F364373
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 173 | 250 | 545 |
Family's Representative Sequence
| Representative Sequence | 3300048914|Ga0496111_0105015|Ga0496111_0105015_10_1749 |
| Length | 579 |
| Sequence | MTETPQPPRRKDEPAATPVGKAAVFLDERTGGAKGLKGLLGKVFPDHWSFMLGEIALYSFIVLLLSGTYLSLFFKPSQAEVIYHGSYVPLDGLSMTDAYSSTLHITFDVRGGLLMRQIHHWAALLFVAAITVHLFRVYFTGAFRKPRELNWLIGVGLLTLGILEGFAGYSLPDDLLSGTGLRIAEGIVQAIPVVGTYLASFVFGGEFPGNDFISRLYTVHILIVPALILALITAHLFLVVYHKHTQFPGPGRTEQNVVGYPLLPVYTAKAGGFFFVVFGVITLLSALVTINPVWLFGPYNPSQITAGSQPDWYIGFLDGALRIFPNWETYIWGHTISWNIFIPSVVIPGILFTLLGAYPFIEQFVTGDKRDHHLLDRPRNMPVRTGLGAMAISFYLLLWIGGGNDIIATRFDLTINEITRSIQVALFVVPPLVFLATKRICLGLQHRDRDKLLHGRETGIIRRLPSGEFVEIHAPVPDEERYTILQAGQMRPEPLALPAAVDDNGVPAPGGRKAALRAKLSAWFYAESVLTPSDEELHHAAHHAQELLEDQQRQLDAYNAGVPVDVSAEPDTREVTSGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 2 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 3 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 114 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 115 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 116 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 117 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 118 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 119 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 121 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 124 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 127 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 128 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 132 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 133 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 134 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 135 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 136 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 137 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 140 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 141 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 142 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 151 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 152 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 153 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.44 |
| Metatranscriptomes | 2.37 |
| Isolates | 1.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.91 |
| Rhizosphere | 87.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007397 | 3300001979 | Bacteria | 4468 |
| 2 | JGI24739J22299_10001876 | 3300001989 | Bacteria | 8018 |
| 3 | JGI24737J22298_10002997 | 3300001990 | Bacteria | 5986 |
| 4 | JGI25406J46586_10000292 | 3300003203 | Bacteria | 22443 |
| 5 | Ga0070658_10038083 | 3300005327 | Bacteria | 3878 |
| 6 | Ga0070658_10044237 | 3300005327 | Bacteria | 3598 |
| 7 | Ga0070683_100124749 | 3300005329 | Bacteria | 2434 |
| 8 | Ga0070670_100036062 | 3300005331 | Bacteria | 4257 |
| 9 | Ga0068869_100002657 | 3300005334 | Bacteria | 10799 |
| 10 | Ga0070680_100111998 | 3300005336 | Bacteria | 2272 |
| 11 | Ga0070682_100011270 | 3300005337 | Bacteria | 5103 |
| 12 | Ga0068868_100009620 | 3300005338 | Bacteria | 6972 |
| 13 | Ga0070668_100055400 | 3300005347 | Bacteria | 3060 |
| 14 | Ga0070675_100133728 | 3300005354 | Bacteria | 2115 |
| 15 | Ga0070671_100005593 | 3300005355 | Bacteria | 10006 |
| 16 | Ga0070659_100022584 | 3300005366 | Bacteria | 4803 |
| 17 | Ga0070659_100048842 | 3300005366 | Bacteria | 3325 |
| 18 | Ga0070667_100090619 | 3300005367 | Bacteria | 2628 |
| 19 | Ga0070709_10015372 | 3300005434 | Bacteria | 4353 |
| 20 | Ga0070714_100009359 | 3300005435 | Bacteria | 7697 |
| 21 | Ga0070710_10000039 | 3300005437 | Bacteria | 60337 |
| 22 | Ga0070705_100091806 | 3300005440 | Bacteria | 1894 |
| 23 | Ga0070663_100010380 | 3300005455 | Bacteria | 5805 |
| 24 | Ga0070678_100004093 | 3300005456 | Bacteria | 8214 |
| 25 | Ga0070681_10010142 | 3300005458 | Bacteria | 9289 |
| 26 | Ga0070681_10124474 | 3300005458 | Bacteria | 2511 |
| 27 | Ga0070681_10208752 | 3300005458 | Bacteria | 1869 |
| 28 | Ga0070679_100013030 | 3300005530 | Bacteria | 7962 |
| 29 | Ga0070679_100023841 | 3300005530 | Bacteria | 5995 |
| 30 | Ga0070684_100133623 | 3300005535 | Bacteria | 2239 |
| 31 | Ga0070693_100001271 | 3300005547 | Bacteria | 11405 |
| 32 | Ga0070665_100003985 | 3300005548 | Bacteria | 15573 |
| 33 | Ga0068855_100035129 | 3300005563 | Bacteria | 5971 |
| 34 | Ga0068855_100039338 | 3300005563 | Bacteria | 5614 |
| 35 | Ga0068855_100055099 | 3300005563 | Bacteria | 4671 |
| 36 | Ga0068855_100093043 | 3300005563 | Bacteria | 3476 |
| 37 | Ga0068855_100104395 | 3300005563 | Bacteria | 3260 |
| 38 | Ga0070664_100062004 | 3300005564 | Bacteria | 3187 |
| 39 | Ga0068857_100033222 | 3300005577 | Bacteria | 4563 |
| 40 | Ga0068857_100119410 | 3300005577 | Bacteria | 2373 |
| 41 | Ga0068854_100012270 | 3300005578 | Bacteria | 5609 |
| 42 | Ga0068854_100079818 | 3300005578 | Bacteria | 2413 |
| 43 | Ga0068856_100009445 | 3300005614 | Bacteria | 9471 |
| 44 | Ga0068856_100038175 | 3300005614 | Bacteria | 4714 |
| 45 | Ga0068856_100162465 | 3300005614 | Bacteria | 2244 |
| 46 | Ga0070702_100000618 | 3300005615 | Bacteria | 13083 |
| 47 | Ga0070702_100013746 | 3300005615 | Bacteria | 4094 |
| 48 | Ga0068852_100082587 | 3300005616 | Bacteria | 2855 |
| 49 | Ga0068864_100046924 | 3300005618 | Bacteria | 3708 |
| 50 | Ga0068851_10021712 | 3300005834 | Bacteria | 3118 |
| 51 | Ga0068863_100009864 | 3300005841 | Bacteria | 9304 |
| 52 | Ga0068863_100010783 | 3300005841 | Bacteria | 8865 |
| 53 | Ga0068858_100060858 | 3300005842 | Bacteria | 3490 |
| 54 | Ga0081455_10046575 | 3300005937 | Bacteria | 3761 |
| 55 | Ga0081539_10000242 | 3300005985 | Bacteria | 127897 |
| 56 | Ga0070717_10002693 | 3300006028 | Bacteria | 12522 |
| 57 | Ga0070716_100000222 | 3300006173 | Bacteria | 22754 |
| 58 | Ga0068871_100021881 | 3300006358 | Bacteria | 4923 |
| 59 | Ga0075428_100032129 | 3300006844 | Bacteria | 5798 |
| 60 | Ga0075433_10046061 | 3300006852 | Bacteria | 3791 |
| 61 | Ga0075434_100034457 | 3300006871 | Bacteria | 4999 |
| 62 | Ga0075434_100225201 | 3300006871 | Bacteria | 1895 |
| 63 | Ga0075436_100007449 | 3300006914 | Bacteria | 7485 |
| 64 | Ga0075435_100006974 | 3300007076 | Bacteria | 8021 |
| 65 | Ga0105240_10007675 | 3300009093 | Bacteria | 15616 |
| 66 | Ga0105240_10018433 | 3300009093 | Bacteria | 9371 |
| 67 | Ga0105240_10041725 | 3300009093 | Bacteria | 5852 |
| 68 | Ga0105245_10028224 | 3300009098 | Bacteria | 4947 |
| 69 | Ga0105247_10010522 | 3300009101 | Bacteria | 5590 |
| 70 | Ga0114129_10010612 | 3300009147 | Bacteria | 13136 |
| 71 | Ga0114129_10021145 | 3300009147 | Bacteria | 9239 |
| 72 | Ga0114129_10051656 | 3300009147 | Bacteria | 5771 |
| 73 | Ga0105243_10035980 | 3300009148 | Bacteria | 3840 |
| 74 | Ga0105241_10006484 | 3300009174 | Bacteria | 8629 |
| 75 | Ga0105248_10023874 | 3300009177 | Bacteria | 6796 |
| 76 | Ga0105237_10009695 | 3300009545 | Bacteria | 10305 |
| 77 | Ga0105237_10095948 | 3300009545 | Bacteria | 2955 |
| 78 | Ga0105237_10096220 | 3300009545 | Bacteria | 2952 |
| 79 | Ga0105238_10024646 | 3300009551 | Bacteria | 6132 |
| 80 | Ga0105035_100381 | 3300009988 | Bacteria | 2753 |
| 81 | Ga0105239_10004404 | 3300010375 | Bacteria | 16856 |
| 82 | Ga0105246_10002547 | 3300011119 | Bacteria | 11013 |
| 83 | Ga0157371_10016506 | 3300013102 | Bacteria | 5509 |
| 84 | Ga0157370_10010581 | 3300013104 | Bacteria | 9712 |
| 85 | Ga0157370_10029832 | 3300013104 | Bacteria | 5347 |
| 86 | Ga0157369_10001634 | 3300013105 | Bacteria | 27388 |
| 87 | Ga0157369_10016725 | 3300013105 | Bacteria | 8243 |
| 88 | Ga0157369_10081416 | 3300013105 | Bacteria | 3465 |
| 89 | Ga0157374_10146838 | 3300013296 | Bacteria | 2291 |
| 90 | Ga0157372_10038120 | 3300013307 | Bacteria | 5303 |
| 91 | Ga0157375_10029533 | 3300013308 | Bacteria | 5157 |
| 92 | Ga0163163_10148615 | 3300014325 | Bacteria | 2387 |
| 93 | Ga0157377_10008989 | 3300014745 | Bacteria | 4893 |
| 94 | Ga0157379_10015459 | 3300014968 | Bacteria | 6697 |
| 95 | Ga0206352_10295959 | 3300020078 | Bacteria | 2180 |
| 96 | Ga0154015_1645553 | 3300020610 | Bacteria | 2430 |
| 97 | Ga0224712_10002602 | 3300022467 | Bacteria | 4497 |
| 98 | Ga0224712_10003024 | 3300022467 | Bacteria | 4284 |
| 99 | Ga0207692_10001672 | 3300025898 | Bacteria | 8381 |
| 100 | Ga0207688_10001013 | 3300025901 | Bacteria | 14332 |
| 101 | Ga0207647_10009972 | 3300025904 | Bacteria | 6728 |
| 102 | Ga0207647_10010970 | 3300025904 | Bacteria | 6374 |
| 103 | Ga0207647_10040084 | 3300025904 | Bacteria | 2951 |
| 104 | Ga0207699_10000105 | 3300025906 | Bacteria | 59026 |
| 105 | Ga0207643_10000266 | 3300025908 | Bacteria | 36491 |
| 106 | Ga0207643_10026774 | 3300025908 | Bacteria | 3194 |
| 107 | Ga0207705_10015216 | 3300025909 | Bacteria | 5527 |
| 108 | Ga0207705_10050292 | 3300025909 | Bacteria | 3000 |
| 109 | Ga0207654_10007745 | 3300025911 | Bacteria | 5421 |
| 110 | Ga0207695_10116034 | 3300025913 | Bacteria | 2652 |
| 111 | Ga0207695_10141096 | 3300025913 | Bacteria | 2358 |
| 112 | Ga0207695_10163195 | 3300025913 | Bacteria | 2158 |
| 113 | Ga0207671_10004450 | 3300025914 | Bacteria | 13393 |
| 114 | Ga0207693_10001586 | 3300025915 | Bacteria | 20116 |
| 115 | Ga0207693_10019109 | 3300025915 | Bacteria | 5453 |
| 116 | Ga0207657_10046997 | 3300025919 | Bacteria | 3777 |
| 117 | Ga0207649_10015570 | 3300025920 | Bacteria | 4272 |
| 118 | Ga0207652_10009476 | 3300025921 | Bacteria | 7828 |
| 119 | Ga0207652_10015344 | 3300025921 | Bacteria | 6221 |
| 120 | Ga0207650_10028313 | 3300025925 | Bacteria | 4016 |
| 121 | Ga0207687_10061878 | 3300025927 | Bacteria | 2645 |
| 122 | Ga0207700_10000050 | 3300025928 | Bacteria | 79672 |
| 123 | Ga0207664_10000101 | 3300025929 | Bacteria | 79541 |
| 124 | Ga0207644_10081660 | 3300025931 | Bacteria | 2389 |
| 125 | Ga0207665_10000438 | 3300025939 | Bacteria | 28608 |
| 126 | Ga0207689_10003430 | 3300025942 | Bacteria | 14473 |
| 127 | Ga0207661_10003241 | 3300025944 | Bacteria | 11278 |
| 128 | Ga0207679_10004435 | 3300025945 | Bacteria | 8743 |
| 129 | Ga0207667_10027201 | 3300025949 | Bacteria | 6232 |
| 130 | Ga0207667_10057370 | 3300025949 | Bacteria | 4087 |
| 131 | Ga0207640_10015307 | 3300025981 | Bacteria | 4437 |
| 132 | Ga0207658_10005925 | 3300025986 | Bacteria | 8348 |
| 133 | Ga0207678_10000359 | 3300026067 | Bacteria | 41383 |
| 134 | Ga0207678_10094029 | 3300026067 | Bacteria | 2561 |
| 135 | Ga0207708_10007985 | 3300026075 | Bacteria | 7841 |
| 136 | Ga0207702_10007229 | 3300026078 | Bacteria | 9497 |
| 137 | Ga0207702_10068507 | 3300026078 | Bacteria | 3049 |
| 138 | Ga0207641_10051569 | 3300026088 | Bacteria | 3484 |
| 139 | Ga0207641_10139932 | 3300026088 | Bacteria | 2182 |
| 140 | Ga0207648_10061583 | 3300026089 | Bacteria | 3272 |
| 141 | Ga0207676_10002781 | 3300026095 | Bacteria | 12441 |
| 142 | Ga0207676_10058736 | 3300026095 | Bacteria | 3035 |
| 143 | Ga0207674_10043241 | 3300026116 | Bacteria | 4646 |
| 144 | Ga0207674_10043277 | 3300026116 | Bacteria | 4643 |
| 145 | Ga0207674_10110575 | 3300026116 | Bacteria | 2723 |
| 146 | Ga0207675_100015297 | 3300026118 | Bacteria | 7160 |
| 147 | Ga0207683_10003259 | 3300026121 | Bacteria | 14153 |
| 148 | Ga0207428_10079739 | 3300027907 | Bacteria | 2559 |
| 149 | Ga0265340_10011466 | 3300031247 | Bacteria | 4708 |
| 150 | Ga0307513_10037315 | 3300031456 | Bacteria | 5410 |
| 151 | Ga0307513_10063333 | 3300031456 | Bacteria | 3903 |
| 152 | Ga0307508_10036052 | 3300031616 | Bacteria | 4455 |
| 153 | Ga0316579_10004002 | 3300031691 | Bacteria | 5811 |
| 154 | Ga0316576_10005118 | 3300031727 | Bacteria | 7960 |
| 155 | Ga0316576_10055540 | 3300031727 | Bacteria | 2890 |
| 156 | Ga0316577_10042847 | 3300031733 | Bacteria | 2532 |
| 157 | Ga0316583_10013596 | 3300032133 | Bacteria | 2938 |
| 158 | Ga0316585_10025705 | 3300032137 | Bacteria | 1827 |
| 159 | Ga0316593_10025248 | 3300032168 | Bacteria | 1890 |
| 160 | Ga0307507_10037395 | 3300033179 | Bacteria | 4941 |
| 161 | Ga0316592_1000795 | 3300033524 | Bacteria | 4709 |
| 162 | Ga0395900_0087804 | 3300037418 | Bacteria | 3196 |
| 163 | Ga0316581_0001700 | 3300037588 | Bacteria | 5055 |
| 164 | Ga0436364_1516024 | 3300037853 | Bacteria | 3457 |
| 165 | Ga0395901_0018022 | 3300038443 | Bacteria | 7207 |
| 166 | Ga0395901_0163706 | 3300038443 | Bacteria | 2336 |
| 167 | Ga0395901_0253072 | 3300038443 | Bacteria | 1835 |
| 168 | Ga0451833_0357642 | 3300041491 | Bacteria | 13939 |
| 169 | Ga0466972_0015873 | 3300044658 | Bacteria | 3765 |
| 170 | Ga0466966_0027336 | 3300044684 | Bacteria | 3721 |
| 171 | Ga0466966_0032544 | 3300044684 | Bacteria | 3378 |
| 172 | Ga0466966_0087428 | 3300044684 | Bacteria | 1937 |
| 173 | Ga0466961_0001008 | 3300044693 | Bacteria | 17382 |
| 174 | Ga0466961_0011768 | 3300044693 | Bacteria | 5592 |
| 175 | Ga0466961_0032585 | 3300044693 | Bacteria | 3349 |
| 176 | Ga0466961_0090875 | 3300044693 | Bacteria | 1928 |
| 177 | Ga0466963_0004835 | 3300044694 | Bacteria | 7849 |
| 178 | Ga0466963_0009249 | 3300044694 | Bacteria | 5933 |
| 179 | Ga0466963_0068948 | 3300044694 | Bacteria | 2376 |
| 180 | Ga0466964_0014945 | 3300044706 | Bacteria | 2956 |
| 181 | Ga0466970_0011710 | 3300044765 | Bacteria | 4474 |
| 182 | Ga0466957_0015818 | 3300044842 | Bacteria | 4408 |
| 183 | Ga0466960_0004182 | 3300044901 | Bacteria | 5615 |
| 184 | Ga0466960_0029675 | 3300044901 | Bacteria | 2511 |
| 185 | Ga0466959_0024600 | 3300045049 | Bacteria | 4462 |
| 186 | Ga0466959_0085817 | 3300045049 | Bacteria | 2265 |
| 187 | Ga0466958_0016254 | 3300045836 | Bacteria | 4281 |
| 188 | Ga0466958_0018864 | 3300045836 | Bacteria | 4008 |
| 189 | Ga0466967_0000814 | 3300045976 | Bacteria | 16363 |
| 190 | Ga0466967_0003831 | 3300045976 | Bacteria | 9955 |
| 191 | Ga0466967_0038975 | 3300045976 | Bacteria | 4080 |
| 192 | Ga0466967_0054834 | 3300045976 | Bacteria | 3510 |
| 193 | Ga0466967_0075949 | 3300045976 | Bacteria | 3021 |
| 194 | Ga0496102_0000453 | 3300048905 | Bacteria | 46525 |
| 195 | Ga0496102_0000602 | 3300048905 | Bacteria | 37524 |
| 196 | Ga0496103_0041842 | 3300048906 | Bacteria | 2817 |
| 197 | Ga0496104_0002035 | 3300048907 | Bacteria | 17565 |
| 198 | Ga0496104_0021901 | 3300048907 | Bacteria | 5869 |
| 199 | Ga0496105_0015637 | 3300048908 | Bacteria | 6052 |
| 200 | Ga0496107_0040228 | 3300048910 | Bacteria | 3355 |
| 201 | Ga0496108_0081632 | 3300048911 | Bacteria | 2740 |
| 202 | Ga0496109_0007436 | 3300048912 | Bacteria | 9274 |
| 203 | Ga0496109_0013792 | 3300048912 | Bacteria | 7024 |
| 204 | Ga0496109_0037778 | 3300048912 | Bacteria | 4364 |
| 205 | Ga0496110_0002225 | 3300048913 | Bacteria | 14501 |
| 206 | Ga0496110_0004812 | 3300048913 | Bacteria | 10518 |
| 207 | Ga0496110_0010183 | 3300048913 | Bacteria | 7639 |
| 208 | Ga0496111_0013280 | 3300048914 | Bacteria | 5600 |
| 209 | Ga0496111_0105015 | 3300048914 | Bacteria | 2078 |
| 210 | Ga0496112_0020362 | 3300048915 | Bacteria | 6287 |
| 211 | Ga0496113_0001690 | 3300048916 | Bacteria | 12501 |
| 212 | Ga0496113_0012612 | 3300048916 | Bacteria | 5687 |
| 213 | Ga0496114_0024119 | 3300048917 | Bacteria | 4965 |
| 214 | Ga0496119_0001177 | 3300048922 | Bacteria | 32784 |
| 215 | Ga0496120_0004782 | 3300048923 | Bacteria | 11108 |
| 216 | Ga0496126_0000072 | 3300048929 | Bacteria | 238130 |
| 217 | Ga0501032_0024450 | 3300049569 | Bacteria | 4171 |
| 218 | Ga0501033_0090678 | 3300049570 | Bacteria | 2236 |
| 219 | Ga0501034_0031789 | 3300049571 | Bacteria | 5361 |
| 220 | Ga0501036_0005006 | 3300049572 | Bacteria | 10723 |
| 221 | Ga0501036_0092078 | 3300049572 | Bacteria | 2561 |
| 222 | Ga0501038_0000544 | 3300049574 | Bacteria | 33088 |
| 223 | Ga0501038_0001682 | 3300049574 | Bacteria | 20489 |
| 224 | Ga0501038_0111296 | 3300049574 | Bacteria | 2269 |
| 225 | Ga0501042_0092746 | 3300049578 | Bacteria | 2168 |
| 226 | Ga0501043_0005123 | 3300049579 | Bacteria | 10606 |
| 227 | Ga0501043_0023293 | 3300049579 | Bacteria | 4856 |
| 228 | Ga0501043_0058733 | 3300049579 | Bacteria | 3019 |
| 229 | Ga0501047_0000018 | 3300049581 | Bacteria | 274180 |
| 230 | Ga0501047_0002306 | 3300049581 | Bacteria | 18245 |
| 231 | Ga0501047_0011814 | 3300049581 | Bacteria | 8259 |
| 232 | Ga0501048_0000768 | 3300049582 | Bacteria | 23513 |
| 233 | Ga0501048_0000855 | 3300049582 | Bacteria | 22442 |
| 234 | Ga0501048_0004462 | 3300049582 | Bacteria | 10651 |
| 235 | Ga0501070_0004038 | 3300049586 | Bacteria | 12606 |
| 236 | Ga0501070_0028556 | 3300049586 | Bacteria | 4679 |
| 237 | Ga0501073_0085579 | 3300049589 | Bacteria | 2193 |
| 238 | Ga0501074_0014768 | 3300049590 | Bacteria | 5681 |
| 239 | Ga0501035_0014609 | 3300049822 | Bacteria | 7248 |
| 240 | Ga0501035_0049389 | 3300049822 | Bacteria | 3770 |
| 241 | Ga0501044_0023794 | 3300049823 | Bacteria | 6513 |
| 242 | nmdc:mga05p37_140717_c1 | 3300050507 | Bacteria | 2956 |
| 243 | nmdc:mga05p37_4705_c1 | 3300050507 | Bacteria | 15944 |
| 244 | nmdc:mga09592_161830_c1 | 3300050508 | Bacteria | 1934 |
| 245 | nmdc:mga09592_53090_c1 | 3300050508 | Bacteria | 3422 |
| 246 | nmdc:mga06r32_82498_c1 | 3300050510 | Bacteria | 3132 |
| 247 | nmdc:mga08y16_4458_c1 | 3300050511 | Bacteria | 14639 |
| 248 | nmdc:mga0rr50_56333_c1 | 3300050513 | Bacteria | 2937 |
| 249 | nmdc:mga08x19_7722_c1 | 3300050514 | Bacteria | 6388 |
| 250 | Ga0466962_0021178 | 3300061719 | Bacteria | 3122 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0090678 | Ga0501033_0090678_685_2205 | 469 |
| 2 | 3300045976 | Ga0466967_0075949 | Ga0466967_0075949_611_2116 | 474 |
| 3 | 3300048911 | Ga0496108_0081632 | Ga0496108_0081632_683_2212 | 485 |
| 4 | 3300048905 | Ga0496102_0000453 | Ga0496102_0000453_42651_44249 | 492 |
| 5 | 3300013296 | Ga0157374_10146838 | Ga0157374_101468382 | 496 |
| 6 | 3300025908 | Ga0207643_10026774 | Ga0207643_100267743 | 496 |
| 7 | iso_pu_bacteria | 2816332139 | 2816512052 | 496 |
| 8 | 3300003203 | JGI25406J46586_10000292 | JGI25406J46586_1000029217 | 498 |
| 9 | 3300005327 | Ga0070658_10038083 | Ga0070658_100380832 | 498 |
| 10 | 3300005347 | Ga0070668_100055400 | Ga0070668_1000554001 | 498 |
| 11 | 3300005354 | Ga0070675_100133728 | Ga0070675_1001337282 | 498 |
| 12 | 3300005366 | Ga0070659_100048842 | Ga0070659_1000488422 | 498 |
| 13 | 3300005535 | Ga0070684_100133623 | Ga0070684_1001336232 | 498 |
| 14 | 3300005564 | Ga0070664_100062004 | Ga0070664_1000620042 | 498 |
| 15 | 3300005578 | Ga0068854_100079818 | Ga0068854_1000798182 | 498 |
| 16 | 3300005614 | Ga0068856_100162465 | Ga0068856_1001624652 | 498 |
| 17 | 3300005615 | Ga0070702_100013746 | Ga0070702_1000137463 | 498 |
| 18 | 3300005985 | Ga0081539_10000242 | Ga0081539_1000024253 | 498 |
| 19 | 3300006871 | Ga0075434_100225201 | Ga0075434_1002252011 | 498 |
| 20 | 3300009545 | Ga0105237_10095948 | Ga0105237_100959482 | 498 |
| 21 | 3300009988 | Ga0105035_100381 | Ga0105035_1003812 | 498 |
| 22 | 3300025904 | Ga0207647_10040084 | Ga0207647_100400842 | 498 |
| 23 | 3300025909 | Ga0207705_10050292 | Ga0207705_100502922 | 498 |
| 24 | 3300026089 | Ga0207648_10061583 | Ga0207648_100615832 | 498 |
| 25 | 3300026118 | Ga0207675_100015297 | Ga0207675_1000152978 | 498 |
| 26 | 3300031616 | Ga0307508_10036052 | Ga0307508_100360524 | 498 |
| 27 | 3300033179 | Ga0307507_10037395 | Ga0307507_100373952 | 498 |
| 28 | 3300045976 | Ga0466967_0054834 | Ga0466967_0054834_676_2274 | 498 |
| 29 | 3300009093 | Ga0105240_10007675 | Ga0105240_1000767513 | 499 |
| 30 | 3300025913 | Ga0207695_10116034 | Ga0207695_101160341 | 499 |
| 31 | 3300020610 | Ga0154015_1645553 | Ga0154015_16455533 | 500 |
| 32 | 3300005937 | Ga0081455_10046575 | Ga0081455_100465753 | 501 |
| 33 | 3300048929 | Ga0496126_0000072 | Ga0496126_0000072_163848_165512 | 502 |
| 34 | 3300005577 | Ga0068857_100119410 | Ga0068857_1001194102 | 503 |
| 35 | 3300005841 | Ga0068863_100009864 | Ga0068863_1000098648 | 503 |
| 36 | 3300013105 | Ga0157369_10001634 | Ga0157369_1000163424 | 503 |
| 37 | 3300026078 | Ga0207702_10068507 | Ga0207702_100685072 | 503 |
| 38 | 3300026088 | Ga0207641_10139932 | Ga0207641_101399322 | 503 |
| 39 | 3300026095 | Ga0207676_10058736 | Ga0207676_100587362 | 503 |
| 40 | 3300026116 | Ga0207674_10110575 | Ga0207674_101105752 | 503 |
| 41 | 3300048907 | Ga0496104_0002035 | Ga0496104_0002035_8247_9884 | 503 |
| 42 | 3300048912 | Ga0496109_0007436 | Ga0496109_0007436_7592_9229 | 503 |
| 43 | 3300048913 | Ga0496110_0004812 | Ga0496110_0004812_7000_8637 | 503 |
| 44 | 3300048914 | Ga0496111_0013280 | Ga0496111_0013280_3907_5544 | 503 |
| 45 | 3300048915 | Ga0496112_0020362 | Ga0496112_0020362_3780_5417 | 503 |
| 46 | 3300048916 | Ga0496113_0001690 | Ga0496113_0001690_8814_10451 | 503 |
| 47 | 3300005327 | Ga0070658_10044237 | Ga0070658_100442372 | 505 |
| 48 | 3300005331 | Ga0070670_100036062 | Ga0070670_1000360622 | 505 |
| 49 | 3300005334 | Ga0068869_100002657 | Ga0068869_1000026577 | 505 |
| 50 | 3300005336 | Ga0070680_100111998 | Ga0070680_1001119981 | 505 |
| 51 | 3300005337 | Ga0070682_100011270 | Ga0070682_1000112702 | 505 |
| 52 | 3300005338 | Ga0068868_100009620 | Ga0068868_1000096207 | 505 |
| 53 | 3300005355 | Ga0070671_100005593 | Ga0070671_10000559310 | 505 |
| 54 | 3300005366 | Ga0070659_100022584 | Ga0070659_1000225845 | 505 |
| 55 | 3300005434 | Ga0070709_10015372 | Ga0070709_100153724 | 505 |
| 56 | 3300005435 | Ga0070714_100009359 | Ga0070714_1000093597 | 505 |
| 57 | 3300005440 | Ga0070705_100091806 | Ga0070705_1000918062 | 505 |
| 58 | 3300005455 | Ga0070663_100010380 | Ga0070663_1000103801 | 505 |
| 59 | 3300005456 | Ga0070678_100004093 | Ga0070678_1000040937 | 505 |
| 60 | 3300005458 | Ga0070681_10010142 | Ga0070681_100101428 | 505 |
| 61 | 3300005530 | Ga0070679_100023841 | Ga0070679_1000238415 | 505 |
| 62 | 3300005547 | Ga0070693_100001271 | Ga0070693_1000012712 | 505 |
| 63 | 3300005548 | Ga0070665_100003985 | Ga0070665_1000039858 | 505 |
| 64 | 3300005563 | Ga0068855_100055099 | Ga0068855_1000550993 | 505 |
| 65 | 3300005563 | Ga0068855_100104395 | Ga0068855_1001043952 | 505 |
| 66 | 3300005578 | Ga0068854_100012270 | Ga0068854_1000122702 | 505 |
| 67 | 3300005614 | Ga0068856_100009445 | Ga0068856_1000094458 | 505 |
| 68 | 3300005614 | Ga0068856_100038175 | Ga0068856_1000381753 | 505 |
| 69 | 3300005615 | Ga0070702_100000618 | Ga0070702_1000006188 | 505 |
| 70 | 3300005618 | Ga0068864_100046924 | Ga0068864_1000469243 | 505 |
| 71 | 3300005834 | Ga0068851_10021712 | Ga0068851_100217124 | 505 |
| 72 | 3300005841 | Ga0068863_100010783 | Ga0068863_1000107838 | 505 |
| 73 | 3300005842 | Ga0068858_100060858 | Ga0068858_1000608581 | 505 |
| 74 | 3300006358 | Ga0068871_100021881 | Ga0068871_1000218812 | 505 |
| 75 | 3300006852 | Ga0075433_10046061 | Ga0075433_100460613 | 505 |
| 76 | 3300006871 | Ga0075434_100034457 | Ga0075434_1000344576 | 505 |
| 77 | 3300006914 | Ga0075436_100007449 | Ga0075436_1000074498 | 505 |
| 78 | 3300007076 | Ga0075435_100006974 | Ga0075435_1000069749 | 505 |
| 79 | 3300009098 | Ga0105245_10028224 | Ga0105245_100282242 | 505 |
| 80 | 3300009101 | Ga0105247_10010522 | Ga0105247_100105224 | 505 |
| 81 | 3300009147 | Ga0114129_10021145 | Ga0114129_100211458 | 505 |
| 82 | 3300009148 | Ga0105243_10035980 | Ga0105243_100359803 | 505 |
| 83 | 3300009174 | Ga0105241_10006484 | Ga0105241_100064843 | 505 |
| 84 | 3300009177 | Ga0105248_10023874 | Ga0105248_100238743 | 505 |
| 85 | 3300009551 | Ga0105238_10024646 | Ga0105238_100246462 | 505 |
| 86 | 3300011119 | Ga0105246_10002547 | Ga0105246_100025476 | 505 |
| 87 | 3300013102 | Ga0157371_10016506 | Ga0157371_100165062 | 505 |
| 88 | 3300013104 | Ga0157370_10029832 | Ga0157370_100298322 | 505 |
| 89 | 3300013307 | Ga0157372_10038120 | Ga0157372_100381204 | 505 |
| 90 | 3300013308 | Ga0157375_10029533 | Ga0157375_100295334 | 505 |
| 91 | 3300014745 | Ga0157377_10008989 | Ga0157377_100089893 | 505 |
| 92 | 3300014968 | Ga0157379_10015459 | Ga0157379_100154595 | 505 |
| 93 | 3300025901 | Ga0207688_10001013 | Ga0207688_100010139 | 505 |
| 94 | 3300025908 | Ga0207643_10000266 | Ga0207643_1000026620 | 505 |
| 95 | 3300025909 | Ga0207705_10015216 | Ga0207705_100152163 | 505 |
| 96 | 3300025911 | Ga0207654_10007745 | Ga0207654_100077454 | 505 |
| 97 | 3300025915 | Ga0207693_10019109 | Ga0207693_100191093 | 505 |
| 98 | 3300025920 | Ga0207649_10015570 | Ga0207649_100155702 | 505 |
| 99 | 3300025921 | Ga0207652_10009476 | Ga0207652_100094761 | 505 |
| 100 | 3300025925 | Ga0207650_10028313 | Ga0207650_100283132 | 505 |
| 101 | 3300025927 | Ga0207687_10061878 | Ga0207687_100618781 | 505 |
| 102 | 3300025931 | Ga0207644_10081660 | Ga0207644_100816602 | 505 |
| 103 | 3300025942 | Ga0207689_10003430 | Ga0207689_100034307 | 505 |
| 104 | 3300025944 | Ga0207661_10003241 | Ga0207661_100032417 | 505 |
| 105 | 3300025945 | Ga0207679_10004435 | Ga0207679_100044356 | 505 |
| 106 | 3300025949 | Ga0207667_10057370 | Ga0207667_100573703 | 505 |
| 107 | 3300025981 | Ga0207640_10015307 | Ga0207640_100153074 | 505 |
| 108 | 3300026067 | Ga0207678_10000359 | Ga0207678_100003597 | 505 |
| 109 | 3300026075 | Ga0207708_10007985 | Ga0207708_100079857 | 505 |
| 110 | 3300026078 | Ga0207702_10007229 | Ga0207702_100072297 | 505 |
| 111 | 3300026088 | Ga0207641_10051569 | Ga0207641_100515691 | 505 |
| 112 | 3300026095 | Ga0207676_10002781 | Ga0207676_100027816 | 505 |
| 113 | 3300026121 | Ga0207683_10003259 | Ga0207683_100032597 | 505 |
| 114 | 3300027907 | Ga0207428_10079739 | Ga0207428_100797391 | 505 |
| 115 | 3300038443 | Ga0395901_0163706 | Ga0395901_0163706_481_2115 | 505 |
| 116 | 3300048907 | Ga0496104_0021901 | Ga0496104_0021901_2641_4275 | 505 |
| 117 | 3300048908 | Ga0496105_0015637 | Ga0496105_0015637_694_2328 | 505 |
| 118 | 3300048910 | Ga0496107_0040228 | Ga0496107_0040228_105_1739 | 505 |
| 119 | 3300048913 | Ga0496110_0010183 | Ga0496110_0010183_4162_5796 | 505 |
| 120 | 3300048916 | Ga0496113_0012612 | Ga0496113_0012612_3396_5030 | 505 |
| 121 | 3300050511 | nmdc:mga08y16_4458_c1 | nmdc:mga08y16_4458_c1_7991_9625 | 505 |
| 122 | 3300050513 | nmdc:mga0rr50_56333_c1 | nmdc:mga0rr50_56333_c1_709_2343 | 505 |
| 123 | 3300050514 | nmdc:mga08x19_7722_c1 | nmdc:mga08x19_7722_c1_2040_3674 | 505 |
| 124 | 3300009093 | Ga0105240_10041725 | Ga0105240_100417253 | 506 |
| 125 | 3300009545 | Ga0105237_10009695 | Ga0105237_100096959 | 506 |
| 126 | 3300010375 | Ga0105239_10004404 | Ga0105239_100044046 | 506 |
| 127 | 3300025914 | Ga0207671_10004450 | Ga0207671_1000445011 | 506 |
| 128 | 3300025986 | Ga0207658_10005925 | Ga0207658_100059252 | 506 |
| 129 | 3300038443 | Ga0395901_0253072 | Ga0395901_0253072_100_1743 | 506 |
| 130 | 3300044658 | Ga0466972_0015873 | Ga0466972_0015873_1699_3294 | 506 |
| 131 | 3300045836 | Ga0466958_0016254 | Ga0466958_0016254_1332_2963 | 506 |
| 132 | 3300045976 | Ga0466967_0000814 | Ga0466967_0000814_9045_10676 | 506 |
| 133 | 3300005458 | Ga0070681_10208752 | Ga0070681_102087522 | 507 |
| 134 | 3300005563 | Ga0068855_100039338 | Ga0068855_1000393382 | 507 |
| 135 | 3300005563 | Ga0068855_100093043 | Ga0068855_1000930432 | 507 |
| 136 | 3300009545 | Ga0105237_10096220 | Ga0105237_100962202 | 507 |
| 137 | 3300014325 | Ga0163163_10148615 | Ga0163163_101486152 | 507 |
| 138 | 3300044684 | Ga0466966_0027336 | Ga0466966_0027336_957_2609 | 507 |
| 139 | 3300044684 | Ga0466966_0032544 | Ga0466966_0032544_578_2203 | 507 |
| 140 | 3300044684 | Ga0466966_0087428 | Ga0466966_0087428_71_1705 | 507 |
| 141 | 3300044693 | Ga0466961_0001008 | Ga0466961_0001008_4281_5912 | 507 |
| 142 | 3300044693 | Ga0466961_0011768 | Ga0466961_0011768_1548_3173 | 507 |
| 143 | 3300044693 | Ga0466961_0032585 | Ga0466961_0032585_524_2143 | 507 |
| 144 | 3300044693 | Ga0466961_0090875 | Ga0466961_0090875_30_1673 | 507 |
| 145 | 3300044694 | Ga0466963_0004835 | Ga0466963_0004835_25_1668 | 507 |
| 146 | 3300044694 | Ga0466963_0009249 | Ga0466963_0009249_1388_3040 | 507 |
| 147 | 3300044694 | Ga0466963_0068948 | Ga0466963_0068948_209_1831 | 507 |
| 148 | 3300044706 | Ga0466964_0014945 | Ga0466964_0014945_1220_2863 | 507 |
| 149 | 3300044765 | Ga0466970_0011710 | Ga0466970_0011710_332_1978 | 507 |
| 150 | 3300044842 | Ga0466957_0015818 | Ga0466957_0015818_1084_2727 | 507 |
| 151 | 3300044901 | Ga0466960_0004182 | Ga0466960_0004182_3530_5176 | 507 |
| 152 | 3300044901 | Ga0466960_0029675 | Ga0466960_0029675_635_2275 | 507 |
| 153 | 3300045049 | Ga0466959_0024600 | Ga0466959_0024600_2175_3794 | 507 |
| 154 | 3300045049 | Ga0466959_0085817 | Ga0466959_0085817_361_2007 | 507 |
| 155 | 3300045836 | Ga0466958_0018864 | Ga0466958_0018864_712_2364 | 507 |
| 156 | 3300045976 | Ga0466967_0003831 | Ga0466967_0003831_1162_2805 | 507 |
| 157 | 3300045976 | Ga0466967_0038975 | Ga0466967_0038975_976_2613 | 507 |
| 158 | 3300048905 | Ga0496102_0000602 | Ga0496102_0000602_27966_29621 | 507 |
| 159 | 3300048906 | Ga0496103_0041842 | Ga0496103_0041842_1114_2769 | 507 |
| 160 | 3300048912 | Ga0496109_0013792 | Ga0496109_0013792_4433_6097 | 507 |
| 161 | 3300048912 | Ga0496109_0037778 | Ga0496109_0037778_2143_3795 | 507 |
| 162 | 3300048917 | Ga0496114_0024119 | Ga0496114_0024119_33_1685 | 507 |
| 163 | 3300048922 | Ga0496119_0001177 | Ga0496119_0001177_19424_21088 | 507 |
| 164 | 3300048923 | Ga0496120_0004782 | Ga0496120_0004782_5847_7511 | 507 |
| 165 | 3300049569 | Ga0501032_0024450 | Ga0501032_0024450_2479_4149 | 507 |
| 166 | 3300049571 | Ga0501034_0031789 | Ga0501034_0031789_2215_3885 | 507 |
| 167 | 3300049572 | Ga0501036_0092078 | Ga0501036_0092078_666_2336 | 507 |
| 168 | 3300049574 | Ga0501038_0000544 | Ga0501038_0000544_15652_17322 | 507 |
| 169 | 3300049579 | Ga0501043_0005123 | Ga0501043_0005123_6816_8486 | 507 |
| 170 | 3300049579 | Ga0501043_0058733 | Ga0501043_0058733_102_1763 | 507 |
| 171 | 3300049581 | Ga0501047_0002306 | Ga0501047_0002306_15402_17063 | 507 |
| 172 | 3300049581 | Ga0501047_0011814 | Ga0501047_0011814_322_1992 | 507 |
| 173 | 3300049582 | Ga0501048_0000768 | Ga0501048_0000768_795_2456 | 507 |
| 174 | 3300049582 | Ga0501048_0000855 | Ga0501048_0000855_17497_19167 | 507 |
| 175 | 3300049586 | Ga0501070_0004038 | Ga0501070_0004038_1541_3211 | 507 |
| 176 | 3300049822 | Ga0501035_0014609 | Ga0501035_0014609_2211_3872 | 507 |
| 177 | 3300049822 | Ga0501035_0049389 | Ga0501035_0049389_150_1820 | 507 |
| 178 | 3300061719 | Ga0466962_0021178 | Ga0466962_0021178_257_1900 | 507 |
| 179 | 3300050508 | nmdc:mga09592_161830_c1 | nmdc:mga09592_161830_c1_39_1646 | 509 |
| 180 | 3300006844 | Ga0075428_100032129 | Ga0075428_1000321296 | 510 |
| 181 | 3300031456 | Ga0307513_10063333 | Ga0307513_100633332 | 510 |
| 182 | 3300009147 | Ga0114129_10051656 | Ga0114129_100516564 | 513 |
| 183 | 3300037418 | Ga0395900_0087804 | Ga0395900_0087804_1481_3082 | 513 |
| 184 | 3300038443 | Ga0395901_0018022 | Ga0395901_0018022_2307_3908 | 513 |
| 185 | 3300050507 | nmdc:mga05p37_140717_c1 | nmdc:mga05p37_140717_c1_1134_2735 | 513 |
| 186 | 3300005329 | Ga0070683_100124749 | Ga0070683_1001247491 | 514 |
| 187 | 3300025913 | Ga0207695_10163195 | Ga0207695_101631952 | 514 |
| 188 | 3300025919 | Ga0207657_10046997 | Ga0207657_100469973 | 514 |
| 189 | 3300005458 | Ga0070681_10124474 | Ga0070681_101244742 | 517 |
| 190 | 3300005530 | Ga0070679_100013030 | Ga0070679_1000130308 | 517 |
| 191 | 3300025921 | Ga0207652_10015344 | Ga0207652_100153443 | 517 |
| 192 | 3300031727 | Ga0316576_10005118 | Ga0316576_100051181 | 518 |
| 193 | 3300020078 | Ga0206352_10295959 | Ga0206352_102959592 | 519 |
| 194 | 3300022467 | Ga0224712_10003024 | Ga0224712_100030244 | 519 |
| 195 | 3300005437 | Ga0070710_10000039 | Ga0070710_1000003915 | 520 |
| 196 | 3300006028 | Ga0070717_10002693 | Ga0070717_100026937 | 520 |
| 197 | 3300006173 | Ga0070716_100000222 | Ga0070716_10000022225 | 520 |
| 198 | 3300025898 | Ga0207692_10001672 | Ga0207692_100016723 | 520 |
| 199 | 3300025906 | Ga0207699_10000105 | Ga0207699_1000010533 | 520 |
| 200 | 3300025915 | Ga0207693_10001586 | Ga0207693_1000158621 | 520 |
| 201 | 3300025928 | Ga0207700_10000050 | Ga0207700_1000005028 | 520 |
| 202 | 3300025929 | Ga0207664_10000101 | Ga0207664_1000010128 | 520 |
| 203 | 3300025939 | Ga0207665_10000438 | Ga0207665_1000043829 | 520 |
| 204 | 3300005563 | Ga0068855_100035129 | Ga0068855_1000351292 | 521 |
| 205 | 3300025949 | Ga0207667_10027201 | Ga0207667_100272016 | 521 |
| 206 | 3300037853 | Ga0436364_1516024 | Ga0436364_1516024_419_2053 | 521 |
| 207 | 3300049572 | Ga0501036_0005006 | Ga0501036_0005006_7239_8837 | 521 |
| 208 | 3300049574 | Ga0501038_0001682 | Ga0501038_0001682_13562_15160 | 521 |
| 209 | 3300049578 | Ga0501042_0092746 | Ga0501042_0092746_300_1898 | 521 |
| 210 | 3300049579 | Ga0501043_0023293 | Ga0501043_0023293_1357_2955 | 521 |
| 211 | 3300049582 | Ga0501048_0004462 | Ga0501048_0004462_5830_7428 | 521 |
| 212 | 3300049589 | Ga0501073_0085579 | Ga0501073_0085579_218_1816 | 521 |
| 213 | 3300049590 | Ga0501074_0014768 | Ga0501074_0014768_3208_4806 | 521 |
| 214 | 3300049823 | Ga0501044_0023794 | Ga0501044_0023794_3761_5359 | 521 |
| 215 | 3300013105 | Ga0157369_10081416 | Ga0157369_100814162 | 522 |
| 216 | 3300049574 | Ga0501038_0111296 | Ga0501038_0111296_402_2012 | 522 |
| 217 | 3300031691 | Ga0316579_10004002 | Ga0316579_100040026 | 523 |
| 218 | 3300031727 | Ga0316576_10055540 | Ga0316576_100555402 | 523 |
| 219 | 3300031733 | Ga0316577_10042847 | Ga0316577_100428471 | 523 |
| 220 | 3300032133 | Ga0316583_10013596 | Ga0316583_100135962 | 523 |
| 221 | 3300032137 | Ga0316585_10025705 | Ga0316585_100257051 | 523 |
| 222 | 3300032168 | Ga0316593_10025248 | Ga0316593_100252481 | 523 |
| 223 | 3300033524 | Ga0316592_1000795 | Ga0316592_10007951 | 523 |
| 224 | 3300037588 | Ga0316581_0001700 | Ga0316581_0001700_3024_4700 | 523 |
| 225 | 3300049581 | Ga0501047_0000018 | Ga0501047_0000018_125021_126625 | 524 |
| 226 | 3300049586 | Ga0501070_0028556 | Ga0501070_0028556_2244_3947 | 524 |
| 227 | 3300041491 | Ga0451833_0357642 | Ga0451833_0357642_8786_10519 | 527 |
| 228 | 3300005616 | Ga0068852_100082587 | Ga0068852_1000825872 | 528 |
| 229 | 3300009093 | Ga0105240_10018433 | Ga0105240_100184332 | 528 |
| 230 | 3300013104 | Ga0157370_10010581 | Ga0157370_100105819 | 528 |
| 231 | 3300013105 | Ga0157369_10016725 | Ga0157369_100167254 | 528 |
| 232 | 3300022467 | Ga0224712_10002602 | Ga0224712_100026021 | 528 |
| 233 | 3300025913 | Ga0207695_10141096 | Ga0207695_101410961 | 528 |
| 234 | 3300031247 | Ga0265340_10011466 | Ga0265340_100114663 | 528 |
| 235 | 3300009147 | Ga0114129_10010612 | Ga0114129_100106126 | 529 |
| 236 | 3300050507 | nmdc:mga05p37_4705_c1 | nmdc:mga05p37_4705_c1_9712_11406 | 529 |
| 237 | 3300050508 | nmdc:mga09592_53090_c1 | nmdc:mga09592_53090_c1_1129_2823 | 529 |
| 238 | 3300050510 | nmdc:mga06r32_82498_c1 | nmdc:mga06r32_82498_c1_760_2454 | 529 |
| 239 | 3300026067 | Ga0207678_10094029 | Ga0207678_100940292 | 531 |
| 240 | 3300005577 | Ga0068857_100033222 | Ga0068857_1000332222 | 532 |
| 241 | 3300025904 | Ga0207647_10009972 | Ga0207647_100099725 | 532 |
| 242 | 3300026116 | Ga0207674_10043277 | Ga0207674_100432772 | 532 |
| 243 | 3300031456 | Ga0307513_10037315 | Ga0307513_100373155 | 532 |
| 244 | 3300001979 | JGI24740J21852_10007397 | JGI24740J21852_100073972 | 533 |
| 245 | 3300001989 | JGI24739J22299_10001876 | JGI24739J22299_100018766 | 533 |
| 246 | 3300001990 | JGI24737J22298_10002997 | JGI24737J22298_100029973 | 533 |
| 247 | 3300005367 | Ga0070667_100090619 | Ga0070667_1000906193 | 533 |
| 248 | 3300025904 | Ga0207647_10010970 | Ga0207647_100109705 | 533 |
| 249 | 3300026116 | Ga0207674_10043241 | Ga0207674_100432415 | 533 |
| 250 | 3300048913 | Ga0496110_0002225 | Ga0496110_0002225_5626_7359 | 533 |
| 251 | 3300048914 | Ga0496111_0105015 | Ga0496111_0105015_10_1749 | 533 |
| 252 | iso_pu_bacteria | 2643221961 | 2645719270 | 533 |
| 253 | iso_pu_bacteria | 2643221962 | 2645726187 | 533 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e74-assembly1.cif.gz_A | crystal structure of the cytochrome b6f complex from m.laminosus | 0.9009 | 12 | 230 |
| 1q90-assembly1.cif.gz_B | structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii | 0.9007 | 11 | 230 |
| 4h44-assembly1.cif.gz_A | 2.70 a cytochrome b6f complex structure from nostoc pcc 7120 | 0.8922 | 12 | 230 |
| 7qrm-assembly1.cif.gz_A | cryo-em structure of catalytically active spinacia oleracea cytochrome b6f in complex with endogenous plastoquinones at 2.7 a resolution | 0.8823 | 8 | 231 |
| 7zxy-assembly1.cif.gz_I | 3.15 angstrom cryo-em structure of the dimeric cytochrome b6f complex from synechocystis sp. pcc 6803 with natively bound plastoquinone and lipid molecules. | 0.8762 | 5 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP37_12_439_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9447 | 10 | 432 | 1.20.810.10 |
| af_P9WP37_12_439_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9298 | 10 | 432 | 1.20.810.10 |
| 2e76A00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9019 | 11 | 227 | 1.20.810.10 |
| af_P05642_1_215_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.9015 | 7 | 231 | 1.20.810.10 |
| af_P05642_1_215_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8781 | 7 | 231 | 1.20.810.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W4TU27-F1-model_v4 | deleted | 0.9801 | 46 | 152 |
|
| AF-A0A538HS50-F1-model_v4 | Cytochrome bc1 complex cytochrome b subunit (EC 7.1.1.8) (Cytochrome bc1 reductase complex subunit QcrB) | 0.9567 | 29 | 210 |
GO:0008121
GO:0016020 GO:0022904 |
| AF-A0A7Z0CJZ8-F1-model_v4 | Cytochrome bc1 complex cytochrome b subunit (EC 7.1.1.8) (Cytochrome bc1 reductase complex subunit QcrB) | 0.9558 | 29 | 532 |
GO:0009055
GO:0016020 GO:0016491 GO:0022904 GO:0046872 |
| AF-A0A6L9SA94-F1-model_v4 | Cytochrome bc1 complex cytochrome b subunit (EC 7.1.1.8) (Cytochrome bc1 reductase complex subunit QcrB) | 0.9544 | 11 | 435 |
GO:0008121
GO:0016020 GO:0022904 |
| AF-A0A6L5F240-F1-model_v4 | Cytochrome bc1 complex cytochrome b subunit (EC 7.1.1.8) (Cytochrome bc1 reductase complex subunit QcrB) | 0.9539 | 87 | 271 |
GO:0008121
GO:0016020 GO:0022904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar