F364373

General Info

Members Datasets Scaffolds Average Seq Length
253 173 250 545

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0105015|Ga0496111_0105015_10_1749
Length 579
Sequence MTETPQPPRRKDEPAATPVGKAAVFLDERTGGAKGLKGLLGKVFPDHWSFMLGEIALYSFIVLLLSGTYLSLFFKPSQAEVIYHGSYVPLDGLSMTDAYSSTLHITFDVRGGLLMRQIHHWAALLFVAAITVHLFRVYFTGAFRKPRELNWLIGVGLLTLGILEGFAGYSLPDDLLSGTGLRIAEGIVQAIPVVGTYLASFVFGGEFPGNDFISRLYTVHILIVPALILALITAHLFLVVYHKHTQFPGPGRTEQNVVGYPLLPVYTAKAGGFFFVVFGVITLLSALVTINPVWLFGPYNPSQITAGSQPDWYIGFLDGALRIFPNWETYIWGHTISWNIFIPSVVIPGILFTLLGAYPFIEQFVTGDKRDHHLLDRPRNMPVRTGLGAMAISFYLLLWIGGGNDIIATRFDLTINEITRSIQVALFVVPPLVFLATKRICLGLQHRDRDKLLHGRETGIIRRLPSGEFVEIHAPVPDEERYTILQAGQMRPEPLALPAAVDDNGVPAPGGRKAALRAKLSAWFYAESVLTPSDEELHHAAHHAQELLEDQQRQLDAYNAGVPVDVSAEPDTREVTSGH

Samples

Sample ID Description Type Environment
1 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
2 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
3 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
119 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 2.37
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.91
Rhizosphere 87.35
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007397 3300001979 Bacteria 4468
2 JGI24739J22299_10001876 3300001989 Bacteria 8018
3 JGI24737J22298_10002997 3300001990 Bacteria 5986
4 JGI25406J46586_10000292 3300003203 Bacteria 22443
5 Ga0070658_10038083 3300005327 Bacteria 3878
6 Ga0070658_10044237 3300005327 Bacteria 3598
7 Ga0070683_100124749 3300005329 Bacteria 2434
8 Ga0070670_100036062 3300005331 Bacteria 4257
9 Ga0068869_100002657 3300005334 Bacteria 10799
10 Ga0070680_100111998 3300005336 Bacteria 2272
11 Ga0070682_100011270 3300005337 Bacteria 5103
12 Ga0068868_100009620 3300005338 Bacteria 6972
13 Ga0070668_100055400 3300005347 Bacteria 3060
14 Ga0070675_100133728 3300005354 Bacteria 2115
15 Ga0070671_100005593 3300005355 Bacteria 10006
16 Ga0070659_100022584 3300005366 Bacteria 4803
17 Ga0070659_100048842 3300005366 Bacteria 3325
18 Ga0070667_100090619 3300005367 Bacteria 2628
19 Ga0070709_10015372 3300005434 Bacteria 4353
20 Ga0070714_100009359 3300005435 Bacteria 7697
21 Ga0070710_10000039 3300005437 Bacteria 60337
22 Ga0070705_100091806 3300005440 Bacteria 1894
23 Ga0070663_100010380 3300005455 Bacteria 5805
24 Ga0070678_100004093 3300005456 Bacteria 8214
25 Ga0070681_10010142 3300005458 Bacteria 9289
26 Ga0070681_10124474 3300005458 Bacteria 2511
27 Ga0070681_10208752 3300005458 Bacteria 1869
28 Ga0070679_100013030 3300005530 Bacteria 7962
29 Ga0070679_100023841 3300005530 Bacteria 5995
30 Ga0070684_100133623 3300005535 Bacteria 2239
31 Ga0070693_100001271 3300005547 Bacteria 11405
32 Ga0070665_100003985 3300005548 Bacteria 15573
33 Ga0068855_100035129 3300005563 Bacteria 5971
34 Ga0068855_100039338 3300005563 Bacteria 5614
35 Ga0068855_100055099 3300005563 Bacteria 4671
36 Ga0068855_100093043 3300005563 Bacteria 3476
37 Ga0068855_100104395 3300005563 Bacteria 3260
38 Ga0070664_100062004 3300005564 Bacteria 3187
39 Ga0068857_100033222 3300005577 Bacteria 4563
40 Ga0068857_100119410 3300005577 Bacteria 2373
41 Ga0068854_100012270 3300005578 Bacteria 5609
42 Ga0068854_100079818 3300005578 Bacteria 2413
43 Ga0068856_100009445 3300005614 Bacteria 9471
44 Ga0068856_100038175 3300005614 Bacteria 4714
45 Ga0068856_100162465 3300005614 Bacteria 2244
46 Ga0070702_100000618 3300005615 Bacteria 13083
47 Ga0070702_100013746 3300005615 Bacteria 4094
48 Ga0068852_100082587 3300005616 Bacteria 2855
49 Ga0068864_100046924 3300005618 Bacteria 3708
50 Ga0068851_10021712 3300005834 Bacteria 3118
51 Ga0068863_100009864 3300005841 Bacteria 9304
52 Ga0068863_100010783 3300005841 Bacteria 8865
53 Ga0068858_100060858 3300005842 Bacteria 3490
54 Ga0081455_10046575 3300005937 Bacteria 3761
55 Ga0081539_10000242 3300005985 Bacteria 127897
56 Ga0070717_10002693 3300006028 Bacteria 12522
57 Ga0070716_100000222 3300006173 Bacteria 22754
58 Ga0068871_100021881 3300006358 Bacteria 4923
59 Ga0075428_100032129 3300006844 Bacteria 5798
60 Ga0075433_10046061 3300006852 Bacteria 3791
61 Ga0075434_100034457 3300006871 Bacteria 4999
62 Ga0075434_100225201 3300006871 Bacteria 1895
63 Ga0075436_100007449 3300006914 Bacteria 7485
64 Ga0075435_100006974 3300007076 Bacteria 8021
65 Ga0105240_10007675 3300009093 Bacteria 15616
66 Ga0105240_10018433 3300009093 Bacteria 9371
67 Ga0105240_10041725 3300009093 Bacteria 5852
68 Ga0105245_10028224 3300009098 Bacteria 4947
69 Ga0105247_10010522 3300009101 Bacteria 5590
70 Ga0114129_10010612 3300009147 Bacteria 13136
71 Ga0114129_10021145 3300009147 Bacteria 9239
72 Ga0114129_10051656 3300009147 Bacteria 5771
73 Ga0105243_10035980 3300009148 Bacteria 3840
74 Ga0105241_10006484 3300009174 Bacteria 8629
75 Ga0105248_10023874 3300009177 Bacteria 6796
76 Ga0105237_10009695 3300009545 Bacteria 10305
77 Ga0105237_10095948 3300009545 Bacteria 2955
78 Ga0105237_10096220 3300009545 Bacteria 2952
79 Ga0105238_10024646 3300009551 Bacteria 6132
80 Ga0105035_100381 3300009988 Bacteria 2753
81 Ga0105239_10004404 3300010375 Bacteria 16856
82 Ga0105246_10002547 3300011119 Bacteria 11013
83 Ga0157371_10016506 3300013102 Bacteria 5509
84 Ga0157370_10010581 3300013104 Bacteria 9712
85 Ga0157370_10029832 3300013104 Bacteria 5347
86 Ga0157369_10001634 3300013105 Bacteria 27388
87 Ga0157369_10016725 3300013105 Bacteria 8243
88 Ga0157369_10081416 3300013105 Bacteria 3465
89 Ga0157374_10146838 3300013296 Bacteria 2291
90 Ga0157372_10038120 3300013307 Bacteria 5303
91 Ga0157375_10029533 3300013308 Bacteria 5157
92 Ga0163163_10148615 3300014325 Bacteria 2387
93 Ga0157377_10008989 3300014745 Bacteria 4893
94 Ga0157379_10015459 3300014968 Bacteria 6697
95 Ga0206352_10295959 3300020078 Bacteria 2180
96 Ga0154015_1645553 3300020610 Bacteria 2430
97 Ga0224712_10002602 3300022467 Bacteria 4497
98 Ga0224712_10003024 3300022467 Bacteria 4284
99 Ga0207692_10001672 3300025898 Bacteria 8381
100 Ga0207688_10001013 3300025901 Bacteria 14332
101 Ga0207647_10009972 3300025904 Bacteria 6728
102 Ga0207647_10010970 3300025904 Bacteria 6374
103 Ga0207647_10040084 3300025904 Bacteria 2951
104 Ga0207699_10000105 3300025906 Bacteria 59026
105 Ga0207643_10000266 3300025908 Bacteria 36491
106 Ga0207643_10026774 3300025908 Bacteria 3194
107 Ga0207705_10015216 3300025909 Bacteria 5527
108 Ga0207705_10050292 3300025909 Bacteria 3000
109 Ga0207654_10007745 3300025911 Bacteria 5421
110 Ga0207695_10116034 3300025913 Bacteria 2652
111 Ga0207695_10141096 3300025913 Bacteria 2358
112 Ga0207695_10163195 3300025913 Bacteria 2158
113 Ga0207671_10004450 3300025914 Bacteria 13393
114 Ga0207693_10001586 3300025915 Bacteria 20116
115 Ga0207693_10019109 3300025915 Bacteria 5453
116 Ga0207657_10046997 3300025919 Bacteria 3777
117 Ga0207649_10015570 3300025920 Bacteria 4272
118 Ga0207652_10009476 3300025921 Bacteria 7828
119 Ga0207652_10015344 3300025921 Bacteria 6221
120 Ga0207650_10028313 3300025925 Bacteria 4016
121 Ga0207687_10061878 3300025927 Bacteria 2645
122 Ga0207700_10000050 3300025928 Bacteria 79672
123 Ga0207664_10000101 3300025929 Bacteria 79541
124 Ga0207644_10081660 3300025931 Bacteria 2389
125 Ga0207665_10000438 3300025939 Bacteria 28608
126 Ga0207689_10003430 3300025942 Bacteria 14473
127 Ga0207661_10003241 3300025944 Bacteria 11278
128 Ga0207679_10004435 3300025945 Bacteria 8743
129 Ga0207667_10027201 3300025949 Bacteria 6232
130 Ga0207667_10057370 3300025949 Bacteria 4087
131 Ga0207640_10015307 3300025981 Bacteria 4437
132 Ga0207658_10005925 3300025986 Bacteria 8348
133 Ga0207678_10000359 3300026067 Bacteria 41383
134 Ga0207678_10094029 3300026067 Bacteria 2561
135 Ga0207708_10007985 3300026075 Bacteria 7841
136 Ga0207702_10007229 3300026078 Bacteria 9497
137 Ga0207702_10068507 3300026078 Bacteria 3049
138 Ga0207641_10051569 3300026088 Bacteria 3484
139 Ga0207641_10139932 3300026088 Bacteria 2182
140 Ga0207648_10061583 3300026089 Bacteria 3272
141 Ga0207676_10002781 3300026095 Bacteria 12441
142 Ga0207676_10058736 3300026095 Bacteria 3035
143 Ga0207674_10043241 3300026116 Bacteria 4646
144 Ga0207674_10043277 3300026116 Bacteria 4643
145 Ga0207674_10110575 3300026116 Bacteria 2723
146 Ga0207675_100015297 3300026118 Bacteria 7160
147 Ga0207683_10003259 3300026121 Bacteria 14153
148 Ga0207428_10079739 3300027907 Bacteria 2559
149 Ga0265340_10011466 3300031247 Bacteria 4708
150 Ga0307513_10037315 3300031456 Bacteria 5410
151 Ga0307513_10063333 3300031456 Bacteria 3903
152 Ga0307508_10036052 3300031616 Bacteria 4455
153 Ga0316579_10004002 3300031691 Bacteria 5811
154 Ga0316576_10005118 3300031727 Bacteria 7960
155 Ga0316576_10055540 3300031727 Bacteria 2890
156 Ga0316577_10042847 3300031733 Bacteria 2532
157 Ga0316583_10013596 3300032133 Bacteria 2938
158 Ga0316585_10025705 3300032137 Bacteria 1827
159 Ga0316593_10025248 3300032168 Bacteria 1890
160 Ga0307507_10037395 3300033179 Bacteria 4941
161 Ga0316592_1000795 3300033524 Bacteria 4709
162 Ga0395900_0087804 3300037418 Bacteria 3196
163 Ga0316581_0001700 3300037588 Bacteria 5055
164 Ga0436364_1516024 3300037853 Bacteria 3457
165 Ga0395901_0018022 3300038443 Bacteria 7207
166 Ga0395901_0163706 3300038443 Bacteria 2336
167 Ga0395901_0253072 3300038443 Bacteria 1835
168 Ga0451833_0357642 3300041491 Bacteria 13939
169 Ga0466972_0015873 3300044658 Bacteria 3765
170 Ga0466966_0027336 3300044684 Bacteria 3721
171 Ga0466966_0032544 3300044684 Bacteria 3378
172 Ga0466966_0087428 3300044684 Bacteria 1937
173 Ga0466961_0001008 3300044693 Bacteria 17382
174 Ga0466961_0011768 3300044693 Bacteria 5592
175 Ga0466961_0032585 3300044693 Bacteria 3349
176 Ga0466961_0090875 3300044693 Bacteria 1928
177 Ga0466963_0004835 3300044694 Bacteria 7849
178 Ga0466963_0009249 3300044694 Bacteria 5933
179 Ga0466963_0068948 3300044694 Bacteria 2376
180 Ga0466964_0014945 3300044706 Bacteria 2956
181 Ga0466970_0011710 3300044765 Bacteria 4474
182 Ga0466957_0015818 3300044842 Bacteria 4408
183 Ga0466960_0004182 3300044901 Bacteria 5615
184 Ga0466960_0029675 3300044901 Bacteria 2511
185 Ga0466959_0024600 3300045049 Bacteria 4462
186 Ga0466959_0085817 3300045049 Bacteria 2265
187 Ga0466958_0016254 3300045836 Bacteria 4281
188 Ga0466958_0018864 3300045836 Bacteria 4008
189 Ga0466967_0000814 3300045976 Bacteria 16363
190 Ga0466967_0003831 3300045976 Bacteria 9955
191 Ga0466967_0038975 3300045976 Bacteria 4080
192 Ga0466967_0054834 3300045976 Bacteria 3510
193 Ga0466967_0075949 3300045976 Bacteria 3021
194 Ga0496102_0000453 3300048905 Bacteria 46525
195 Ga0496102_0000602 3300048905 Bacteria 37524
196 Ga0496103_0041842 3300048906 Bacteria 2817
197 Ga0496104_0002035 3300048907 Bacteria 17565
198 Ga0496104_0021901 3300048907 Bacteria 5869
199 Ga0496105_0015637 3300048908 Bacteria 6052
200 Ga0496107_0040228 3300048910 Bacteria 3355
201 Ga0496108_0081632 3300048911 Bacteria 2740
202 Ga0496109_0007436 3300048912 Bacteria 9274
203 Ga0496109_0013792 3300048912 Bacteria 7024
204 Ga0496109_0037778 3300048912 Bacteria 4364
205 Ga0496110_0002225 3300048913 Bacteria 14501
206 Ga0496110_0004812 3300048913 Bacteria 10518
207 Ga0496110_0010183 3300048913 Bacteria 7639
208 Ga0496111_0013280 3300048914 Bacteria 5600
209 Ga0496111_0105015 3300048914 Bacteria 2078
210 Ga0496112_0020362 3300048915 Bacteria 6287
211 Ga0496113_0001690 3300048916 Bacteria 12501
212 Ga0496113_0012612 3300048916 Bacteria 5687
213 Ga0496114_0024119 3300048917 Bacteria 4965
214 Ga0496119_0001177 3300048922 Bacteria 32784
215 Ga0496120_0004782 3300048923 Bacteria 11108
216 Ga0496126_0000072 3300048929 Bacteria 238130
217 Ga0501032_0024450 3300049569 Bacteria 4171
218 Ga0501033_0090678 3300049570 Bacteria 2236
219 Ga0501034_0031789 3300049571 Bacteria 5361
220 Ga0501036_0005006 3300049572 Bacteria 10723
221 Ga0501036_0092078 3300049572 Bacteria 2561
222 Ga0501038_0000544 3300049574 Bacteria 33088
223 Ga0501038_0001682 3300049574 Bacteria 20489
224 Ga0501038_0111296 3300049574 Bacteria 2269
225 Ga0501042_0092746 3300049578 Bacteria 2168
226 Ga0501043_0005123 3300049579 Bacteria 10606
227 Ga0501043_0023293 3300049579 Bacteria 4856
228 Ga0501043_0058733 3300049579 Bacteria 3019
229 Ga0501047_0000018 3300049581 Bacteria 274180
230 Ga0501047_0002306 3300049581 Bacteria 18245
231 Ga0501047_0011814 3300049581 Bacteria 8259
232 Ga0501048_0000768 3300049582 Bacteria 23513
233 Ga0501048_0000855 3300049582 Bacteria 22442
234 Ga0501048_0004462 3300049582 Bacteria 10651
235 Ga0501070_0004038 3300049586 Bacteria 12606
236 Ga0501070_0028556 3300049586 Bacteria 4679
237 Ga0501073_0085579 3300049589 Bacteria 2193
238 Ga0501074_0014768 3300049590 Bacteria 5681
239 Ga0501035_0014609 3300049822 Bacteria 7248
240 Ga0501035_0049389 3300049822 Bacteria 3770
241 Ga0501044_0023794 3300049823 Bacteria 6513
242 nmdc:mga05p37_140717_c1 3300050507 Bacteria 2956
243 nmdc:mga05p37_4705_c1 3300050507 Bacteria 15944
244 nmdc:mga09592_161830_c1 3300050508 Bacteria 1934
245 nmdc:mga09592_53090_c1 3300050508 Bacteria 3422
246 nmdc:mga06r32_82498_c1 3300050510 Bacteria 3132
247 nmdc:mga08y16_4458_c1 3300050511 Bacteria 14639
248 nmdc:mga0rr50_56333_c1 3300050513 Bacteria 2937
249 nmdc:mga08x19_7722_c1 3300050514 Bacteria 6388
250 Ga0466962_0021178 3300061719 Bacteria 3122

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0090678 Ga0501033_0090678_685_2205 469
2 3300045976 Ga0466967_0075949 Ga0466967_0075949_611_2116 474
3 3300048911 Ga0496108_0081632 Ga0496108_0081632_683_2212 485
4 3300048905 Ga0496102_0000453 Ga0496102_0000453_42651_44249 492
5 3300013296 Ga0157374_10146838 Ga0157374_101468382 496
6 3300025908 Ga0207643_10026774 Ga0207643_100267743 496
7 iso_pu_bacteria 2816332139 2816512052 496
8 3300003203 JGI25406J46586_10000292 JGI25406J46586_1000029217 498
9 3300005327 Ga0070658_10038083 Ga0070658_100380832 498
10 3300005347 Ga0070668_100055400 Ga0070668_1000554001 498
11 3300005354 Ga0070675_100133728 Ga0070675_1001337282 498
12 3300005366 Ga0070659_100048842 Ga0070659_1000488422 498
13 3300005535 Ga0070684_100133623 Ga0070684_1001336232 498
14 3300005564 Ga0070664_100062004 Ga0070664_1000620042 498
15 3300005578 Ga0068854_100079818 Ga0068854_1000798182 498
16 3300005614 Ga0068856_100162465 Ga0068856_1001624652 498
17 3300005615 Ga0070702_100013746 Ga0070702_1000137463 498
18 3300005985 Ga0081539_10000242 Ga0081539_1000024253 498
19 3300006871 Ga0075434_100225201 Ga0075434_1002252011 498
20 3300009545 Ga0105237_10095948 Ga0105237_100959482 498
21 3300009988 Ga0105035_100381 Ga0105035_1003812 498
22 3300025904 Ga0207647_10040084 Ga0207647_100400842 498
23 3300025909 Ga0207705_10050292 Ga0207705_100502922 498
24 3300026089 Ga0207648_10061583 Ga0207648_100615832 498
25 3300026118 Ga0207675_100015297 Ga0207675_1000152978 498
26 3300031616 Ga0307508_10036052 Ga0307508_100360524 498
27 3300033179 Ga0307507_10037395 Ga0307507_100373952 498
28 3300045976 Ga0466967_0054834 Ga0466967_0054834_676_2274 498
29 3300009093 Ga0105240_10007675 Ga0105240_1000767513 499
30 3300025913 Ga0207695_10116034 Ga0207695_101160341 499
31 3300020610 Ga0154015_1645553 Ga0154015_16455533 500
32 3300005937 Ga0081455_10046575 Ga0081455_100465753 501
33 3300048929 Ga0496126_0000072 Ga0496126_0000072_163848_165512 502
34 3300005577 Ga0068857_100119410 Ga0068857_1001194102 503
35 3300005841 Ga0068863_100009864 Ga0068863_1000098648 503
36 3300013105 Ga0157369_10001634 Ga0157369_1000163424 503
37 3300026078 Ga0207702_10068507 Ga0207702_100685072 503
38 3300026088 Ga0207641_10139932 Ga0207641_101399322 503
39 3300026095 Ga0207676_10058736 Ga0207676_100587362 503
40 3300026116 Ga0207674_10110575 Ga0207674_101105752 503
41 3300048907 Ga0496104_0002035 Ga0496104_0002035_8247_9884 503
42 3300048912 Ga0496109_0007436 Ga0496109_0007436_7592_9229 503
43 3300048913 Ga0496110_0004812 Ga0496110_0004812_7000_8637 503
44 3300048914 Ga0496111_0013280 Ga0496111_0013280_3907_5544 503
45 3300048915 Ga0496112_0020362 Ga0496112_0020362_3780_5417 503
46 3300048916 Ga0496113_0001690 Ga0496113_0001690_8814_10451 503
47 3300005327 Ga0070658_10044237 Ga0070658_100442372 505
48 3300005331 Ga0070670_100036062 Ga0070670_1000360622 505
49 3300005334 Ga0068869_100002657 Ga0068869_1000026577 505
50 3300005336 Ga0070680_100111998 Ga0070680_1001119981 505
51 3300005337 Ga0070682_100011270 Ga0070682_1000112702 505
52 3300005338 Ga0068868_100009620 Ga0068868_1000096207 505
53 3300005355 Ga0070671_100005593 Ga0070671_10000559310 505
54 3300005366 Ga0070659_100022584 Ga0070659_1000225845 505
55 3300005434 Ga0070709_10015372 Ga0070709_100153724 505
56 3300005435 Ga0070714_100009359 Ga0070714_1000093597 505
57 3300005440 Ga0070705_100091806 Ga0070705_1000918062 505
58 3300005455 Ga0070663_100010380 Ga0070663_1000103801 505
59 3300005456 Ga0070678_100004093 Ga0070678_1000040937 505
60 3300005458 Ga0070681_10010142 Ga0070681_100101428 505
61 3300005530 Ga0070679_100023841 Ga0070679_1000238415 505
62 3300005547 Ga0070693_100001271 Ga0070693_1000012712 505
63 3300005548 Ga0070665_100003985 Ga0070665_1000039858 505
64 3300005563 Ga0068855_100055099 Ga0068855_1000550993 505
65 3300005563 Ga0068855_100104395 Ga0068855_1001043952 505
66 3300005578 Ga0068854_100012270 Ga0068854_1000122702 505
67 3300005614 Ga0068856_100009445 Ga0068856_1000094458 505
68 3300005614 Ga0068856_100038175 Ga0068856_1000381753 505
69 3300005615 Ga0070702_100000618 Ga0070702_1000006188 505
70 3300005618 Ga0068864_100046924 Ga0068864_1000469243 505
71 3300005834 Ga0068851_10021712 Ga0068851_100217124 505
72 3300005841 Ga0068863_100010783 Ga0068863_1000107838 505
73 3300005842 Ga0068858_100060858 Ga0068858_1000608581 505
74 3300006358 Ga0068871_100021881 Ga0068871_1000218812 505
75 3300006852 Ga0075433_10046061 Ga0075433_100460613 505
76 3300006871 Ga0075434_100034457 Ga0075434_1000344576 505
77 3300006914 Ga0075436_100007449 Ga0075436_1000074498 505
78 3300007076 Ga0075435_100006974 Ga0075435_1000069749 505
79 3300009098 Ga0105245_10028224 Ga0105245_100282242 505
80 3300009101 Ga0105247_10010522 Ga0105247_100105224 505
81 3300009147 Ga0114129_10021145 Ga0114129_100211458 505
82 3300009148 Ga0105243_10035980 Ga0105243_100359803 505
83 3300009174 Ga0105241_10006484 Ga0105241_100064843 505
84 3300009177 Ga0105248_10023874 Ga0105248_100238743 505
85 3300009551 Ga0105238_10024646 Ga0105238_100246462 505
86 3300011119 Ga0105246_10002547 Ga0105246_100025476 505
87 3300013102 Ga0157371_10016506 Ga0157371_100165062 505
88 3300013104 Ga0157370_10029832 Ga0157370_100298322 505
89 3300013307 Ga0157372_10038120 Ga0157372_100381204 505
90 3300013308 Ga0157375_10029533 Ga0157375_100295334 505
91 3300014745 Ga0157377_10008989 Ga0157377_100089893 505
92 3300014968 Ga0157379_10015459 Ga0157379_100154595 505
93 3300025901 Ga0207688_10001013 Ga0207688_100010139 505
94 3300025908 Ga0207643_10000266 Ga0207643_1000026620 505
95 3300025909 Ga0207705_10015216 Ga0207705_100152163 505
96 3300025911 Ga0207654_10007745 Ga0207654_100077454 505
97 3300025915 Ga0207693_10019109 Ga0207693_100191093 505
98 3300025920 Ga0207649_10015570 Ga0207649_100155702 505
99 3300025921 Ga0207652_10009476 Ga0207652_100094761 505
100 3300025925 Ga0207650_10028313 Ga0207650_100283132 505
101 3300025927 Ga0207687_10061878 Ga0207687_100618781 505
102 3300025931 Ga0207644_10081660 Ga0207644_100816602 505
103 3300025942 Ga0207689_10003430 Ga0207689_100034307 505
104 3300025944 Ga0207661_10003241 Ga0207661_100032417 505
105 3300025945 Ga0207679_10004435 Ga0207679_100044356 505
106 3300025949 Ga0207667_10057370 Ga0207667_100573703 505
107 3300025981 Ga0207640_10015307 Ga0207640_100153074 505
108 3300026067 Ga0207678_10000359 Ga0207678_100003597 505
109 3300026075 Ga0207708_10007985 Ga0207708_100079857 505
110 3300026078 Ga0207702_10007229 Ga0207702_100072297 505
111 3300026088 Ga0207641_10051569 Ga0207641_100515691 505
112 3300026095 Ga0207676_10002781 Ga0207676_100027816 505
113 3300026121 Ga0207683_10003259 Ga0207683_100032597 505
114 3300027907 Ga0207428_10079739 Ga0207428_100797391 505
115 3300038443 Ga0395901_0163706 Ga0395901_0163706_481_2115 505
116 3300048907 Ga0496104_0021901 Ga0496104_0021901_2641_4275 505
117 3300048908 Ga0496105_0015637 Ga0496105_0015637_694_2328 505
118 3300048910 Ga0496107_0040228 Ga0496107_0040228_105_1739 505
119 3300048913 Ga0496110_0010183 Ga0496110_0010183_4162_5796 505
120 3300048916 Ga0496113_0012612 Ga0496113_0012612_3396_5030 505
121 3300050511 nmdc:mga08y16_4458_c1 nmdc:mga08y16_4458_c1_7991_9625 505
122 3300050513 nmdc:mga0rr50_56333_c1 nmdc:mga0rr50_56333_c1_709_2343 505
123 3300050514 nmdc:mga08x19_7722_c1 nmdc:mga08x19_7722_c1_2040_3674 505
124 3300009093 Ga0105240_10041725 Ga0105240_100417253 506
125 3300009545 Ga0105237_10009695 Ga0105237_100096959 506
126 3300010375 Ga0105239_10004404 Ga0105239_100044046 506
127 3300025914 Ga0207671_10004450 Ga0207671_1000445011 506
128 3300025986 Ga0207658_10005925 Ga0207658_100059252 506
129 3300038443 Ga0395901_0253072 Ga0395901_0253072_100_1743 506
130 3300044658 Ga0466972_0015873 Ga0466972_0015873_1699_3294 506
131 3300045836 Ga0466958_0016254 Ga0466958_0016254_1332_2963 506
132 3300045976 Ga0466967_0000814 Ga0466967_0000814_9045_10676 506
133 3300005458 Ga0070681_10208752 Ga0070681_102087522 507
134 3300005563 Ga0068855_100039338 Ga0068855_1000393382 507
135 3300005563 Ga0068855_100093043 Ga0068855_1000930432 507
136 3300009545 Ga0105237_10096220 Ga0105237_100962202 507
137 3300014325 Ga0163163_10148615 Ga0163163_101486152 507
138 3300044684 Ga0466966_0027336 Ga0466966_0027336_957_2609 507
139 3300044684 Ga0466966_0032544 Ga0466966_0032544_578_2203 507
140 3300044684 Ga0466966_0087428 Ga0466966_0087428_71_1705 507
141 3300044693 Ga0466961_0001008 Ga0466961_0001008_4281_5912 507
142 3300044693 Ga0466961_0011768 Ga0466961_0011768_1548_3173 507
143 3300044693 Ga0466961_0032585 Ga0466961_0032585_524_2143 507
144 3300044693 Ga0466961_0090875 Ga0466961_0090875_30_1673 507
145 3300044694 Ga0466963_0004835 Ga0466963_0004835_25_1668 507
146 3300044694 Ga0466963_0009249 Ga0466963_0009249_1388_3040 507
147 3300044694 Ga0466963_0068948 Ga0466963_0068948_209_1831 507
148 3300044706 Ga0466964_0014945 Ga0466964_0014945_1220_2863 507
149 3300044765 Ga0466970_0011710 Ga0466970_0011710_332_1978 507
150 3300044842 Ga0466957_0015818 Ga0466957_0015818_1084_2727 507
151 3300044901 Ga0466960_0004182 Ga0466960_0004182_3530_5176 507
152 3300044901 Ga0466960_0029675 Ga0466960_0029675_635_2275 507
153 3300045049 Ga0466959_0024600 Ga0466959_0024600_2175_3794 507
154 3300045049 Ga0466959_0085817 Ga0466959_0085817_361_2007 507
155 3300045836 Ga0466958_0018864 Ga0466958_0018864_712_2364 507
156 3300045976 Ga0466967_0003831 Ga0466967_0003831_1162_2805 507
157 3300045976 Ga0466967_0038975 Ga0466967_0038975_976_2613 507
158 3300048905 Ga0496102_0000602 Ga0496102_0000602_27966_29621 507
159 3300048906 Ga0496103_0041842 Ga0496103_0041842_1114_2769 507
160 3300048912 Ga0496109_0013792 Ga0496109_0013792_4433_6097 507
161 3300048912 Ga0496109_0037778 Ga0496109_0037778_2143_3795 507
162 3300048917 Ga0496114_0024119 Ga0496114_0024119_33_1685 507
163 3300048922 Ga0496119_0001177 Ga0496119_0001177_19424_21088 507
164 3300048923 Ga0496120_0004782 Ga0496120_0004782_5847_7511 507
165 3300049569 Ga0501032_0024450 Ga0501032_0024450_2479_4149 507
166 3300049571 Ga0501034_0031789 Ga0501034_0031789_2215_3885 507
167 3300049572 Ga0501036_0092078 Ga0501036_0092078_666_2336 507
168 3300049574 Ga0501038_0000544 Ga0501038_0000544_15652_17322 507
169 3300049579 Ga0501043_0005123 Ga0501043_0005123_6816_8486 507
170 3300049579 Ga0501043_0058733 Ga0501043_0058733_102_1763 507
171 3300049581 Ga0501047_0002306 Ga0501047_0002306_15402_17063 507
172 3300049581 Ga0501047_0011814 Ga0501047_0011814_322_1992 507
173 3300049582 Ga0501048_0000768 Ga0501048_0000768_795_2456 507
174 3300049582 Ga0501048_0000855 Ga0501048_0000855_17497_19167 507
175 3300049586 Ga0501070_0004038 Ga0501070_0004038_1541_3211 507
176 3300049822 Ga0501035_0014609 Ga0501035_0014609_2211_3872 507
177 3300049822 Ga0501035_0049389 Ga0501035_0049389_150_1820 507
178 3300061719 Ga0466962_0021178 Ga0466962_0021178_257_1900 507
179 3300050508 nmdc:mga09592_161830_c1 nmdc:mga09592_161830_c1_39_1646 509
180 3300006844 Ga0075428_100032129 Ga0075428_1000321296 510
181 3300031456 Ga0307513_10063333 Ga0307513_100633332 510
182 3300009147 Ga0114129_10051656 Ga0114129_100516564 513
183 3300037418 Ga0395900_0087804 Ga0395900_0087804_1481_3082 513
184 3300038443 Ga0395901_0018022 Ga0395901_0018022_2307_3908 513
185 3300050507 nmdc:mga05p37_140717_c1 nmdc:mga05p37_140717_c1_1134_2735 513
186 3300005329 Ga0070683_100124749 Ga0070683_1001247491 514
187 3300025913 Ga0207695_10163195 Ga0207695_101631952 514
188 3300025919 Ga0207657_10046997 Ga0207657_100469973 514
189 3300005458 Ga0070681_10124474 Ga0070681_101244742 517
190 3300005530 Ga0070679_100013030 Ga0070679_1000130308 517
191 3300025921 Ga0207652_10015344 Ga0207652_100153443 517
192 3300031727 Ga0316576_10005118 Ga0316576_100051181 518
193 3300020078 Ga0206352_10295959 Ga0206352_102959592 519
194 3300022467 Ga0224712_10003024 Ga0224712_100030244 519
195 3300005437 Ga0070710_10000039 Ga0070710_1000003915 520
196 3300006028 Ga0070717_10002693 Ga0070717_100026937 520
197 3300006173 Ga0070716_100000222 Ga0070716_10000022225 520
198 3300025898 Ga0207692_10001672 Ga0207692_100016723 520
199 3300025906 Ga0207699_10000105 Ga0207699_1000010533 520
200 3300025915 Ga0207693_10001586 Ga0207693_1000158621 520
201 3300025928 Ga0207700_10000050 Ga0207700_1000005028 520
202 3300025929 Ga0207664_10000101 Ga0207664_1000010128 520
203 3300025939 Ga0207665_10000438 Ga0207665_1000043829 520
204 3300005563 Ga0068855_100035129 Ga0068855_1000351292 521
205 3300025949 Ga0207667_10027201 Ga0207667_100272016 521
206 3300037853 Ga0436364_1516024 Ga0436364_1516024_419_2053 521
207 3300049572 Ga0501036_0005006 Ga0501036_0005006_7239_8837 521
208 3300049574 Ga0501038_0001682 Ga0501038_0001682_13562_15160 521
209 3300049578 Ga0501042_0092746 Ga0501042_0092746_300_1898 521
210 3300049579 Ga0501043_0023293 Ga0501043_0023293_1357_2955 521
211 3300049582 Ga0501048_0004462 Ga0501048_0004462_5830_7428 521
212 3300049589 Ga0501073_0085579 Ga0501073_0085579_218_1816 521
213 3300049590 Ga0501074_0014768 Ga0501074_0014768_3208_4806 521
214 3300049823 Ga0501044_0023794 Ga0501044_0023794_3761_5359 521
215 3300013105 Ga0157369_10081416 Ga0157369_100814162 522
216 3300049574 Ga0501038_0111296 Ga0501038_0111296_402_2012 522
217 3300031691 Ga0316579_10004002 Ga0316579_100040026 523
218 3300031727 Ga0316576_10055540 Ga0316576_100555402 523
219 3300031733 Ga0316577_10042847 Ga0316577_100428471 523
220 3300032133 Ga0316583_10013596 Ga0316583_100135962 523
221 3300032137 Ga0316585_10025705 Ga0316585_100257051 523
222 3300032168 Ga0316593_10025248 Ga0316593_100252481 523
223 3300033524 Ga0316592_1000795 Ga0316592_10007951 523
224 3300037588 Ga0316581_0001700 Ga0316581_0001700_3024_4700 523
225 3300049581 Ga0501047_0000018 Ga0501047_0000018_125021_126625 524
226 3300049586 Ga0501070_0028556 Ga0501070_0028556_2244_3947 524
227 3300041491 Ga0451833_0357642 Ga0451833_0357642_8786_10519 527
228 3300005616 Ga0068852_100082587 Ga0068852_1000825872 528
229 3300009093 Ga0105240_10018433 Ga0105240_100184332 528
230 3300013104 Ga0157370_10010581 Ga0157370_100105819 528
231 3300013105 Ga0157369_10016725 Ga0157369_100167254 528
232 3300022467 Ga0224712_10002602 Ga0224712_100026021 528
233 3300025913 Ga0207695_10141096 Ga0207695_101410961 528
234 3300031247 Ga0265340_10011466 Ga0265340_100114663 528
235 3300009147 Ga0114129_10010612 Ga0114129_100106126 529
236 3300050507 nmdc:mga05p37_4705_c1 nmdc:mga05p37_4705_c1_9712_11406 529
237 3300050508 nmdc:mga09592_53090_c1 nmdc:mga09592_53090_c1_1129_2823 529
238 3300050510 nmdc:mga06r32_82498_c1 nmdc:mga06r32_82498_c1_760_2454 529
239 3300026067 Ga0207678_10094029 Ga0207678_100940292 531
240 3300005577 Ga0068857_100033222 Ga0068857_1000332222 532
241 3300025904 Ga0207647_10009972 Ga0207647_100099725 532
242 3300026116 Ga0207674_10043277 Ga0207674_100432772 532
243 3300031456 Ga0307513_10037315 Ga0307513_100373155 532
244 3300001979 JGI24740J21852_10007397 JGI24740J21852_100073972 533
245 3300001989 JGI24739J22299_10001876 JGI24739J22299_100018766 533
246 3300001990 JGI24737J22298_10002997 JGI24737J22298_100029973 533
247 3300005367 Ga0070667_100090619 Ga0070667_1000906193 533
248 3300025904 Ga0207647_10010970 Ga0207647_100109705 533
249 3300026116 Ga0207674_10043241 Ga0207674_100432415 533
250 3300048913 Ga0496110_0002225 Ga0496110_0002225_5626_7359 533
251 3300048914 Ga0496111_0105015 Ga0496111_0105015_10_1749 533
252 iso_pu_bacteria 2643221961 2645719270 533
253 iso_pu_bacteria 2643221962 2645726187 533

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13631

Cytochrom_B_N_2

Cytochrome b(N-terminal)/b6/petB

124

298

0.96

PF00033

Cytochrome_B

Cytochrome b/b6/petB

41

244

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e74-assembly1.cif.gz_A crystal structure of the cytochrome b6f complex from m.laminosus 0.9009 12 230
1q90-assembly1.cif.gz_B structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii 0.9007 11 230
4h44-assembly1.cif.gz_A 2.70 a cytochrome b6f complex structure from nostoc pcc 7120 0.8922 12 230
7qrm-assembly1.cif.gz_A cryo-em structure of catalytically active spinacia oleracea cytochrome b6f in complex with endogenous plastoquinones at 2.7 a resolution 0.8823 8 231
7zxy-assembly1.cif.gz_I 3.15 angstrom cryo-em structure of the dimeric cytochrome b6f complex from synechocystis sp. pcc 6803 with natively bound plastoquinone and lipid molecules. 0.8762 5 230
ID Description Score Start End Superfamily
af_P9WP37_12_439_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.9447 10 432 1.20.810.10
af_P9WP37_12_439_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.9298 10 432 1.20.810.10
2e76A00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.9019 11 227 1.20.810.10
af_P05642_1_215_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.9015 7 231 1.20.810.10
af_P05642_1_215_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8781 7 231 1.20.810.10
ID Description Score Start End GO Terms
AF-W4TU27-F1-model_v4 deleted 0.9801 46 152
AF-A0A538HS50-F1-model_v4 Cytochrome bc1 complex cytochrome b subunit (EC 7.1.1.8) (Cytochrome bc1 reductase complex subunit QcrB) 0.9567 29 210 GO:0008121
GO:0016020
GO:0022904
AF-A0A7Z0CJZ8-F1-model_v4 Cytochrome bc1 complex cytochrome b subunit (EC 7.1.1.8) (Cytochrome bc1 reductase complex subunit QcrB) 0.9558 29 532 GO:0009055
GO:0016020
GO:0016491
GO:0022904
GO:0046872
AF-A0A6L9SA94-F1-model_v4 Cytochrome bc1 complex cytochrome b subunit (EC 7.1.1.8) (Cytochrome bc1 reductase complex subunit QcrB) 0.9544 11 435 GO:0008121
GO:0016020
GO:0022904
AF-A0A6L5F240-F1-model_v4 Cytochrome bc1 complex cytochrome b subunit (EC 7.1.1.8) (Cytochrome bc1 reductase complex subunit QcrB) 0.9539 87 271 GO:0008121
GO:0016020
GO:0022904

Feature Viewer

pLDDT pTM Quality
80.03 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map