F364324

General Info

Members Datasets Scaffolds Average Seq Length
253 205 506 160

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0213137|Ga0495583_0213137_62_604
Length 180
Sequence MAEVGPSGARSHQKPPSGSLVMTDLPYRPAAGIMLLNGAGQVFVACRIDTTTEAWQMPQGGLDPGEEARAGALRELEEETGIRPDQVELIAEAAEPLYYDLPADLQKKVWKGKYRGQKQHWFLLRFLGRDEDIDLETEHPEFRTWRWAEPASLPDLIVPFKRTLYQQVLAAFADHLERAG

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
159 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
160 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
161 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
162 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
163 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
169 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
172 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
177 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
180 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
181 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
182 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
183 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
184 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
193 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
194 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
200 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
201 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
202 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
203 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
204 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
205 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.84
Metatranscriptomes 0.4
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 1.19
Bulb 0
Endosphere 4.74
Nodule 0
Rhizoplane 4.74
Rhizosphere 86.56
Stem 0
Stem Tuber 0
Unclassified 2.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0213137 3300046506 Bacteria 782
2 SwRhRL3b_contig_3344127 2162886006 Bacteria 2391
3 JGI24736J21556_1000056 3300001904 Bacteria 18329
4 JGI24740J21852_10013422 3300001979 Bacteria 3054
5 JGI24739J22299_10010310 3300001989 Bacteria 3470
6 JGI24737J22298_10018404 3300001990 Bacteria 2242
7 JGI24735J21928_10007014 3300002067 Bacteria 3683
8 JGI24750J21931_1000004 3300002070 Bacteria 25671
9 JGI24748J21848_1000044 3300002074 Bacteria 59119
10 JGI24738J21930_10001953 3300002075 Bacteria 5558
11 JGI24749J21850_1000660 3300002076 Bacteria 5003
12 JGI24034J26672_10000020 3300002239 Bacteria 122643
13 JGI24742J22300_10009611 3300002244 Bacteria 1597
14 Ga0055534_1027980 3300003784 Bacteria 886
15 Ga0065704_10170964 3300005289 Unclassified 1292
16 Ga0065707_10083820 3300005295 Bacteria 8173
17 Ga0070658_10048345 3300005327 Bacteria 3444
18 Ga0070683_100564035 3300005329 Bacteria 1089
19 Ga0070690_100000180 3300005330 Bacteria 32463
20 Ga0070670_100293023 3300005331 Bacteria 1422
21 Ga0070666_10000027 3300005335 Bacteria 151010
22 Ga0070661_100049814 3300005344 Bacteria 3066
23 Ga0070661_100364233 3300005344 Bacteria 1137
24 Ga0070668_100829110 3300005347 Bacteria 823
25 Ga0070669_100000099 3300005353 Bacteria 85328
26 Ga0070688_100010650 3300005365 Bacteria 5079
27 Ga0070659_100171104 3300005366 Bacteria 1779
28 Ga0070667_100043981 3300005367 Bacteria 3749
29 Ga0070709_10044843 3300005434 Bacteria 2740
30 Ga0070663_100242498 3300005455 Bacteria 1423
31 Ga0070662_100253173 3300005457 Bacteria 1416
32 Ga0070685_10000238 3300005466 Bacteria 36209
33 Ga0070679_100310459 3300005530 Bacteria 1527
34 Ga0068853_100085212 3300005539 Bacteria 2769
35 Ga0070672_100227418 3300005543 Bacteria 1566
36 Ga0070686_100000010 3300005544 Bacteria 192116
37 Ga0070665_100000254 3300005548 Bacteria 88587
38 Ga0070665_100414296 3300005548 Bacteria 1356
39 Ga0068855_100009757 3300005563 Bacteria 11583
40 Ga0068855_100908951 3300005563 Bacteria 929
41 Ga0070664_100135251 3300005564 Bacteria 2167
42 Ga0068856_100233069 3300005614 Bacteria 1856
43 Ga0068856_100560848 3300005614 Bacteria 1163
44 Ga0068852_100669822 3300005616 Bacteria 1046
45 Ga0068859_100004830 3300005617 Bacteria 13721
46 Ga0068864_100004528 3300005618 Bacteria 11411
47 Ga0068861_100051612 3300005719 Bacteria 3122
48 Ga0068851_10059811 3300005834 Bacteria 1949
49 Ga0068851_10383513 3300005834 Bacteria 824
50 Ga0068863_100000775 3300005841 Bacteria 32088
51 Ga0068863_101507176 3300005841 Bacteria 681
52 Ga0068858_100000530 3300005842 Bacteria 39968
53 Ga0068860_100000080 3300005843 Bacteria 170152
54 Ga0068862_100000115 3300005844 Bacteria 94951
55 Ga0081455_10000545 3300005937 Bacteria 48941
56 Ga0070715_10540491 3300006163 Bacteria 674
57 Ga0068871_100353543 3300006358 Bacteria 1300
58 Ga0097620_100004830 3300006931 Bacteria 13721
59 Ga0105250_10031274 3300009092 Bacteria 2137
60 Ga0105240_10016986 3300009093 Bacteria 9830
61 Ga0105241_10178021 3300009174 Bacteria 1762
62 Ga0105248_10016891 3300009177 Bacteria 8035
63 Ga0105248_10606435 3300009177 Unclassified 1235
64 Ga0105237_10020390 3300009545 Bacteria 6835
65 Ga0105237_10261181 3300009545 Bacteria 1734
66 Ga0105237_10450791 3300009545 Bacteria 1292
67 Ga0105238_10219076 3300009551 Bacteria 1879
68 Ga0105238_10736071 3300009551 Bacteria 999
69 Ga0105249_10000064 3300009553 Bacteria 151646
70 Ga0157373_10065167 3300013100 Bacteria 2578
71 Ga0157370_10039889 3300013104 Bacteria 4535
72 Ga0157378_10086659 3300013297 Bacteria 2839
73 Ga0163162_10098967 3300013306 Bacteria 3006
74 Ga0157372_11041633 3300013307 Bacteria 947
75 Ga0157375_10402622 3300013308 Bacteria 1535
76 Ga0157380_10000086 3300014326 Bacteria 51604
77 Ga0157380_10000723 3300014326 Bacteria 20585
78 Ga0157379_10002697 3300014968 Bacteria 14964
79 Ga0157379_10476386 3300014968 Bacteria 1155
80 Ga0163161_10000110 3300017792 Bacteria 78102
81 Ga0213872_10001941 3300021361 Bacteria 12635
82 Ga0213872_10017941 3300021361 Bacteria 3265
83 Ga0213872_10037014 3300021361 Bacteria 2228
84 Ga0213872_10040350 3300021361 Bacteria 2131
85 Ga0207672_1000647 3300025223 Bacteria 4059
86 Ga0209675_1000922 3300025291 Bacteria 18751
87 Ga0209257_1036103 3300025304 Bacteria 1522
88 Ga0207710_10029623 3300025900 Bacteria 2383
89 Ga0207680_10000009 3300025903 Bacteria 464571
90 Ga0207647_10000684 3300025904 Bacteria 26599
91 Ga0207654_10069370 3300025911 Bacteria 2089
92 Ga0207695_10003071 3300025913 Bacteria 23930
93 Ga0207695_10017590 3300025913 Bacteria 8308
94 Ga0207671_10001965 3300025914 Bacteria 22681
95 Ga0207660_10128750 3300025917 Bacteria 1925
96 Ga0207657_10259600 3300025919 Bacteria 1383
97 Ga0207649_10257208 3300025920 Bacteria 1260
98 Ga0207652_10468879 3300025921 Bacteria 1134
99 Ga0207681_10000106 3300025923 Bacteria 71721
100 Ga0207694_10004457 3300025924 Bacteria 10933
101 Ga0207694_11201752 3300025924 Bacteria 642
102 Ga0207644_10023094 3300025931 Bacteria 4255
103 Ga0207644_10023194 3300025931 Bacteria 4247
104 Ga0207706_10432288 3300025933 Bacteria 1140
105 Ga0207670_10062400 3300025936 Bacteria 2547
106 Ga0207711_10030589 3300025941 Bacteria 4542
107 Ga0207667_10001537 3300025949 Bacteria 29015
108 Ga0207667_10002231 3300025949 Bacteria 24328
109 Ga0207712_10000044 3300025961 Bacteria 171240
110 Ga0207668_10718104 3300025972 Bacteria 879
111 Ga0207640_10039501 3300025981 Bacteria 2987
112 Ga0207658_10000340 3300025986 Bacteria 46680
113 Ga0207703_10003985 3300026035 Bacteria 12235
114 Ga0207639_10070195 3300026041 Bacteria 2736
115 Ga0207678_10070354 3300026067 Bacteria 3000
116 Ga0207702_10001379 3300026078 Bacteria 24214
117 Ga0207702_10056186 3300026078 Bacteria 3341
118 Ga0207641_10005614 3300026088 Bacteria 10688
119 Ga0207648_10701166 3300026089 Bacteria 938
120 Ga0207676_10003902 3300026095 Bacteria 10534
121 Ga0207674_10093240 3300026116 Bacteria 3000
122 Ga0207675_100000207 3300026118 Bacteria 54791
123 Ga0207698_10468740 3300026142 Bacteria 1219
124 Ga0207698_10493472 3300026142 Bacteria 1190
125 Ga0207698_10598269 3300026142 Bacteria 1087
126 Ga0268266_10000069 3300028379 Bacteria 239714
127 Ga0268266_10939679 3300028379 Bacteria 836
128 Ga0268265_10000100 3300028380 Bacteria 108659
129 Ga0268264_10000131 3300028381 Bacteria 181459
130 Ga0265328_10013632 3300031239 Bacteria 3214
131 Ga0265331_10000377 3300031250 Bacteria 46393
132 Ga0307408_100007268 3300031548 Bacteria 7325
133 Ga0265313_10075596 3300031595 Bacteria 1541
134 Ga0316575_10072597 3300031665 Bacteria 1384
135 Ga0316576_10029387 3300031727 Bacteria 3885
136 Ga0307405_10015721 3300031731 Bacteria 4106
137 Ga0307405_10405962 3300031731 Bacteria 1068
138 Ga0316577_10050786 3300031733 Bacteria 2315
139 Ga0307413_10825937 3300031824 Bacteria 781
140 Ga0307414_10288492 3300032004 Bacteria 1382
141 Ga0307414_11171398 3300032004 Bacteria 711
142 Ga0316583_10070330 3300032133 Bacteria 1224
143 Ga0373940_0063228 3300035088 Bacteria 1063
144 Ga0373939_0054854 3300035114 Bacteria 1249
145 Ga0373942_0015233 3300035207 Bacteria 1871
146 Ga0316584_0029067 3300036712 Bacteria 4080
147 Ga0316584_0043280 3300036712 Bacteria 3358
148 Ga0316584_0296771 3300036712 Bacteria 1171
149 Ga0395901_0535760 3300038443 Bacteria 1188
150 Ga0237816_00160 3300039145 Bacteria 5331
151 Ga0436360_0757186 3300039438 Bacteria 1401
152 Ga0436360_1225518 3300039438 Bacteria 1220
153 Ga0436361_0007544 3300039447 Bacteria 2395
154 Ga0436361_0028337 3300039447 Bacteria 793
155 Ga0436361_0777273 3300039447 Bacteria 2100
156 Ga0436363_0223170 3300039450 Bacteria 786
157 Ga0451577_0478194 3300042876 Bacteria 1131
158 Ga0453684_0000015 3300044712 Bacteria 969198
159 Ga0453684_0000020 3300044712 Bacteria 879938
160 Ga0453684_0066987 3300044712 Bacteria 4569
161 Ga0466968_0066669 3300044735 Bacteria 1559
162 Ga0466968_0075273 3300044735 Bacteria 1475
163 Ga0495603_0282966 3300046455 Bacteria 953
164 Ga0495638_0132714 3300046460 Bacteria 1461
165 Ga0495580_0337254 3300046472 Bacteria 1023
166 Ga0495607_0013092 3300046501 Bacteria 5447
167 Ga0495630_0074209 3300046517 Bacteria 2562
168 Ga0495642_0021567 3300046528 Bacteria 2534
169 Ga0495622_0039759 3300046557 Bacteria 2190
170 Ga0495622_0112935 3300046557 Bacteria 1243
171 Ga0495668_0229565 3300046616 Bacteria 1016
172 Ga0495658_0028733 3300046683 Bacteria 3004
173 Ga0495624_0065331 3300046690 Bacteria 2273
174 Ga0495649_0185157 3300046694 Bacteria 1085
175 Ga0495589_0127378 3300046794 Unclassified 1224
176 Ga0495660_0271908 3300046810 Bacteria 778
177 Ga0495686_0000057 3300047472 Bacteria 250088
178 Ga0495686_0006858 3300047472 Bacteria 8628
179 Ga0495686_0017032 3300047472 Bacteria 4907
180 Ga0495686_0110463 3300047472 Bacteria 1649
181 Ga0495686_0130774 3300047472 Bacteria 1488
182 Ga0495626_0070032 3300048091 Bacteria 1579
183 Ga0496100_0584444 3300048903 Unclassified 866
184 Ga0496100_0988031 3300048903 Bacteria 662
185 Ga0496102_0057780 3300048905 Bacteria 3543
186 Ga0496103_0039456 3300048906 Bacteria 2901
187 Ga0496104_0144369 3300048907 Bacteria 2286
188 Ga0496105_0033858 3300048908 Bacteria 4199
189 Ga0496106_0252040 3300048909 Bacteria 1411
190 Ga0496107_0368145 3300048910 Unclassified 1069
191 Ga0496110_0192519 3300048913 Bacteria 1852
192 Ga0496111_0393566 3300048914 Unclassified 1024
193 Ga0496115_1082093 3300048918 Bacteria 609
194 Ga0496116_0033685 3300048919 Bacteria 3630
195 Ga0496117_0013881 3300048920 Bacteria 6985
196 Ga0496124_0178948 3300048927 Bacteria 1634
197 Ga0501290_003261 3300049513 Bacteria 2059
198 Ga0501292_000377 3300049515 Bacteria 6005
199 Ga0501297_078640 3300049520 Bacteria 531
200 Ga0501299_037928 3300049522 Bacteria 956
201 Ga0501300_026912 3300049523 Bacteria 844
202 Ga0501300_038448 3300049523 Bacteria 717
203 Ga0501314_011380 3300049530 Bacteria 840
204 Ga0501033_0148844 3300049570 Bacteria 1690
205 Ga0501034_0101498 3300049571 Bacteria 2870
206 Ga0501034_0544312 3300049571 Bacteria 1071
207 Ga0501034_0842192 3300049571 Bacteria 808
208 Ga0501039_0390417 3300049575 Bacteria 1093
209 Ga0501073_0217234 3300049589 Bacteria 1321
210 Ga0501198_009347 3300049649 Unclassified 1437
211 Ga0501222_000639 3300049662 Bacteria 5132
212 Ga0501223_000116 3300049663 Bacteria 22926
213 Ga0501223_001036 3300049663 Bacteria 6560
214 Ga0501223_038339 3300049663 Bacteria 930
215 Ga0501224_000011 3300049664 Bacteria 93275
216 Ga0501224_007800 3300049664 Bacteria 1558
217 Ga0501233_000190 3300049668 Bacteria 9097
218 Ga0501235_009116 3300049669 Bacteria 2167
219 Ga0501247_006538 3300049677 Bacteria 1323
220 Ga0501257_000144 3300049686 Bacteria 15686
221 Ga0501259_002415 3300049688 Bacteria 3034
222 Ga0501261_000051 3300049690 Bacteria 22280
223 Ga0501225_0000152 3300049705 Bacteria 21223
224 Ga0501278_002516 3300049774 Bacteria 1289
225 Ga0501279_000364 3300049775 Bacteria 6061
226 Ga0501280_000100 3300049776 Bacteria 22874
227 Ga0501280_001107 3300049776 Bacteria 5410
228 Ga0501281_00601 3300049777 Bacteria 3215
229 Ga0501282_002537 3300049778 Bacteria 1980
230 Ga0501283_002486 3300049779 Bacteria 2394
231 Ga0501035_0365712 3300049822 Bacteria 1205
232 Ga0501044_0036902 3300049823 Bacteria 5111
233 Ga0501044_0473269 3300049823 Bacteria 1157
234 Ga0501045_0267504 3300049824 Bacteria 1273
235 Ga0501226_000024 3300049853 Bacteria 93123
236 Ga0500635_0006026 3300053080 Bacteria 3220
237 Ga0495619_0241865 3300053085 Bacteria 1251
238 Ga0500643_000173 3300053087 Bacteria 63279
239 Ga0500643_069462 3300053087 Bacteria 979
240 Ga0500592_001208 3300053116 Bacteria 4206
241 Ga0500655_030892 3300053133 Bacteria 1032
242 Ga0500559_0055951 3300053136 Bacteria 1750
243 Ga0500568_0060115 3300053139 Bacteria 1472
244 Ga0500604_0062132 3300053151 Bacteria 1175
245 Ga0500637_0005414 3300053178 Bacteria 6174
246 Ga0501082_0629453 3300060353 Bacteria 939
247 2600202584 2599185354 Bacteria 4398675
248 2753764377 2751185897 Bacteria 5322941
249 2928027675 2928027323 Bacteria 4382488
250 2984558032 2984555340 Bacteria 4247089
251 2984567601 2984564862 Bacteria 4339992
252 2993358653 2993356040 Bacteria 4247105
253 8057101776 8057101203 Bacteria 5034064
254 Ga0495583_0213137
255 SwRhRL3b_contig_3344127
256 JGI24736J21556_1000056
257 JGI24740J21852_10013422
258 JGI24739J22299_10010310
259 JGI24737J22298_10018404
260 JGI24735J21928_10007014
261 JGI24750J21931_1000004
262 JGI24748J21848_1000044
263 JGI24738J21930_10001953
264 JGI24749J21850_1000660
265 JGI24034J26672_10000020
266 JGI24742J22300_10009611
267 Ga0055534_1027980
268 Ga0065704_10170964
269 Ga0065707_10083820
270 Ga0070658_10048345
271 Ga0070683_100564035
272 Ga0070690_100000180
273 Ga0070670_100293023
274 Ga0070666_10000027
275 Ga0070661_100049814
276 Ga0070661_100364233
277 Ga0070668_100829110
278 Ga0070669_100000099
279 Ga0070688_100010650
280 Ga0070659_100171104
281 Ga0070667_100043981
282 Ga0070709_10044843
283 Ga0070663_100242498
284 Ga0070662_100253173
285 Ga0070685_10000238
286 Ga0070679_100310459
287 Ga0068853_100085212
288 Ga0070672_100227418
289 Ga0070686_100000010
290 Ga0070665_100000254
291 Ga0070665_100414296
292 Ga0068855_100009757
293 Ga0068855_100908951
294 Ga0070664_100135251
295 Ga0068856_100233069
296 Ga0068856_100560848
297 Ga0068852_100669822
298 Ga0068859_100004830
299 Ga0068864_100004528
300 Ga0068861_100051612
301 Ga0068851_10059811
302 Ga0068851_10383513
303 Ga0068863_100000775
304 Ga0068863_101507176
305 Ga0068858_100000530
306 Ga0068860_100000080
307 Ga0068862_100000115
308 Ga0081455_10000545
309 Ga0070715_10540491
310 Ga0068871_100353543
311 Ga0097620_100004830
312 Ga0105250_10031274
313 Ga0105240_10016986
314 Ga0105241_10178021
315 Ga0105248_10016891
316 Ga0105248_10606435
317 Ga0105237_10020390
318 Ga0105237_10261181
319 Ga0105237_10450791
320 Ga0105238_10219076
321 Ga0105238_10736071
322 Ga0105249_10000064
323 Ga0157373_10065167
324 Ga0157370_10039889
325 Ga0157378_10086659
326 Ga0163162_10098967
327 Ga0157372_11041633
328 Ga0157375_10402622
329 Ga0157380_10000086
330 Ga0157380_10000723
331 Ga0157379_10002697
332 Ga0157379_10476386
333 Ga0163161_10000110
334 Ga0213872_10001941
335 Ga0213872_10017941
336 Ga0213872_10037014
337 Ga0213872_10040350
338 Ga0207672_1000647
339 Ga0209675_1000922
340 Ga0209257_1036103
341 Ga0207710_10029623
342 Ga0207680_10000009
343 Ga0207647_10000684
344 Ga0207654_10069370
345 Ga0207695_10003071
346 Ga0207695_10017590
347 Ga0207671_10001965
348 Ga0207660_10128750
349 Ga0207657_10259600
350 Ga0207649_10257208
351 Ga0207652_10468879
352 Ga0207681_10000106
353 Ga0207694_10004457
354 Ga0207694_11201752
355 Ga0207644_10023094
356 Ga0207644_10023194
357 Ga0207706_10432288
358 Ga0207670_10062400
359 Ga0207711_10030589
360 Ga0207667_10001537
361 Ga0207667_10002231
362 Ga0207712_10000044
363 Ga0207668_10718104
364 Ga0207640_10039501
365 Ga0207658_10000340
366 Ga0207703_10003985
367 Ga0207639_10070195
368 Ga0207678_10070354
369 Ga0207702_10001379
370 Ga0207702_10056186
371 Ga0207641_10005614
372 Ga0207648_10701166
373 Ga0207676_10003902
374 Ga0207674_10093240
375 Ga0207675_100000207
376 Ga0207698_10468740
377 Ga0207698_10493472
378 Ga0207698_10598269
379 Ga0268266_10000069
380 Ga0268266_10939679
381 Ga0268265_10000100
382 Ga0268264_10000131
383 Ga0265328_10013632
384 Ga0265331_10000377
385 Ga0307408_100007268
386 Ga0265313_10075596
387 Ga0316575_10072597
388 Ga0316576_10029387
389 Ga0307405_10015721
390 Ga0307405_10405962
391 Ga0316577_10050786
392 Ga0307413_10825937
393 Ga0307414_10288492
394 Ga0307414_11171398
395 Ga0316583_10070330
396 Ga0373940_0063228
397 Ga0373939_0054854
398 Ga0373942_0015233
399 Ga0316584_0029067
400 Ga0316584_0043280
401 Ga0316584_0296771
402 Ga0395901_0535760
403 Ga0237816_00160
404 Ga0436360_0757186
405 Ga0436360_1225518
406 Ga0436361_0007544
407 Ga0436361_0028337
408 Ga0436361_0777273
409 Ga0436363_0223170
410 Ga0451577_0478194
411 Ga0453684_0000015
412 Ga0453684_0000020
413 Ga0453684_0066987
414 Ga0466968_0066669
415 Ga0466968_0075273
416 Ga0495603_0282966
417 Ga0495638_0132714
418 Ga0495580_0337254
419 Ga0495607_0013092
420 Ga0495630_0074209
421 Ga0495642_0021567
422 Ga0495622_0039759
423 Ga0495622_0112935
424 Ga0495668_0229565
425 Ga0495658_0028733
426 Ga0495624_0065331
427 Ga0495649_0185157
428 Ga0495589_0127378
429 Ga0495660_0271908
430 Ga0495686_0000057
431 Ga0495686_0006858
432 Ga0495686_0017032
433 Ga0495686_0110463
434 Ga0495686_0130774
435 Ga0495626_0070032
436 Ga0496100_0584444
437 Ga0496100_0988031
438 Ga0496102_0057780
439 Ga0496103_0039456
440 Ga0496104_0144369
441 Ga0496105_0033858
442 Ga0496106_0252040
443 Ga0496107_0368145
444 Ga0496110_0192519
445 Ga0496111_0393566
446 Ga0496115_1082093
447 Ga0496116_0033685
448 Ga0496117_0013881
449 Ga0496124_0178948
450 Ga0501290_003261
451 Ga0501292_000377
452 Ga0501297_078640
453 Ga0501299_037928
454 Ga0501300_026912
455 Ga0501300_038448
456 Ga0501314_011380
457 Ga0501033_0148844
458 Ga0501034_0101498
459 Ga0501034_0544312
460 Ga0501034_0842192
461 Ga0501039_0390417
462 Ga0501073_0217234
463 Ga0501198_009347
464 Ga0501222_000639
465 Ga0501223_000116
466 Ga0501223_001036
467 Ga0501223_038339
468 Ga0501224_000011
469 Ga0501224_007800
470 Ga0501233_000190
471 Ga0501235_009116
472 Ga0501247_006538
473 Ga0501257_000144
474 Ga0501259_002415
475 Ga0501261_000051
476 Ga0501225_0000152
477 Ga0501278_002516
478 Ga0501279_000364
479 Ga0501280_000100
480 Ga0501280_001107
481 Ga0501281_00601
482 Ga0501282_002537
483 Ga0501283_002486
484 Ga0501035_0365712
485 Ga0501044_0036902
486 Ga0501044_0473269
487 Ga0501045_0267504
488 Ga0501226_000024
489 Ga0500635_0006026
490 Ga0495619_0241865
491 Ga0500643_000173
492 Ga0500643_069462
493 Ga0500592_001208
494 Ga0500655_030892
495 Ga0500559_0055951
496 Ga0500568_0060115
497 Ga0500604_0062132
498 Ga0500637_0005414
499 Ga0501082_0629453
500 2600202584
501 2753764377
502 2928027675
503 2984558032
504 2984567601
505 2993358653
506 8057101776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

26

168

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.9538 9 157
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.9506 9 157
6d1v-assembly1.cif.gz_B crystal structure of e. coli rpph-dapf complex, monomer bound to rna 0.9411 9 157
4s2x-assembly1.cif.gz_A structure of e. coli rpph bound to rna and two magnesium ions 0.9404 9 157
5ygu-assembly1.cif.gz_B crystal structure of escherichia coli (strain k12) mrna decapping complex rpph-dapf 0.9364 9 156
ID Description Score Start End Superfamily
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9506 9 157 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9246 5 158 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9177 25 158 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8907 5 158 3.90.79.10
4s2vA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8784 9 156 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A1G6LYJ1-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 1.001 4 157 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A2A5YH42-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9947 3 158 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A2U2CBR0-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9944 3 159 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A1G9IA05-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9939 7 156 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A6J4T925-F1-model_v4 Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase 0.9933 6 158 GO:0006753
GO:0008893
GO:0019693
GO:0034432

Map