga0501079_0008616 3300049741 Bacteria 7736
228 Ga0501080_0020343 3300049742 Bacteria 6142
229 Ga0501081_0048315 3300049743 Bacteria 2928
230 Ga0501283_007504 3300049779 Bacteria 1555
231 Ga0501035_0117434 3300049822 Bacteria 2328
232 Ga0501045_0002091 3300049824 Bacteria 13492
233 Ga0501045_0053327 3300049824 Bacteria 2955
234 nmdc:mga09592_329634_c1 3300050508 Bacteria 1322
235 nmdc:mga09592_831417_c1 3300050508 Bacteria 780
236 nmdc:mga0qj67_70411_c1 3300050509 Bacteria 2790
237 nmdc:mga06r32_653992_c1 3300050510 Bacteria 1019
238 nmdc:mga08y16_138849_c1 3300050511 Bacteria 2527
239 Ga0500552_007329 3300053733 Bacteria 1269
240 Ga0501084_0095309 3300054114 Bacteria 2499
241 Ga0501082_0007524 3300060353 Bacteria 9399
242 Ga0530510_0000126 3300061734 Bacteria 44298
243 Ga0530510_0029101 3300061734 Bacteria 3964
244 2621298012 2619619299 Bacteria 6649820
245 2644340526 2643221660 Bacteria 4208257
246 2738675235 2738541265 Bacteria 6594665
247 2738753639 2738541282 Bacteria 6593925
248 2738862628 2738541303 Bacteria 6591772
249 2812366203 2811994881 Bacteria 6298475
250 2817492850 2816332298 Bacteria 6852809
251 2852613870 2852612431 Bacteria 6885235
252 2852668394 2852667396 Bacteria 6885555
253 2923520226 2923519811 Bacteria 6298479
254 2988729751 2988728565 Bacteria 6124362
255 2990197832 2990196909 Bacteria 4054280
256 Ga0316582_0023141
257 Ga0065707_10083672
258 Ga0065707_10170776
259 Ga0070690_100676947
260 Ga0070680_100096279
261 Ga0070680_100590912
262 Ga0070689_101291115
263 Ga0070689_101992011
264 Ga0070691_10056174
265 Ga0070671_100699229
266 Ga0070701_11049408
267 Ga0070705_100044814
268 Ga0070705_100319323
269 Ga0070694_100011467
270 Ga0070694_100347595
271 Ga0070694_100479077
272 Ga0070694_100539940
273 Ga0070707_101560290
274 Ga0070695_100027194
275 Ga0070695_100162435
276 Ga0070695_101746707
277 Ga0070696_100003299
278 Ga0070696_100047774
279 Ga0070704_101392570
280 Ga0068856_100829848
281 Ga0070702_100432902
282 Ga0070717_10733410
283 Ga0070715_10013410
284 Ga0070716_100068525
285 Ga0075428_100137390
286 Ga0075430_100146558
287 Ga0075429_100128499
288 Ga0111539_10254835
289 Ga0111539_10508858
290 Ga0111539_13226904
291 Ga0114129_10655104
292 Ga0157370_10130691
293 Ga0209233_1002480
294 Ga0207685_10007759
295 Ga0207660_10285846
296 Ga0207660_10490405
297 Ga0207665_10175989
298 Ga0207702_10118657
299 Ga0209995_1009098
300 Ga0207428_10352184
301 Ga0207428_10539090
302 Ga0265334_10000014
303 Ga0265336_10000838
304 Ga0265324_10000762
305 Ga0265324_10064981
306 Ga0265324_10137943
307 Ga0265328_10002977
308 Ga0265325_10000153
309 Ga0265331_10015164
310 Ga0265331_10193461
311 Ga0265327_10005791
312 Ga0265316_10072947
313 Ga0265316_10324588
314 Ga0307408_100281446
315 Ga0307408_101489450
316 Ga0316575_10007330
317 Ga0316579_10004073
318 Ga0316579_10006700
319 Ga0316579_10114148
320 Ga0265314_10070947
321 Ga0265314_10085806
322 Ga0265342_10318382
323 Ga0316576_10018839
324 Ga0316576_10756786
325 Ga0316576_11254771
326 Ga0316578_10011721
327 Ga0316578_10020263
328 Ga0316578_10184013
329 Ga0316578_10223530
330 Ga0316578_10256149
331 Ga0316578_10265558
332 Ga0316578_10284817
333 Ga0316578_10529554
334 Ga0307516_10084132
335 Ga0307405_10437160
336 Ga0316577_10022575
337 Ga0316577_10041517
338 Ga0316577_10220236
339 Ga0316577_10494055
340 Ga0316577_10881458
341 Ga0307412_10576963
342 Ga0307409_101586830
343 Ga0307411_10044570
344 Ga0307415_101267083
345 Ga0316583_10056333
346 Ga0316583_10218721
347 Ga0316585_10007261
348 Ga0316585_10008319
349 Ga0316585_10030961
350 Ga0316585_10092818
351 Ga0316585_10174454
352 Ga0316585_10237044
353 Ga0316580_10006450
354 Ga0316580_10144468
355 Ga0316593_10045003
356 Ga0316593_10109515
357 Ga0316593_10284153
358 Ga0316592_1000623
359 Ga0316588_1000236
360 Ga0316596_1161573
361 Ga0373949_0053682
362 Ga0373956_0499724
363 Ga0316574_0015117
364 Ga0316574_0018386
365 Ga0316574_0088102
366 Ga0316574_0114732
367 Ga0316574_0199055
368 Ga0316574_0200314
369 Ga0373924_0128319
370 Ga0373931_1280395
371 Ga0373937_0114206
372 Ga0373937_0125072
373 Ga0373937_0243112
374 Ga0316582_0000719
375 Ga0316582_0013726
376 Ga0316582_0019157
377 Ga0316582_0028403
378 Ga0316582_0034073
379 Ga0316582_0052102
380 Ga0316582_0083893
381 Ga0316582_0100283
382 Ga0316582_0106154
383 Ga0316582_0112453
384 Ga0316582_0361384
385 Ga0316582_0441990
386 Ga0316582_0476231
387 Ga0316582_1072725
388 Ga0316584_0006544
389 Ga0316584_0011509
390 Ga0316584_0012656
391 Ga0316584_0014889
392 Ga0316584_0027684
393 Ga0316584_0053091
394 Ga0316584_0285106
395 Ga0316584_0381927
396 Ga0316584_0498860
397 Ga0316584_0622634
398 Ga0373925_0222774
399 Ga0395899_0000183
400 Ga0395899_0690085
401 Ga0316581_0012890
402 Ga0316581_0100549
403 Ga0242420_063603
404 Ga0439441_142703
405 Ga0451577_0000085
406 Ga0451577_0006621
407 Ga0451577_0010882
408 Ga0451577_0038015
409 Ga0451577_0746431
410 Ga0451577_1256867
411 Ga0466972_0054637
412 Ga0453683_0000047
413 Ga0453683_0126732
414 Ga0453683_0901553
415 Ga0453684_0000273
416 Ga0453684_0000302
417 Ga0453684_0002114
418 Ga0453684_0007293
419 Ga0453684_0427434
420 Ga0453684_1107343
421 Ga0453684_1509755
422 Ga0453684_2438176
423 Ga0466968_0005266
424 Ga0466968_0005841
425 Ga0451576_0000006
426 Ga0451576_0000116
427 Ga0451576_0002118
428 Ga0451576_0009737
429 Ga0451576_0071911
430 Ga0451576_0742973
431 Ga0466967_0892101
432 Ga0495592_0887197
433 Ga0495651_0101229
434 Ga0495652_0070250
435 Ga0495667_0588236
436 Ga0495623_0231800
437 Ga0495680_0002094
438 Ga0495675_0002646
439 Ga0495675_0278733
440 Ga0496126_0013384
441 Ga0501292_049474
442 Ga0501299_108910
443 Ga0501031_0239346
444 Ga0501031_0252222
445 Ga0501031_0553264
446 Ga0501032_0428007
447 Ga0501033_0150503
448 Ga0501034_1177954
449 Ga0501036_0009903
450 Ga0501036_1307544
451 Ga0501037_0423341
452 Ga0501038_0022129
453 Ga0501039_0020423
454 Ga0501039_0067324
455 Ga0501041_0014604
456 Ga0501041_0053114
457 Ga0501042_0148781
458 Ga0501042_0248492
459 Ga0501043_0358466
460 Ga0501046_0326818
461 Ga0501048_0731390
462 Ga0501048_0804803
463 Ga0501068_0497987
464 Ga0501071_0008708
465 Ga0501071_0308121
466 Ga0501071_0455254
467 Ga0501071_0617033
468 Ga0501071_0788483
469 Ga0501072_0003338
470 Ga0501072_0112665
471 Ga0501072_0260249
472 Ga0501073_0101182
473 Ga0501075_0004871
474 Ga0501075_0027115
475 Ga0501075_0045452
476 Ga0501075_0419923
477 Ga0501076_0001756
478 Ga0501076_0073106
479 Ga0501076_0777227
480 Ga0501077_0014830
481 Ga0501236_019507
482 Ga0501079_0008616
483 Ga0501080_0020343
484 Ga0501081_0048315
485 Ga0501283_007504
486 Ga0501035_0117434
487 Ga0501045_0002091
488 Ga0501045_0053327
489 nmdc:mga09592_329634_c1
490 nmdc:mga09592_831417_c1
491 nmdc:mga0qj67_70411_c1
492 nmdc:mga06r32_653992_c1
493 nmdc:mga08y16_138849_c1
494 Ga0500552_007329
495 Ga0501084_0095309
496 Ga0501082_0007524
497 Ga0530510_0000126
498 Ga0530510_0029101
499 2621298012
500 2644340526
501 2738675235
502 2738753639
503 2738862628
504 2812366203
505 2817492850
506 2852613870
507 2852668394
508 2923520226
509 2988729751
510 2990197832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02656

DUF202

Domain of unknown function (DUF202)

27

104

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tap-assembly1.cif.gz_O cryo-em structure of archazolid a bound to yeast vo v-atpase 0.723 39 103
6nr9-assembly1.cif.gz_1 htric-hpfd class5 0.7019 34 100
7u8o-assembly1.cif.gz_f structure of porcine v-atpase with meak7 and sidk, rotary state 2 0.6799 40 103
7tap-assembly1.cif.gz_O cryo-em structure of archazolid a bound to yeast vo v-atpase 0.6698 39 103
6qum-assembly1.cif.gz_S thermus thermophilus v/a-type atpase/synthase, rotational state 1 0.6051 32 104
ID Description Score Start End Superfamily
af_Q04472_105_466_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8683 44 100 1.25.40.10
af_Q6P3K6_303_378_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.821 39 100 1.10.287.660
af_A4IAM2_33_188_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8158 39 103 1.20.140.150
1wp7A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;YojJ-like 0.8113 38 104 1.10.287.770
1wp8B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;YojJ-like 0.8069 38 104 1.10.287.770
ID Description Score Start End GO Terms
AF-A0A2P4UP56-F1-model_v4 Uncharacterized protein 0.8622 39 104 GO:0016020
AF-K8ELS0-F1-model_v4 Cell death suppressor protein Lls1-like 0.8494 39 100 GO:0009507
GO:0010277
GO:0046872
GO:0051537
AF-A0A2W6AMI8-F1-model_v4 Uncharacterized protein 0.8135 29 100
AF-A0A849RJE5-F1-model_v4 DUF4398 domain-containing protein 0.7761 28 103
AF-D5CLG2-F1-model_v4 Uncharacterized protein 0.7622 30 103 GO:0016020

Map