F365062

General Info

Members Datasets Scaffolds Average Seq Length
254 189 508 235

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0669967|Ga0436363_0669967_4203_5045
Length 280
Sequence MTASIESEPPRSSGSMRDWEFGFDEQTVELFEQSATGVSADRRSPTCLVVEDDSTLRHLVSNYLEDHGIRAVSASGRDEVSRLLAGSEPDLVVLDLGLGQADGLDLLREIRAQSDVPIIITTGQRRDEIDRVVGLELGADDYVTKPFGLRELLARIRAVLRRRETGHANAQRDIEKGRCRFGDWQLDRRNRRLTNSAGEPVALTKGEYALLIAFLDAPLRTLSREHLLQATRIHEDVFDRSIDVQVLRLRRKLETDPSTPSIIRTERGVGYIFSLPVEPP

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
107 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
108 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
167 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
168 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
169 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
172 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
176 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
177 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
178 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
179 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
180 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
181 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
182 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
183 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
184 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
185 2932406140 Serratia sp. 2723 Isolate Rhizosphere
186 2939577877 Serratia sp. 509 Isolate Rhizosphere
187 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
188 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
189 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 0.79
Isolates 5.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 2.76
Rhizoplane 5.12
Rhizosphere 77.95
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0669967 3300039450 Bacteria 6418
2 JGI25407J50210_10007775 3300003373 Bacteria 2692
3 Ga0058862_11787306 3300004803 Bacteria 1597
4 Ga0070658_10031025 3300005327 Bacteria 4291
5 Ga0070683_100705361 3300005329 Bacteria 966
6 Ga0070661_100044140 3300005344 Bacteria 3256
7 Ga0070659_100000935 3300005366 Bacteria 21449
8 Ga0070703_10009652 3300005406 Bacteria 2723
9 Ga0070713_100051469 3300005436 Bacteria 3406
10 Ga0070713_100235181 3300005436 Bacteria 1667
11 Ga0070711_100234916 3300005439 Bacteria 1431
12 Ga0070694_100016850 3300005444 Bacteria 4607
13 Ga0070681_10173167 3300005458 Bacteria 2080
14 Ga0070706_100017564 3300005467 Bacteria 6602
15 Ga0070707_100788495 3300005468 Bacteria 914
16 Ga0070699_100203933 3300005518 Bacteria 1759
17 Ga0070679_100058446 3300005530 Bacteria 3842
18 Ga0070695_100001965 3300005545 Bacteria 11679
19 Ga0070696_100014760 3300005546 Bacteria 5240
20 Ga0070693_100355483 3300005547 Bacteria 1004
21 Ga0070665_100272959 3300005548 Bacteria 1693
22 Ga0070704_100009793 3300005549 Bacteria 5811
23 Ga0068855_100022345 3300005563 Bacteria 7580
24 Ga0068855_100581426 3300005563 Bacteria 1210
25 Ga0070664_100026911 3300005564 Bacteria 4776
26 Ga0070664_100170917 3300005564 Bacteria 1928
27 Ga0068857_100210307 3300005577 Bacteria 1775
28 Ga0068856_100054199 3300005614 Bacteria 3954
29 Ga0068859_100108936 3300005617 Bacteria 2831
30 Ga0068858_100000081 3300005842 Bacteria 100314
31 Ga0068858_100419846 3300005842 Bacteria 1286
32 Ga0068858_100504320 3300005842 Bacteria 1169
33 Ga0068860_100520167 3300005843 Bacteria 1190
34 Ga0081455_10000911 3300005937 Bacteria 37905
35 Ga0081455_10020614 3300005937 Bacteria 6201
36 Ga0081538_10000007 3300005981 Bacteria 175313
37 Ga0081540_1062919 3300005983 Bacteria 1759
38 Ga0075365_10303331 3300006038 Bacteria 1124
39 Ga0075369_10197085 3300006186 Bacteria 929
40 Ga0075428_100009253 3300006844 Bacteria 10926
41 Ga0075428_100024991 3300006844 Bacteria 6609
42 Ga0075430_100000219 3300006846 Bacteria 39415
43 Ga0075430_100012173 3300006846 Bacteria 7324
44 Ga0075431_100006409 3300006847 Bacteria 11679
45 Ga0075431_100025262 3300006847 Bacteria 6090
46 Ga0075433_10172164 3300006852 Bacteria 1927
47 Ga0075429_100000069 3300006880 Bacteria 51472
48 Ga0075429_100007594 3300006880 Bacteria 9416
49 Ga0097620_100108941 3300006931 Bacteria 2831
50 Ga0079104_1000088 3300006946 Bacteria 134442
51 Ga0099794_10012460 3300007265 Bacteria 3671
52 Ga0111539_10000738 3300009094 Bacteria 42458
53 Ga0111539_10551294 3300009094 Bacteria 1343
54 Ga0105245_10000189 3300009098 Bacteria 58162
55 Ga0105245_10341260 3300009098 Bacteria 1481
56 Ga0114129_10000066 3300009147 Bacteria 93802
57 Ga0114129_10021125 3300009147 Bacteria 9242
58 Ga0114129_10026604 3300009147 Bacteria 8193
59 Ga0105248_10000835 3300009177 Bacteria 34604
60 Ga0105249_10288249 3300009553 Bacteria 1642
61 Ga0105239_10076643 3300010375 Bacteria 3678
62 Ga0157374_10022874 3300013296 Bacteria 5581
63 Ga0163162_10139131 3300013306 Bacteria 2540
64 Ga0163162_10359455 3300013306 Bacteria 1589
65 Ga0163163_10016339 3300014325 Bacteria 6891
66 Ga0163163_10059456 3300014325 Bacteria 3781
67 Ga0182008_10175214 3300014497 Bacteria 1084
68 Ga0157379_10000042 3300014968 Bacteria 77721
69 Ga0157376_10022879 3300014969 Bacteria 4880
70 Ga0206354_11329161 3300020081 Bacteria 1600
71 Ga0214544_1000238 3300021320 Bacteria 90741
72 Ga0214542_1000244 3300021321 Bacteria 90727
73 Ga0207705_10043329 3300025909 Bacteria 3233
74 Ga0207707_10119049 3300025912 Bacteria 2308
75 Ga0207660_10147674 3300025917 Bacteria 1803
76 Ga0207652_10098258 3300025921 Bacteria 2582
77 Ga0207681_10725530 3300025923 Bacteria 827
78 Ga0207687_10000665 3300025927 Bacteria 23113
79 Ga0207687_10401459 3300025927 Bacteria 1127
80 Ga0207690_10001019 3300025932 Bacteria 17938
81 Ga0207711_10005055 3300025941 Bacteria 11188
82 Ga0207661_10288544 3300025944 Bacteria 1468
83 Ga0207679_10015894 3300025945 Bacteria 4988
84 Ga0207667_10056023 3300025949 Bacteria 4143
85 Ga0207703_10000089 3300026035 Bacteria 105959
86 Ga0207702_10026816 3300026078 Bacteria 4784
87 Ga0207676_10112457 3300026095 Bacteria 2281
88 Ga0207674_10371048 3300026116 Bacteria 1383
89 Ga0209281_1000176 3300027111 Bacteria 151377
90 Ga0207428_10004434 3300027907 Bacteria 13351
91 Ga0268266_10230340 3300028379 Bacteria 1706
92 Ga0307513_10044305 3300031456 Bacteria 4875
93 Ga0307513_10142284 3300031456 Bacteria 2323
94 Ga0307408_100048540 3300031548 Bacteria 3046
95 Ga0265313_10127735 3300031595 Bacteria 1104
96 Ga0307508_10265404 3300031616 Bacteria 1311
97 Ga0265342_10017077 3300031712 Bacteria 4726
98 Ga0316576_10214079 3300031727 Bacteria 1450
99 Ga0316577_10025532 3300031733 Bacteria 3286
100 Ga0316577_10083308 3300031733 Bacteria 1789
101 Ga0307407_10131347 3300031903 Bacteria 1603
102 Ga0307416_100262491 3300032002 Bacteria 1689
103 Ga0373930_0052609 3300034816 Bacteria 892
104 Ga0373936_0042569 3300035113 Bacteria 1823
105 Ga0373953_0148859 3300035117 Bacteria 1003
106 Ga0373955_0230668 3300035172 Bacteria 1107
107 Ga0373931_0004221 3300035691 Bacteria 6536
108 Ga0373937_0035135 3300036401 Bacteria 4560
109 Ga0373937_0789704 3300036401 Bacteria 897
110 Ga0316582_0033191 3300036647 Bacteria 3168
111 Ga0316584_0012417 3300036712 Bacteria 6007
112 Ga0316584_0246962 3300036712 Bacteria 1305
113 Ga0395899_0029749 3300037312 Bacteria 4109
114 Ga0395899_0100309 3300037312 Bacteria 2091
115 Ga0395899_0181053 3300037312 Bacteria 1480
116 Ga0395900_0003718 3300037418 Bacteria 16398
117 Ga0395900_0032903 3300037418 Bacteria 5334
118 Ga0395900_0094297 3300037418 Bacteria 3074
119 Ga0395900_0178923 3300037418 Bacteria 2156
120 Ga0395898_0027222 3300037466 Bacteria 5742
121 Ga0395898_0072072 3300037466 Bacteria 3338
122 Ga0395898_0099270 3300037466 Bacteria 2796
123 Ga0395905_0001238 3300037471 Bacteria 31721
124 Ga0395905_0004341 3300037471 Bacteria 14766
125 Ga0395905_0005483 3300037471 Bacteria 12944
126 Ga0395905_0204835 3300037471 Bacteria 1849
127 Ga0395901_0003501 3300038443 Bacteria 15823
128 Ga0395901_0042618 3300038443 Bacteria 4706
129 Ga0395901_0057332 3300038443 Bacteria 4051
130 Ga0395901_0063996 3300038443 Bacteria 3828
131 Ga0400483_142660 3300039062 Bacteria 1025
132 Ga0436365_1087891 3300039437 Bacteria 1040
133 Ga0436365_1108413 3300039437 Bacteria 1474
134 Ga0436360_1305189 3300039438 Bacteria 2417
135 Ga0436361_0235048 3300039447 Bacteria 11329
136 Ga0436361_0269396 3300039447 Bacteria 6974
137 Ga0436363_0949174 3300039450 Bacteria 5043
138 Ga0436362_0989824 3300039453 Bacteria 2885
139 Ga0439439_0073678 3300041406 Bacteria 917
140 Ga0451837_1779907 3300041494 Bacteria 1497
141 Ga0439445_0012030 3300042004 Bacteria 2072
142 Ga0439449_0000597 3300042007 Bacteria 13554
143 Ga0450911_000254 3300042115 Bacteria 20091
144 Ga0450913_007481 3300042117 Bacteria 822
145 Ga0450899_016543 3300042135 Bacteria 846
146 Ga0439460_0068643 3300042461 Bacteria 1094
147 Ga0451577_0001218 3300042876 Bacteria 35907
148 Ga0451577_0012231 3300042876 Bacteria 8065
149 Ga0451577_0012782 3300042876 Bacteria 7877
150 Ga0451577_0297769 3300042876 Bacteria 1462
151 Ga0466969_0003249 3300044656 Bacteria 8645
152 Ga0466972_0095889 3300044658 Bacteria 1405
153 Ga0466965_0117262 3300044683 Bacteria 1372
154 Ga0466966_0013511 3300044684 Bacteria 5405
155 Ga0466966_0072944 3300044684 Bacteria 2148
156 Ga0466961_0000655 3300044693 Bacteria 21750
157 Ga0466964_0042257 3300044706 Bacteria 1846
158 Ga0453684_0000341 3300044712 Bacteria 194228
159 Ga0453684_0109525 3300044712 Bacteria 3359
160 Ga0453684_0273880 3300044712 Bacteria 1927
161 Ga0453684_1090139 3300044712 Bacteria 844
162 Ga0466971_0002490 3300044719 Bacteria 7786
163 Ga0466970_0001615 3300044765 Bacteria 10866
164 Ga0466970_0024785 3300044765 Bacteria 3138
165 Ga0466970_0111408 3300044765 Unclassified 1495
166 Ga0466960_0158331 3300044901 Bacteria 1214
167 Ga0466959_0003998 3300045049 Bacteria 9796
168 Ga0466959_0494098 3300045049 Bacteria 827
169 Ga0451576_0008613 3300045051 Bacteria 11949
170 Ga0451576_0195663 3300045051 Bacteria 2112
171 Ga0451576_0866097 3300045051 Bacteria 948
172 Ga0466958_0423809 3300045836 Bacteria 860
173 Ga0466967_0220467 3300045976 Bacteria 1802
174 Ga0495590_0007590 3300046457 Bacteria 4170
175 Ga0495610_0092120 3300046512 Bacteria 1372
176 Ga0495587_0109689 3300046536 Bacteria 1586
177 Ga0495660_0174576 3300046810 Bacteria 1044
178 Ga0495604_0086526 3300047317 Bacteria 2336
179 Ga0496102_0168308 3300048905 Bacteria 2063
180 Ga0496103_0264550 3300048906 Bacteria 1106
181 Ga0496104_0035426 3300048907 Bacteria 4660
182 Ga0496104_0526436 3300048907 Bacteria 1093
183 Ga0496105_0563835 3300048908 Bacteria 888
184 Ga0496106_0356706 3300048909 Bacteria 1175
185 Ga0496108_0589702 3300048911 Bacteria 969
186 Ga0496109_0237130 3300048912 Bacteria 1716
187 Ga0496110_0008875 3300048913 Bacteria 8104
188 Ga0496111_0149046 3300048914 Bacteria 1735
189 Ga0496112_0720549 3300048915 Bacteria 925
190 Ga0496115_0028359 3300048918 Bacteria 4387
191 Ga0496115_0144507 3300048918 Bacteria 1963
192 Ga0496122_0000039 3300048925 Bacteria 295352
193 Ga0496122_0001540 3300048925 Bacteria 36639
194 Ga0496123_0000026 3300048926 Bacteria 318040
195 Ga0496123_0103933 3300048926 Bacteria 1644
196 Ga0496125_0000442 3300048928 Bacteria 75719
197 Ga0496125_0021678 3300048928 Bacteria 5981
198 Ga0496125_0051187 3300048928 Bacteria 3409
199 Ga0496126_0086424 3300048929 Bacteria 2764
200 Ga0496126_0097288 3300048929 Bacteria 2580
201 Ga0501031_0005115 3300049568 Bacteria 8543
202 Ga0501034_0050701 3300049571 Bacteria 4186
203 Ga0501034_0085993 3300049571 Bacteria 3145
204 Ga0501034_0198677 3300049571 Bacteria 1964
205 Ga0501040_0000684 3300049576 Bacteria 20884
206 Ga0501047_0058268 3300049581 Bacteria 3731
207 Ga0501072_0134860 3300049588 Bacteria 1968
208 Ga0501074_0117978 3300049590 Bacteria 1898
209 Ga0501076_0019927 3300049592 Bacteria 5131
210 Ga0501079_0240844 3300049741 Bacteria 1413
211 Ga0501080_0001072 3300049742 Bacteria 22512
212 Ga0501081_0259586 3300049743 Bacteria 1269
213 Ga0501081_0267857 3300049743 Bacteria 1249
214 Ga0501083_0112058 3300049744 Bacteria 1793
215 Ga0501035_0192208 3300049822 Bacteria 1755
216 Ga0501044_0076555 3300049823 Bacteria 3395
217 nmdc:mga0yw44_164031_c1 3300050492 Bacteria 1456
218 nmdc:mga05p37_1072_c1 3300050507 Bacteria 31317
219 nmdc:mga05p37_29231_c1 3300050507 Bacteria 6727
220 nmdc:mga05p37_8012_c2 3300050507 Bacteria 10445
221 nmdc:mga09592_3012_c1 3300050508 Bacteria 13658
222 nmdc:mga09592_46557_c1 3300050508 Bacteria 3654
223 nmdc:mga0qj67_8600_c1 3300050509 Bacteria 7574
224 nmdc:mga06r32_12779_c1 3300050510 Bacteria 7592
225 nmdc:mga06r32_458_c1 3300050510 Bacteria 34859
226 nmdc:mga06r32_579495_c1 3300050510 Bacteria 1094
227 nmdc:mga08y16_4007_c1 3300050511 Bacteria 15354
228 nmdc:mga08x19_276577_c1 3300050514 Bacteria 1163
229 nmdc:mga0a205_358351_c1 3300050515 Bacteria 1325
230 Ga0500562_005345 3300053108 Bacteria 3225
231 Ga0500592_002744 3300053116 Bacteria 2838
232 Ga0500559_0003710 3300053136 Bacteria 7443
233 Ga0500559_0024973 3300053136 Bacteria 2543
234 Ga0500604_0017248 3300053151 Bacteria 1996
235 Ga0500616_0015917 3300053153 Bacteria 4291
236 Ga0500627_0000028 3300053158 Bacteria 99118
237 Ga0500567_138980 3300053723 Bacteria 934
238 Ga0501082_0011189 3300060353 Bacteria 7710
239 Ga0466962_0001310 3300061719 Bacteria 11481
240 2513614419 2513237090 Bacteria 7096802
241 2574429908 2574179768 Bacteria 4907129
242 2686534906 2684623035 Bacteria 8032739
243 2691332744 2690315857 Bacteria 4396207
244 2821449705 2821443989 Bacteria 7658172
245 2876764563 2876761206 Bacteria 10111113
246 2895887564 2895880812 Bacteria 11255272
247 2903778299 2903768456 Bacteria 9749579
248 2919537868 2919534386 Bacteria 4577686
249 2919691086 2919688452 Bacteria 4595932
250 2932406455 2932406140 Bacteria 5134491
251 2939578123 2939577877 Bacteria 5132791
252 8054357982 8054357960 Bacteria 2867777
253 8055228223 8055225921 Bacteria 3341787
254 8056970667 8056967851 Bacteria 9038162
255 Ga0436363_0669967
256 JGI25407J50210_10007775
257 Ga0058862_11787306
258 Ga0070658_10031025
259 Ga0070683_100705361
260 Ga0070661_100044140
261 Ga0070659_100000935
262 Ga0070703_10009652
263 Ga0070713_100051469
264 Ga0070713_100235181
265 Ga0070711_100234916
266 Ga0070694_100016850
267 Ga0070681_10173167
268 Ga0070706_100017564
269 Ga0070707_100788495
270 Ga0070699_100203933
271 Ga0070679_100058446
272 Ga0070695_100001965
273 Ga0070696_100014760
274 Ga0070693_100355483
275 Ga0070665_100272959
276 Ga0070704_100009793
277 Ga0068855_100022345
278 Ga0068855_100581426
279 Ga0070664_100026911
280 Ga0070664_100170917
281 Ga0068857_100210307
282 Ga0068856_100054199
283 Ga0068859_100108936
284 Ga0068858_100000081
285 Ga0068858_100419846
286 Ga0068858_100504320
287 Ga0068860_100520167
288 Ga0081455_10000911
289 Ga0081455_10020614
290 Ga0081538_10000007
291 Ga0081540_1062919
292 Ga0075365_10303331
293 Ga0075369_10197085
294 Ga0075428_100009253
295 Ga0075428_100024991
296 Ga0075430_100000219
297 Ga0075430_100012173
298 Ga0075431_100006409
299 Ga0075431_100025262
300 Ga0075433_10172164
301 Ga0075429_100000069
302 Ga0075429_100007594
303 Ga0097620_100108941
304 Ga0079104_1000088
305 Ga0099794_10012460
306 Ga0111539_10000738
307 Ga0111539_10551294
308 Ga0105245_10000189
309 Ga0105245_10341260
310 Ga0114129_10000066
311 Ga0114129_10021125
312 Ga0114129_10026604
313 Ga0105248_10000835
314 Ga0105249_10288249
315 Ga0105239_10076643
316 Ga0157374_10022874
317 Ga0163162_10139131
318 Ga0163162_10359455
319 Ga0163163_10016339
320 Ga0163163_10059456
321 Ga0182008_10175214
322 Ga0157379_10000042
323 Ga0157376_10022879
324 Ga0206354_11329161
325 Ga0214544_1000238
326 Ga0214542_1000244
327 Ga0207705_10043329
328 Ga0207707_10119049
329 Ga0207660_10147674
330 Ga0207652_10098258
331 Ga0207681_10725530
332 Ga0207687_10000665
333 Ga0207687_10401459
334 Ga0207690_10001019
335 Ga0207711_10005055
336 Ga0207661_10288544
337 Ga0207679_10015894
338 Ga0207667_10056023
339 Ga0207703_10000089
340 Ga0207702_10026816
341 Ga0207676_10112457
342 Ga0207674_10371048
343 Ga0209281_1000176
344 Ga0207428_10004434
345 Ga0268266_10230340
346 Ga0307513_10044305
347 Ga0307513_10142284
348 Ga0307408_100048540
349 Ga0265313_10127735
350 Ga0307508_10265404
351 Ga0265342_10017077
352 Ga0316576_10214079
353 Ga0316577_10025532
354 Ga0316577_10083308
355 Ga0307407_10131347
356 Ga0307416_100262491
357 Ga0373930_0052609
358 Ga0373936_0042569
359 Ga0373953_0148859
360 Ga0373955_0230668
361 Ga0373931_0004221
362 Ga0373937_0035135
363 Ga0373937_0789704
364 Ga0316582_0033191
365 Ga0316584_0012417
366 Ga0316584_0246962
367 Ga0395899_0029749
368 Ga0395899_0100309
369 Ga0395899_0181053
370 Ga0395900_0003718
371 Ga0395900_0032903
372 Ga0395900_0094297
373 Ga0395900_0178923
374 Ga0395898_0027222
375 Ga0395898_0072072
376 Ga0395898_0099270
377 Ga0395905_0001238
378 Ga0395905_0004341
379 Ga0395905_0005483
380 Ga0395905_0204835
381 Ga0395901_0003501
382 Ga0395901_0042618
383 Ga0395901_0057332
384 Ga0395901_0063996
385 Ga0400483_142660
386 Ga0436365_1087891
387 Ga0436365_1108413
388 Ga0436360_1305189
389 Ga0436361_0235048
390 Ga0436361_0269396
391 Ga0436363_0949174
392 Ga0436362_0989824
393 Ga0439439_0073678
394 Ga0451837_1779907
395 Ga0439445_0012030
396 Ga0439449_0000597
397 Ga0450911_000254
398 Ga0450913_007481
399 Ga0450899_016543
400 Ga0439460_0068643
401 Ga0451577_0001218
402 Ga0451577_0012231
403 Ga0451577_0012782
404 Ga0451577_0297769
405 Ga0466969_0003249
406 Ga0466972_0095889
407 Ga0466965_0117262
408 Ga0466966_0013511
409 Ga0466966_0072944
410 Ga0466961_0000655
411 Ga0466964_0042257
412 Ga0453684_0000341
413 Ga0453684_0109525
414 Ga0453684_0273880
415 Ga0453684_1090139
416 Ga0466971_0002490
417 Ga0466970_0001615
418 Ga0466970_0024785
419 Ga0466970_0111408
420 Ga0466960_0158331
421 Ga0466959_0003998
422 Ga0466959_0494098
423 Ga0451576_0008613
424 Ga0451576_0195663
425 Ga0451576_0866097
426 Ga0466958_0423809
427 Ga0466967_0220467
428 Ga0495590_0007590
429 Ga0495610_0092120
430 Ga0495587_0109689
431 Ga0495660_0174576
432 Ga0495604_0086526
433 Ga0496102_0168308
434 Ga0496103_0264550
435 Ga0496104_0035426
436 Ga0496104_0526436
437 Ga0496105_0563835
438 Ga0496106_0356706
439 Ga0496108_0589702
440 Ga0496109_0237130
441 Ga0496110_0008875
442 Ga0496111_0149046
443 Ga0496112_0720549
444 Ga0496115_0028359
445 Ga0496115_0144507
446 Ga0496122_0000039
447 Ga0496122_0001540
448 Ga0496123_0000026
449 Ga0496123_0103933
450 Ga0496125_0000442
451 Ga0496125_0021678
452 Ga0496125_0051187
453 Ga0496126_0086424
454 Ga0496126_0097288
455 Ga0501031_0005115
456 Ga0501034_0050701
457 Ga0501034_0085993
458 Ga0501034_0198677
459 Ga0501040_0000684
460 Ga0501047_0058268
461 Ga0501072_0134860
462 Ga0501074_0117978
463 Ga0501076_0019927
464 Ga0501079_0240844
465 Ga0501080_0001072
466 Ga0501081_0259586
467 Ga0501081_0267857
468 Ga0501083_0112058
469 Ga0501035_0192208
470 Ga0501044_0076555
471 nmdc:mga0yw44_164031_c1
472 nmdc:mga05p37_1072_c1
473 nmdc:mga05p37_29231_c1
474 nmdc:mga05p37_8012_c2
475 nmdc:mga09592_3012_c1
476 nmdc:mga09592_46557_c1
477 nmdc:mga0qj67_8600_c1
478 nmdc:mga06r32_12779_c1
479 nmdc:mga06r32_458_c1
480 nmdc:mga06r32_579495_c1
481 nmdc:mga08y16_4007_c1
482 nmdc:mga08x19_276577_c1
483 nmdc:mga0a205_358351_c1
484 Ga0500562_005345
485 Ga0500592_002744
486 Ga0500559_0003710
487 Ga0500559_0024973
488 Ga0500604_0017248
489 Ga0500616_0015917
490 Ga0500627_0000028
491 Ga0500567_138980
492 Ga0501082_0011189
493 Ga0466962_0001310
494 2513614419
495 2574429908
496 2686534906
497 2691332744
498 2821449705
499 2876764563
500 2895887564
501 2903778299
502 2919537868
503 2919691086
504 2932406455
505 2939578123
506 8054357982
507 8055228223
508 8056970667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

47

157

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9967 3 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9964 3 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9952 3 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9894 1 120
1nxo-assembly1.cif.gz_A-2 micarec ph7.0 0.9855 3 119
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9942 3 80 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9879 1 80 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9866 2 80 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9855 3 119 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.982 2 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0R2Y2J5-F1-model_v4 Transcriptional regulator 0.8835 2 226 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0R2Y2J5-F1-model_v4 Transcriptional regulator 0.8728 2 226 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2G6CAE7-F1-model_v4 Two-component system response regulator CreB 0.8651 2 147 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2G6CAE7-F1-model_v4 Two-component system response regulator CreB 0.8423 2 147 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1C5YCP6-F1-model_v4 Stage 0 sporulation protein A homolog 0.8254 28 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map