F364464

General Info

Members Datasets Scaffolds Average Seq Length
253 171 506 196

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000044|Ga0500616_0000044_56733_57341
Length 202
Sequence MRKITVLSMISLDGVMQAPGGPQEDLSGGFQYGGWTASYGDELFGKIMAEELKPADYILGRNTFDIFSAYWPQHADFWPGINDGTKYVLSQTLEKSDPKVTGWKNTVVLKSVADIEKLKHSDGADIQVWGSSKLIHLLLEHDLVDELRLKIYPLILGKGKKLFDNGAIPAALTLTETHITSKGVIIANYKRAGEITTGDILI

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
144 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
145 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
146 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
147 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
148 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
153 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
154 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
155 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
156 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
157 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
160 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
163 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
164 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
165 2738543023 Pedobacter sp. OK628 Isolate Unclassified
166 2739367663 Pedobacter sp. YR510 Isolate Unclassified
167 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
168 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
169 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
170 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
171 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 0
Isolates 3.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.67
Nodule 0
Rhizoplane 0.79
Rhizosphere 75.49
Stem 0
Stem Tuber 0
Unclassified 5.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000044 3300053153 Bacteria 339611
2 SwRhRL2b_contig_3019120 2162886007 Bacteria 1118
3 SwRhRL2b_contig_566651 2162886007 Bacteria 8673
4 JGI24740J21852_10000062 3300001979 Bacteria 34499
5 JGI25154J39366_1000016 3300002738 Bacteria 255057
6 JGI25158J39367_1006017 3300002739 Bacteria 1754
7 JGI25157J39369_1008656 3300002741 Bacteria 1405
8 JGI25153J46596_10000435 3300003215 Bacteria 26902
9 rootH2_10022014 3300003320 Bacteria 6390
10 rootH2_10091722 3300003320 Bacteria 5845
11 rootH2_10243119 3300003320 Bacteria 2340
12 rootL2_10195368 3300003322 Unclassified 4217
13 rootH1_10066023 3300003323 Bacteria 1994
14 rootH1_10097383 3300003323 Bacteria 1868
15 JGI25160J50197_1010512 3300003354 Bacteria 3340
16 JGI25160J50197_1021056 3300003354 Bacteria 1949
17 Ga0065704_10071392 3300005289 Bacteria 11347
18 Ga0065712_10013481 3300005290 Bacteria 2204
19 Ga0070658_10583265 3300005327 Bacteria 968
20 Ga0070683_100157220 3300005329 Bacteria 2156
21 Ga0068869_100053632 3300005334 Bacteria 2932
22 Ga0070680_100027949 3300005336 Bacteria 4521
23 Ga0070680_100098534 3300005336 Bacteria 2425
24 Ga0068868_100177398 3300005338 Bacteria 1766
25 Ga0070660_100006671 3300005339 Bacteria 8012
26 Ga0070660_100008061 3300005339 Bacteria 7361
27 Ga0070660_100086649 3300005339 Bacteria 2464
28 Ga0070692_10073914 3300005345 Bacteria 1822
29 Ga0070669_100166067 3300005353 Bacteria 1718
30 Ga0070659_100065462 3300005366 Bacteria 2878
31 Ga0070714_100295296 3300005435 Bacteria 1509
32 Ga0070681_10044972 3300005458 Bacteria 4419
33 Ga0070681_10099103 3300005458 Bacteria 2860
34 Ga0070681_10429108 3300005458 Bacteria 1234
35 Ga0068867_101245495 3300005459 Unclassified 685
36 Ga0070679_100245231 3300005530 Bacteria 1748
37 Ga0070679_100973925 3300005530 Bacteria 792
38 Ga0070679_101132247 3300005530 Bacteria 727
39 Ga0068853_100004438 3300005539 Bacteria 10870
40 Ga0068853_100055020 3300005539 Bacteria 3429
41 Ga0068853_100084998 3300005539 Bacteria 2773
42 Ga0068853_100213617 3300005539 Bacteria 1759
43 Ga0070665_100004917 3300005548 Bacteria 13863
44 Ga0068855_100087324 3300005563 Bacteria 3605
45 Ga0068855_100170729 3300005563 Bacteria 2463
46 Ga0068855_101053687 3300005563 Bacteria 852
47 Ga0068857_100019063 3300005577 Bacteria 6020
48 Ga0068857_100414093 3300005577 Bacteria 1256
49 Ga0068856_100025472 3300005614 Bacteria 5770
50 Ga0068856_100034362 3300005614 Bacteria 4966
51 Ga0068856_100456373 3300005614 Bacteria 1299
52 Ga0068852_100109264 3300005616 Bacteria 2511
53 Ga0068852_100250391 3300005616 Bacteria 1697
54 Ga0068859_101015588 3300005617 Bacteria 911
55 Ga0068864_100829620 3300005618 Bacteria 910
56 Ga0068851_10026936 3300005834 Bacteria 2829
57 Ga0068860_100024959 3300005843 Bacteria 5771
58 Ga0097621_100111943 3300006237 Bacteria 2307
59 Ga0097620_101015407 3300006931 Bacteria 911
60 Ga0105240_10000008 3300009093 Bacteria 618862
61 Ga0105240_10034753 3300009093 Bacteria 6499
62 Ga0105240_10055995 3300009093 Bacteria 4935
63 Ga0105240_10104345 3300009093 Bacteria 3442
64 Ga0105240_10417200 3300009093 Bacteria 1509
65 Ga0105243_10000127 3300009148 Bacteria 86196
66 Ga0105243_10301136 3300009148 Bacteria 1453
67 Ga0105242_10018941 3300009176 Bacteria 5391
68 Ga0105237_10006845 3300009545 Bacteria 12564
69 Ga0105237_10041755 3300009545 Bacteria 4625
70 Ga0105238_10113112 3300009551 Bacteria 2694
71 Ga0105238_10217183 3300009551 Bacteria 1888
72 Ga0105238_10657428 3300009551 Bacteria 1058
73 Ga0105239_10000079 3300010375 Bacteria 135513
74 Ga0105239_10000610 3300010375 Bacteria 50916
75 Ga0105239_10006588 3300010375 Bacteria 13450
76 Ga0105239_10038163 3300010375 Bacteria 5264
77 Ga0105239_10102394 3300010375 Bacteria 3169
78 Ga0105239_10161837 3300010375 Bacteria 2501
79 Ga0105239_10358922 3300010375 Bacteria 1646
80 Ga0157373_10059948 3300013100 Bacteria 2696
81 Ga0157371_10033879 3300013102 Bacteria 3667
82 Ga0157371_10066506 3300013102 Bacteria 2552
83 Ga0157371_10550539 3300013102 Unclassified 855
84 Ga0157369_10490325 3300013105 Unclassified 1271
85 Ga0157374_10000009 3300013296 Bacteria 564330
86 Ga0163162_10972393 3300013306 Bacteria 959
87 Ga0157372_10008763 3300013307 Bacteria 10742
88 Ga0157372_10705441 3300013307 Bacteria 1174
89 Ga0157372_11991651 3300013307 Bacteria 667
90 Ga0157379_10082058 3300014968 Bacteria 2889
91 Ga0157376_10013036 3300014969 Bacteria 6193
92 Ga0182006_1000011 3300015261 Bacteria 408647
93 Ga0183373_1001 3300015682 Bacteria 1410374
94 Ga0163161_10093596 3300017792 Bacteria 2227
95 Ga0209646_1000003 3300025246 Bacteria 1160860
96 Ga0209026_1000334 3300025250 Bacteria 45711
97 Ga0209129_1006306 3300025258 Bacteria 3884
98 Ga0209130_1001631 3300025284 Bacteria 13815
99 Ga0209758_1002380 3300025297 Bacteria 19358
100 Ga0209050_1001044 3300025298 Bacteria 34198
101 Ga0209050_1006445 3300025298 Bacteria 6943
102 Ga0207426_1000310 3300025302 Bacteria 96036
103 Ga0207426_1000364 3300025302 Bacteria 80671
104 Ga0209257_1058355 3300025304 Bacteria 1058
105 Ga0207656_10005104 3300025321 Bacteria 4617
106 Ga0207647_10027541 3300025904 Bacteria 3704
107 Ga0207647_10167212 3300025904 Bacteria 1281
108 Ga0207707_10105897 3300025912 Bacteria 2458
109 Ga0207707_10364044 3300025912 Bacteria 1245
110 Ga0207695_10000021 3300025913 Bacteria 679399
111 Ga0207695_10102051 3300025913 Bacteria 2862
112 Ga0207695_10126686 3300025913 Bacteria 2515
113 Ga0207695_10343767 3300025913 Bacteria 1379
114 Ga0207671_10000961 3300025914 Bacteria 35766
115 Ga0207671_10568334 3300025914 Bacteria 904
116 Ga0207671_10680536 3300025914 Bacteria 818
117 Ga0207660_10012762 3300025917 Bacteria 5500
118 Ga0207660_10358157 3300025917 Bacteria 1170
119 Ga0207657_10011787 3300025919 Bacteria 8657
120 Ga0207657_10014107 3300025919 Bacteria 7819
121 Ga0207652_10000057 3300025921 Bacteria 113664
122 Ga0207652_10021920 3300025921 Bacteria 5278
123 Ga0207652_10070699 3300025921 Bacteria 3031
124 Ga0207681_10107180 3300025923 Bacteria 2026
125 Ga0207681_10249215 3300025923 Bacteria 1386
126 Ga0207650_10118347 3300025925 Bacteria 2059
127 Ga0207664_10364862 3300025929 Unclassified 1280
128 Ga0207686_10119561 3300025934 Bacteria 1791
129 Ga0207686_10322251 3300025934 Bacteria 1155
130 Ga0207709_10000176 3300025935 Bacteria 86175
131 Ga0207689_10100510 3300025942 Bacteria 2376
132 Ga0207667_10007347 3300025949 Bacteria 13261
133 Ga0207667_10054488 3300025949 Bacteria 4206
134 Ga0207667_10086179 3300025949 Bacteria 3251
135 Ga0207668_10266769 3300025972 Bacteria 1398
136 Ga0207668_10442938 3300025972 Bacteria 1107
137 Ga0207639_10180142 3300026041 Bacteria 1797
138 Ga0207639_10315940 3300026041 Bacteria 1385
139 Ga0207639_10747126 3300026041 Bacteria 909
140 Ga0207678_10064566 3300026067 Bacteria 3145
141 Ga0207708_10134788 3300026075 Bacteria 1933
142 Ga0207702_10296244 3300026078 Bacteria 1534
143 Ga0207641_10567021 3300026088 Bacteria 1109
144 Ga0207674_10021785 3300026116 Bacteria 6897
145 Ga0207674_10024730 3300026116 Bacteria 6411
146 Ga0207674_10409790 3300026116 Bacteria 1310
147 Ga0207698_11117032 3300026142 Bacteria 801
148 Ga0207428_10012497 3300027907 Bacteria 7457
149 Ga0268266_10004702 3300028379 Bacteria 12994
150 Ga0268264_10004651 3300028381 Bacteria 11663
151 Ga0265336_10020190 3300028666 Bacteria 2141
152 Ga0307517_10006280 3300028786 Bacteria 17659
153 Ga0307515_10198855 3300028794 Bacteria 1887
154 Ga0265338_10000566 3300028800 Bacteria 65065
155 Ga0307511_10000429 3300030521 Bacteria 44853
156 Ga0307513_10039126 3300031456 Bacteria 5259
157 Ga0307516_10361083 3300031730 Bacteria 1117
158 Ga0307412_10000017 3300031911 Bacteria 294698
159 Ga0307414_10000586 3300032004 Bacteria 18882
160 Ga0307414_10000806 3300032004 Bacteria 16044
161 Ga0307414_10142589 3300032004 Bacteria 1878
162 Ga0395899_0107462 3300037312 Bacteria 2008
163 Ga0395900_0274849 3300037418 Unclassified 1678
164 Ga0395901_0129735 3300038443 Bacteria 2649
165 Ga0395901_0426993 3300038443 Bacteria 1358
166 Ga0451837_1339514 3300041494 Unclassified 828
167 Ga0451853_2816621 3300041512 Bacteria 962
168 Ga0439445_0177441 3300042004 Bacteria 625
169 Ga0451577_0037315 3300042876 Bacteria 4374
170 Ga0451577_0847519 3300042876 Bacteria 824
171 Ga0466972_0010772 3300044658 Bacteria 4589
172 Ga0466972_0042808 3300044658 Bacteria 2200
173 Ga0466961_0056371 3300044693 Bacteria 2504
174 Ga0453684_0000766 3300044712 Bacteria 111429
175 Ga0453684_0082678 3300044712 Bacteria 3999
176 Ga0466960_0074528 3300044901 Bacteria 1696
177 Ga0451576_0232104 3300045051 Bacteria 1927
178 Ga0495627_007480 3300046453 Bacteria 4176
179 Ga0495638_0035213 3300046460 Bacteria 3193
180 Ga0495638_0170994 3300046460 Bacteria 1247
181 Ga0495585_0000902 3300046492 Bacteria 25158
182 Ga0495606_0007501 3300046507 Bacteria 9740
183 Ga0495606_0012928 3300046507 Bacteria 6645
184 Ga0495606_0022762 3300046507 Bacteria 4554
185 Ga0495610_0000001 3300046512 Bacteria 1620061
186 Ga0495648_0028229 3300046524 Bacteria 3741
187 Ga0495663_0013913 3300046525 Bacteria 2251
188 Ga0495609_0018181 3300046538 Bacteria 3259
189 Ga0495633_0000099 3300046558 Bacteria 116834
190 Ga0495668_0000003 3300046616 Bacteria 695023
191 Ga0495611_0000057 3300046648 Bacteria 80239
192 Ga0495625_0001822 3300046660 Bacteria 24395
193 Ga0495660_0009170 3300046810 Bacteria 5779
194 Ga0495593_0188151 3300047673 Bacteria 1039
195 Ga0495614_0020950 3300048089 Bacteria 2826
196 Ga0496102_0063605 3300048905 Bacteria 3379
197 Ga0496103_0327453 3300048906 Bacteria 985
198 Ga0496116_0000012 3300048919 Bacteria 611365
199 Ga0496117_0000257 3300048920 Bacteria 99879
200 Ga0496118_0000196 3300048921 Bacteria 106933
201 Ga0496119_0000002 3300048922 Bacteria 738385
202 Ga0496121_0197422 3300048924 Bacteria 1437
203 Ga0496122_0000090 3300048925 Bacteria 205886
204 Ga0496122_0000633 3300048925 Bacteria 71586
205 Ga0496122_0003496 3300048925 Bacteria 20642
206 Ga0496123_0000775 3300048926 Bacteria 51737
207 Ga0496123_0024103 3300048926 Bacteria 4635
208 Ga0496124_0016275 3300048927 Bacteria 7081
209 Ga0496125_0007872 3300048928 Bacteria 11259
210 Ga0501032_0458953 3300049569 Unclassified 816
211 Ga0501034_0000028 3300049571 Bacteria 255803
212 Ga0501034_0144341 3300049571 Unclassified 2358
213 Ga0501034_0232799 3300049571 Bacteria 1791
214 Ga0501036_0148380 3300049572 Bacteria 1978
215 Ga0501037_0000001 3300049573 Bacteria 753276
216 Ga0501038_0112302 3300049574 Bacteria 2256
217 Ga0501047_0233500 3300049581 Bacteria 1692
218 Ga0501047_0269235 3300049581 Unclassified 1550
219 Ga0501047_0320790 3300049581 Bacteria 1389
220 Ga0501210_001024 3300049657 Bacteria 1512
221 Ga0501236_001392 3300049670 Bacteria 2753
222 Ga0501253_101002 3300049683 Bacteria 676
223 Ga0501257_001552 3300049686 Bacteria 4785
224 Ga0501264_000177 3300049761 Bacteria 10348
225 Ga0501267_013632 3300049764 Bacteria 847
226 Ga0501035_0206729 3300049822 Unclassified 1681
227 Ga0501044_0211460 3300049823 Unclassified 1894
228 nmdc:mga08y16_3563_c1 3300050511 Bacteria 16166
229 Ga0500578_0000009 3300053086 Bacteria 219807
230 Ga0500646_0058889 3300053090 Bacteria 1125
231 Ga0500583_0000050 3300053092 Bacteria 77416
232 Ga0500583_0000764 3300053092 Bacteria 9334
233 Ga0500583_0001356 3300053092 Bacteria 7015
234 Ga0500556_0168701 3300053104 Unclassified 864
235 Ga0500608_113256 3300053122 Bacteria 1241
236 Ga0500614_056248 3300053123 Bacteria 1046
237 Ga0500616_0013159 3300053153 Bacteria 4816
238 Ga0500616_0117770 3300053153 Bacteria 1273
239 Ga0500622_0000012 3300053156 Bacteria 383183
240 Ga0500622_0000013 3300053156 Bacteria 371650
241 Ga0500627_0106598 3300053158 Bacteria 1260
242 Ga0500611_000037 3300053727 Bacteria 72513
243 Ga0466962_0016608 3300061719 Bacteria 3550
244 2587679728 2585428045 Bacteria 5203023
245 2588219504 2585428184 Bacteria 4978681
246 2590601032 2588254255 Bacteria 5014294
247 2739300911 2738543023 Bacteria 6767879
248 2739647205 2739367663 Bacteria 5040914
249 2842083968 2842083920 Bacteria 4857652
250 2929179847 2929177148 Bacteria 7883697
251 2945982273 2945977869 Bacteria 7777518
252 2946018339 2946013367 Bacteria 7766675
253 8003151802 8003151029 Bacteria 8187759
254 Ga0500616_0000044
255 SwRhRL2b_contig_3019120
256 SwRhRL2b_contig_566651
257 JGI24740J21852_10000062
258 JGI25154J39366_1000016
259 JGI25158J39367_1006017
260 JGI25157J39369_1008656
261 JGI25153J46596_10000435
262 rootH2_10022014
263 rootH2_10091722
264 rootH2_10243119
265 rootL2_10195368
266 rootH1_10066023
267 rootH1_10097383
268 JGI25160J50197_1010512
269 JGI25160J50197_1021056
270 Ga0065704_10071392
271 Ga0065712_10013481
272 Ga0070658_10583265
273 Ga0070683_100157220
274 Ga0068869_100053632
275 Ga0070680_100027949
276 Ga0070680_100098534
277 Ga0068868_100177398
278 Ga0070660_100006671
279 Ga0070660_100008061
280 Ga0070660_100086649
281 Ga0070692_10073914
282 Ga0070669_100166067
283 Ga0070659_100065462
284 Ga0070714_100295296
285 Ga0070681_10044972
286 Ga0070681_10099103
287 Ga0070681_10429108
288 Ga0068867_101245495
289 Ga0070679_100245231
290 Ga0070679_100973925
291 Ga0070679_101132247
292 Ga0068853_100004438
293 Ga0068853_100055020
294 Ga0068853_100084998
295 Ga0068853_100213617
296 Ga0070665_100004917
297 Ga0068855_100087324
298 Ga0068855_100170729
299 Ga0068855_101053687
300 Ga0068857_100019063
301 Ga0068857_100414093
302 Ga0068856_100025472
303 Ga0068856_100034362
304 Ga0068856_100456373
305 Ga0068852_100109264
306 Ga0068852_100250391
307 Ga0068859_101015588
308 Ga0068864_100829620
309 Ga0068851_10026936
310 Ga0068860_100024959
311 Ga0097621_100111943
312 Ga0097620_101015407
313 Ga0105240_10000008
314 Ga0105240_10034753
315 Ga0105240_10055995
316 Ga0105240_10104345
317 Ga0105240_10417200
318 Ga0105243_10000127
319 Ga0105243_10301136
320 Ga0105242_10018941
321 Ga0105237_10006845
322 Ga0105237_10041755
323 Ga0105238_10113112
324 Ga0105238_10217183
325 Ga0105238_10657428
326 Ga0105239_10000079
327 Ga0105239_10000610
328 Ga0105239_10006588
329 Ga0105239_10038163
330 Ga0105239_10102394
331 Ga0105239_10161837
332 Ga0105239_10358922
333 Ga0157373_10059948
334 Ga0157371_10033879
335 Ga0157371_10066506
336 Ga0157371_10550539
337 Ga0157369_10490325
338 Ga0157374_10000009
339 Ga0163162_10972393
340 Ga0157372_10008763
341 Ga0157372_10705441
342 Ga0157372_11991651
343 Ga0157379_10082058
344 Ga0157376_10013036
345 Ga0182006_1000011
346 Ga0183373_1001
347 Ga0163161_10093596
348 Ga0209646_1000003
349 Ga0209026_1000334
350 Ga0209129_1006306
351 Ga0209130_1001631
352 Ga0209758_1002380
353 Ga0209050_1001044
354 Ga0209050_1006445
355 Ga0207426_1000310
356 Ga0207426_1000364
357 Ga0209257_1058355
358 Ga0207656_10005104
359 Ga0207647_10027541
360 Ga0207647_10167212
361 Ga0207707_10105897
362 Ga0207707_10364044
363 Ga0207695_10000021
364 Ga0207695_10102051
365 Ga0207695_10126686
366 Ga0207695_10343767
367 Ga0207671_10000961
368 Ga0207671_10568334
369 Ga0207671_10680536
370 Ga0207660_10012762
371 Ga0207660_10358157
372 Ga0207657_10011787
373 Ga0207657_10014107
374 Ga0207652_10000057
375 Ga0207652_10021920
376 Ga0207652_10070699
377 Ga0207681_10107180
378 Ga0207681_10249215
379 Ga0207650_10118347
380 Ga0207664_10364862
381 Ga0207686_10119561
382 Ga0207686_10322251
383 Ga0207709_10000176
384 Ga0207689_10100510
385 Ga0207667_10007347
386 Ga0207667_10054488
387 Ga0207667_10086179
388 Ga0207668_10266769
389 Ga0207668_10442938
390 Ga0207639_10180142
391 Ga0207639_10315940
392 Ga0207639_10747126
393 Ga0207678_10064566
394 Ga0207708_10134788
395 Ga0207702_10296244
396 Ga0207641_10567021
397 Ga0207674_10021785
398 Ga0207674_10024730
399 Ga0207674_10409790
400 Ga0207698_11117032
401 Ga0207428_10012497
402 Ga0268266_10004702
403 Ga0268264_10004651
404 Ga0265336_10020190
405 Ga0307517_10006280
406 Ga0307515_10198855
407 Ga0265338_10000566
408 Ga0307511_10000429
409 Ga0307513_10039126
410 Ga0307516_10361083
411 Ga0307412_10000017
412 Ga0307414_10000586
413 Ga0307414_10000806
414 Ga0307414_10142589
415 Ga0395899_0107462
416 Ga0395900_0274849
417 Ga0395901_0129735
418 Ga0395901_0426993
419 Ga0451837_1339514
420 Ga0451853_2816621
421 Ga0439445_0177441
422 Ga0451577_0037315
423 Ga0451577_0847519
424 Ga0466972_0010772
425 Ga0466972_0042808
426 Ga0466961_0056371
427 Ga0453684_0000766
428 Ga0453684_0082678
429 Ga0466960_0074528
430 Ga0451576_0232104
431 Ga0495627_007480
432 Ga0495638_0035213
433 Ga0495638_0170994
434 Ga0495585_0000902
435 Ga0495606_0007501
436 Ga0495606_0012928
437 Ga0495606_0022762
438 Ga0495610_0000001
439 Ga0495648_0028229
440 Ga0495663_0013913
441 Ga0495609_0018181
442 Ga0495633_0000099
443 Ga0495668_0000003
444 Ga0495611_0000057
445 Ga0495625_0001822
446 Ga0495660_0009170
447 Ga0495593_0188151
448 Ga0495614_0020950
449 Ga0496102_0063605
450 Ga0496103_0327453
451 Ga0496116_0000012
452 Ga0496117_0000257
453 Ga0496118_0000196
454 Ga0496119_0000002
455 Ga0496121_0197422
456 Ga0496122_0000090
457 Ga0496122_0000633
458 Ga0496122_0003496
459 Ga0496123_0000775
460 Ga0496123_0024103
461 Ga0496124_0016275
462 Ga0496125_0007872
463 Ga0501032_0458953
464 Ga0501034_0000028
465 Ga0501034_0144341
466 Ga0501034_0232799
467 Ga0501036_0148380
468 Ga0501037_0000001
469 Ga0501038_0112302
470 Ga0501047_0233500
471 Ga0501047_0269235
472 Ga0501047_0320790
473 Ga0501210_001024
474 Ga0501236_001392
475 Ga0501253_101002
476 Ga0501257_001552
477 Ga0501264_000177
478 Ga0501267_013632
479 Ga0501035_0206729
480 Ga0501044_0211460
481 nmdc:mga08y16_3563_c1
482 Ga0500578_0000009
483 Ga0500646_0058889
484 Ga0500583_0000050
485 Ga0500583_0000764
486 Ga0500583_0001356
487 Ga0500556_0168701
488 Ga0500608_113256
489 Ga0500614_056248
490 Ga0500616_0013159
491 Ga0500616_0117770
492 Ga0500622_0000012
493 Ga0500622_0000013
494 Ga0500627_0106598
495 Ga0500611_000037
496 Ga0466962_0016608
497 2587679728
498 2588219504
499 2590601032
500 2739300911
501 2739647205
502 2842083968
503 2929179847
504 2945982273
505 2946018339
506 8003151802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

186

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8033 2 187
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.801 1 187
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7969 1 187
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7954 1 187
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7914 3 187
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7896 1 187 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7891 3 191 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7855 1 187 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7808 2 184 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7807 3 191 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A520CGX7-F1-model_v4 Dihydrofolate reductase 0.9447 56 197 GO:0008703
GO:0009231
AF-A0A520CGX7-F1-model_v4 Dihydrofolate reductase 0.9384 56 197 GO:0008703
GO:0009231
AF-A0A838TPT1-F1-model_v4 Dihydrofolate reductase family protein 0.9341 70 197 GO:0008703
GO:0009231
AF-A0A838TPT1-F1-model_v4 Dihydrofolate reductase family protein 0.9272 70 197 GO:0008703
GO:0009231
AF-A0A385SXB1-F1-model_v4 Dihydrofolate reductase 0.9235 1 197 GO:0008703
GO:0009231

Map