F361148

General Info

Members Datasets Scaffolds Average Seq Length
249 163 498 171

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0182115|Ga0500616_0182115_100_675
Length 191
Sequence MAYTADRRLFATPPDLFQVTMDLKEHIRHVPDFPKPGILFYDISTLLANGPAWHEALNRLTETLRAYKPDVLVGIESRGFLVAAPLADRLGTGFIMVRKRGKLPGEVIRHAYDLEYGEDIIEIQADAIKPGQRVIVLDDLLATGGTMAAAVTLLEKVGADVVAIGCLIELTFLGGRKRLDVPVHTLLSYDS

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
156 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
162 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
163 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.24
Nodule 0.4
Rhizoplane 0.4
Rhizosphere 87.95
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0182115 3300053153 Bacteria 945
2 ARcpr5yngRDRAFT_c018223 3300000043 Bacteria 592
3 JGI25151J46595_10001012 3300003187 Bacteria 21230
4 JGI25153J46596_10000042 3300003215 Bacteria 161788
5 JGI25153J46596_10000087 3300003215 Bacteria 111217
6 JGI25153J46596_10025454 3300003215 Bacteria 2114
7 Ga0065704_10097407 3300005289 Bacteria 2396
8 Ga0065712_10000800 3300005290 Bacteria 9630
9 Ga0065715_10008113 3300005293 Unclassified 2870
10 Ga0065707_10007529 3300005295 Bacteria 3284
11 Ga0070658_10132747 3300005327 Bacteria 2076
12 Ga0070683_101391833 3300005329 Bacteria 674
13 Ga0070690_100036830 3300005330 Bacteria 3078
14 Ga0070670_100232406 3300005331 Bacteria 1605
15 Ga0068869_100184996 3300005334 Bacteria 1635
16 Ga0068869_100222154 3300005334 Bacteria 1498
17 Ga0070666_10120445 3300005335 Bacteria 1819
18 Ga0070675_100008591 3300005354 Bacteria 7929
19 Ga0070675_100107617 3300005354 Bacteria 2355
20 Ga0070675_100621246 3300005354 Bacteria 981
21 Ga0070675_101515116 3300005354 Bacteria 619
22 Ga0070673_100060354 3300005364 Bacteria 3005
23 Ga0070673_101879731 3300005364 Bacteria 568
24 Ga0070659_100351583 3300005366 Bacteria 1236
25 Ga0070659_100393091 3300005366 Bacteria 1169
26 Ga0070667_100288457 3300005367 Bacteria 1475
27 Ga0070714_100562730 3300005435 Bacteria 1092
28 Ga0070701_10348895 3300005438 Bacteria 924
29 Ga0070705_101544191 3300005440 Bacteria 557
30 Ga0070708_100164512 3300005445 Bacteria 2069
31 Ga0070662_100748687 3300005457 Bacteria 829
32 Ga0070681_10007956 3300005458 Bacteria 10379
33 Ga0068867_100221570 3300005459 Bacteria 1525
34 Ga0068867_100952218 3300005459 Bacteria 776
35 Ga0070685_10633937 3300005466 Bacteria 773
36 Ga0070707_100809296 3300005468 Bacteria 901
37 Ga0070698_100390814 3300005471 Bacteria 1324
38 Ga0070699_100034822 3300005518 Bacteria 4351
39 Ga0070697_100478676 3300005536 Bacteria 1087
40 Ga0070697_101506650 3300005536 Bacteria 601
41 Ga0068853_101117411 3300005539 Bacteria 760
42 Ga0070686_100454205 3300005544 Bacteria 986
43 Ga0070695_100904501 3300005545 Bacteria 713
44 Ga0070665_100083614 3300005548 Bacteria 3196
45 Ga0068855_100657484 3300005563 Bacteria 1125
46 Ga0068857_100301593 3300005577 Bacteria 1477
47 Ga0068859_100187117 3300005617 Bacteria 2154
48 Ga0068859_101137894 3300005617 Bacteria 859
49 Ga0068864_100595194 3300005618 Bacteria 1073
50 Ga0068861_100143663 3300005719 Bacteria 1951
51 Ga0068861_100707705 3300005719 Bacteria 937
52 Ga0068870_10605457 3300005840 Bacteria 745
53 Ga0068863_100705592 3300005841 Unclassified 1003
54 Ga0068862_100005787 3300005844 Bacteria 10309
55 Ga0070715_10296475 3300006163 Bacteria 863
56 Ga0070716_100441729 3300006173 Bacteria 946
57 Ga0097621_100083959 3300006237 Bacteria 2654
58 Ga0068871_100075675 3300006358 Bacteria 2779
59 Ga0075428_100329293 3300006844 Bacteria 1641
60 Ga0075428_101456479 3300006844 Bacteria 718
61 Ga0075430_100004720 3300006846 Bacteria 11459
62 Ga0075430_100011515 3300006846 Bacteria 7518
63 Ga0075430_100038826 3300006846 Bacteria 4032
64 Ga0075430_100043183 3300006846 Bacteria 3811
65 Ga0075430_100047569 3300006846 Bacteria 3622
66 Ga0075430_100334272 3300006846 Unclassified 1251
67 Ga0075431_100000275 3300006847 Bacteria 39941
68 Ga0075431_100145487 3300006847 Bacteria 2442
69 Ga0075433_10002061 3300006852 Bacteria 15191
70 Ga0075433_10010482 3300006852 Bacteria 7440
71 Ga0075433_10746527 3300006852 Unclassified 856
72 Ga0075434_100000994 3300006871 Bacteria 22977
73 Ga0075434_100028702 3300006871 Bacteria 5470
74 Ga0075434_100832441 3300006871 Bacteria 939
75 Ga0075429_100004667 3300006880 Bacteria 11796
76 Ga0075429_100086763 3300006880 Bacteria 2728
77 Ga0075429_100191884 3300006880 Bacteria 1790
78 Ga0075436_100026556 3300006914 Bacteria 3987
79 Ga0097620_100187110 3300006931 Bacteria 2154
80 Ga0097620_101138136 3300006931 Bacteria 859
81 Ga0075435_100010818 3300007076 Bacteria 6682
82 Ga0105240_11303283 3300009093 Bacteria 766
83 Ga0111539_10000056 3300009094 Bacteria 114878
84 Ga0111539_10031324 3300009094 Bacteria 6461
85 Ga0111539_10036211 3300009094 Bacteria 5968
86 Ga0111539_10050159 3300009094 Bacteria 4972
87 Ga0111539_10075343 3300009094 Bacteria 3975
88 Ga0111539_10150772 3300009094 Bacteria 2721
89 Ga0111539_10412349 3300009094 Bacteria 1573
90 Ga0105245_10316070 3300009098 Bacteria 1537
91 Ga0114129_10085693 3300009147 Bacteria 4371
92 Ga0114129_10176847 3300009147 Bacteria 2907
93 Ga0114129_10314786 3300009147 Bacteria 2082
94 Ga0114129_10902318 3300009147 Bacteria 1120
95 Ga0105242_11588541 3300009176 Bacteria 687
96 Ga0105242_11603804 3300009176 Bacteria 684
97 Ga0105248_11027930 3300009177 Bacteria 931
98 Ga0105238_10075194 3300009551 Bacteria 3370
99 Ga0105249_10642445 3300009553 Bacteria 1118
100 Ga0157380_10619163 3300014326 Bacteria 1074
101 Ga0157380_10717878 3300014326 Bacteria 1007
102 Ga0157377_10317323 3300014745 Bacteria 1034
103 Ga0213872_10011974 3300021361 Bacteria 4093
104 Ga0209130_1001492 3300025284 Bacteria 15195
105 Ga0209675_1015777 3300025291 Bacteria 2228
106 Ga0209025_1000509 3300025294 Bacteria 74336
107 Ga0209758_1000110 3300025297 Bacteria 213110
108 Ga0209758_1004952 3300025297 Bacteria 10671
109 Ga0207426_1000080 3300025302 Bacteria 304917
110 Ga0207426_1016714 3300025302 Bacteria 2625
111 Ga0207685_10458376 3300025905 Bacteria 664
112 Ga0207684_10919187 3300025910 Bacteria 735
113 Ga0207707_10042377 3300025912 Bacteria 3972
114 Ga0207695_10993083 3300025913 Bacteria 719
115 Ga0207695_11067861 3300025913 Bacteria 687
116 Ga0207671_10509457 3300025914 Bacteria 959
117 Ga0207660_10250124 3300025917 Bacteria 1399
118 Ga0207646_10628733 3300025922 Bacteria 963
119 Ga0207681_10779880 3300025923 Bacteria 798
120 Ga0207681_10858586 3300025923 Bacteria 759
121 Ga0207694_10181937 3300025924 Bacteria 1705
122 Ga0207650_10982902 3300025925 Bacteria 718
123 Ga0207659_10035992 3300025926 Bacteria 3426
124 Ga0207690_10310418 3300025932 Bacteria 1237
125 Ga0207706_10660187 3300025933 Bacteria 895
126 Ga0207670_10688275 3300025936 Bacteria 845
127 Ga0207689_10164236 3300025942 Bacteria 1830
128 Ga0207689_11257267 3300025942 Bacteria 622
129 Ga0207679_10044734 3300025945 Bacteria 3197
130 Ga0207651_10096159 3300025960 Bacteria 2183
131 Ga0207708_10582165 3300026075 Bacteria 946
132 Ga0207641_10136021 3300026088 Bacteria 2212
133 Ga0207648_10071705 3300026089 Bacteria 3019
134 Ga0207648_10319194 3300026089 Bacteria 1396
135 Ga0207676_10816394 3300026095 Bacteria 910
136 Ga0207674_10328904 3300026116 Bacteria 1478
137 Ga0207675_100054101 3300026118 Bacteria 3745
138 Ga0207675_100492220 3300026118 Bacteria 1220
139 Ga0207683_10139570 3300026121 Bacteria 2183
140 Ga0209970_1036635 3300027614 Bacteria 864
141 Ga0209966_1076856 3300027695 Bacteria 736
142 Ga0207428_10002483 3300027907 Bacteria 18414
143 Ga0207428_10073661 3300027907 Bacteria 2679
144 Ga0268266_10000520 3300028379 Bacteria 54335
145 Ga0268266_10591413 3300028379 Bacteria 1065
146 Ga0268265_10006506 3300028380 Bacteria 7918
147 Ga0268264_10501384 3300028381 Bacteria 1184
148 Ga0265318_10085384 3300028577 Bacteria 1164
149 Ga0307512_10278615 3300030522 Bacteria 802
150 Ga0307416_100378360 3300032002 Bacteria 1445
151 Ga0316583_10185437 3300032133 Bacteria 723
152 Ga0242420_035201 3300038996 Bacteria 941
153 Ga0436360_0912806 3300039438 Bacteria 1810
154 Ga0436361_0012467 3300039447 Bacteria 129952
155 Ga0436361_0012669 3300039447 Bacteria 4859
156 Ga0451853_0658236 3300041512 Bacteria 715
157 Ga0439435_0037239 3300042436 Bacteria 1347
158 Ga0453683_0472729 3300044673 Bacteria 812
159 Ga0453684_0115871 3300044712 Bacteria 3246
160 Ga0451576_0152421 3300045051 Bacteria 2411
161 Ga0451576_0163085 3300045051 Bacteria 2326
162 Ga0495663_0189327 3300046525 Bacteria 715
163 Ga0495621_0041803 3300046539 Bacteria 1611
164 Ga0495621_0235812 3300046539 Unclassified 744
165 Ga0496109_0933865 3300048912 Bacteria 805
166 Ga0496126_0706698 3300048929 Bacteria 783
167 Ga0495682_0072134 3300049460 Bacteria 1243
168 Ga0501298_134462 3300049521 Bacteria 593
169 Ga0501038_0185787 3300049574 Bacteria 1675
170 Ga0501042_0071410 3300049578 Bacteria 2483
171 Ga0501043_0547172 3300049579 Bacteria 860
172 Ga0501046_0398102 3300049580 Bacteria 995
173 Ga0501047_0005930 3300049581 Bacteria 11492
174 Ga0501047_0309629 3300049581 Bacteria 1420
175 Ga0501047_0380153 3300049581 Bacteria 1247
176 Ga0501048_0244230 3300049582 Bacteria 1274
177 Ga0501068_0014455 3300049584 Bacteria 4513
178 Ga0501070_0131091 3300049586 Bacteria 2071
179 Ga0501070_0222357 3300049586 Bacteria 1548
180 Ga0501072_0103645 3300049588 Bacteria 2261
181 Ga0501073_0002564 3300049589 Bacteria 13580
182 Ga0501073_0052968 3300049589 Bacteria 2841
183 Ga0501073_0211264 3300049589 Bacteria 1341
184 Ga0501074_0051932 3300049590 Bacteria 2959
185 Ga0501074_0267697 3300049590 Bacteria 1215
186 Ga0501075_0361930 3300049591 Bacteria 1106
187 Ga0501075_0868051 3300049591 Bacteria 686
188 Ga0501076_0013353 3300049592 Bacteria 6159
189 Ga0501076_1192598 3300049592 Bacteria 627
190 Ga0501079_0013121 3300049741 Bacteria 6317
191 Ga0501080_0012127 3300049742 Bacteria 7896
192 Ga0501080_0159097 3300049742 Bacteria 2086
193 Ga0501083_0043841 3300049744 Bacteria 3029
194 Ga0501083_0303031 3300049744 Bacteria 1039
195 Ga0501044_0015288 3300049823 Bacteria 8265
196 Ga0501044_0088304 3300049823 Bacteria 3130
197 nmdc:mga05p37_28714_c1 3300050507 Bacteria 6786
198 nmdc:mga05p37_492572_c1 3300050507 Bacteria 1409
199 nmdc:mga05p37_868403_c1 3300050507 Bacteria 977
200 nmdc:mga09592_35327_c1 3300050508 Bacteria 4184
201 nmdc:mga09592_58209_c1 3300050508 Bacteria 3268
202 nmdc:mga0qj67_14098_c1 3300050509 Bacteria 6037
203 nmdc:mga0qj67_28336_c1 3300050509 Bacteria 4347
204 nmdc:mga0qj67_31825_c1 3300050509 Bacteria 4111
205 nmdc:mga0qj67_352083_c1 3300050509 Unclassified 1190
206 nmdc:mga0qj67_436353_c1 3300050509 Bacteria 1055
207 nmdc:mga0qj67_722118_c1 3300050509 Bacteria 792
208 nmdc:mga0qj67_88657_c1 3300050509 Bacteria 2484
209 nmdc:mga06r32_330157_c1 3300050510 Bacteria 1510
210 nmdc:mga06r32_441446_c1 3300050510 Unclassified 1281
211 nmdc:mga06r32_4607_c1 3300050510 Bacteria 12364
212 nmdc:mga08y16_1311_c1 3300050511 Bacteria 24756
213 nmdc:mga08y16_34880_c1 3300050511 Bacteria 5286
214 nmdc:mga08y16_44849_c1 3300050511 Bacteria 4634
215 nmdc:mga08y16_66286_c1 3300050511 Bacteria 3768
216 nmdc:mga08y16_72739_c1 3300050511 Bacteria 3582
217 nmdc:mga0n895_270585_c1 3300050512 Bacteria 1723
218 nmdc:mga0n895_423152_c1 3300050512 Bacteria 1346
219 nmdc:mga0n895_5357_c1 3300050512 Bacteria 10698
220 nmdc:mga0n895_873_c1 3300050512 Bacteria 21698
221 nmdc:mga0rr50_13904_c1 3300050513 Bacteria 5259
222 nmdc:mga0rr50_371400_c1 3300050513 Bacteria 1205
223 nmdc:mga08x19_20724_c1 3300050514 Bacteria 4051
224 nmdc:mga08x19_415242_c1 3300050514 Bacteria 945
225 nmdc:mga0a205_14834_c1 3300050515 Bacteria 7272
226 nmdc:mga0a205_8463_c1 3300050515 Bacteria 9363
227 Ga0500646_0015605 3300053090 Bacteria 1979
228 Ga0500647_0246876 3300053091 Bacteria 787
229 Ga0500594_0010820 3300053118 Bacteria 2122
230 Ga0500595_093413 3300053119 Bacteria 868
231 Ga0500568_0026445 3300053139 Bacteria 2435
232 Ga0500577_0125007 3300053142 Bacteria 1073
233 Ga0500588_0014638 3300053146 Bacteria 1992
234 Ga0500604_0001428 3300053151 Bacteria 6669
235 Ga0500622_0267894 3300053156 Bacteria 742
236 Ga0500633_0078822 3300053160 Bacteria 1189
237 Ga0500611_050391 3300053727 Bacteria 951
238 Ga0501084_0391712 3300054114 Bacteria 1174
239 Ga0501084_0703418 3300054114 Bacteria 852
240 Ga0501084_0824699 3300054114 Bacteria 781
241 Ga0590071_009661 3300059421 Bacteria 2265
242 Ga0590071_017893 3300059421 Bacteria 1666
243 Ga0501082_0176760 3300060353 Bacteria 1856
244 Ga0501082_0491314 3300060353 Bacteria 1073
245 Ga0501082_0650602 3300060353 Bacteria 922
246 Ga0530510_0051658 3300061734 Bacteria 2971
247 2523105235 2522572158 Bacteria 6514390
248 2821449313 2821443989 Bacteria 7658172
249 2842340117 2842333319 Bacteria 8899485
250 Ga0500616_0182115
251 ARcpr5yngRDRAFT_c018223
252 JGI25151J46595_10001012
253 JGI25153J46596_10000042
254 JGI25153J46596_10000087
255 JGI25153J46596_10025454
256 Ga0065704_10097407
257 Ga0065712_10000800
258 Ga0065715_10008113
259 Ga0065707_10007529
260 Ga0070658_10132747
261 Ga0070683_101391833
262 Ga0070690_100036830
263 Ga0070670_100232406
264 Ga0068869_100184996
265 Ga0068869_100222154
266 Ga0070666_10120445
267 Ga0070675_100008591
268 Ga0070675_100107617
269 Ga0070675_100621246
270 Ga0070675_101515116
271 Ga0070673_100060354
272 Ga0070673_101879731
273 Ga0070659_100351583
274 Ga0070659_100393091
275 Ga0070667_100288457
276 Ga0070714_100562730
277 Ga0070701_10348895
278 Ga0070705_101544191
279 Ga0070708_100164512
280 Ga0070662_100748687
281 Ga0070681_10007956
282 Ga0068867_100221570
283 Ga0068867_100952218
284 Ga0070685_10633937
285 Ga0070707_100809296
286 Ga0070698_100390814
287 Ga0070699_100034822
288 Ga0070697_100478676
289 Ga0070697_101506650
290 Ga0068853_101117411
291 Ga0070686_100454205
292 Ga0070695_100904501
293 Ga0070665_100083614
294 Ga0068855_100657484
295 Ga0068857_100301593
296 Ga0068859_100187117
297 Ga0068859_101137894
298 Ga0068864_100595194
299 Ga0068861_100143663
300 Ga0068861_100707705
301 Ga0068870_10605457
302 Ga0068863_100705592
303 Ga0068862_100005787
304 Ga0070715_10296475
305 Ga0070716_100441729
306 Ga0097621_100083959
307 Ga0068871_100075675
308 Ga0075428_100329293
309 Ga0075428_101456479
310 Ga0075430_100004720
311 Ga0075430_100011515
312 Ga0075430_100038826
313 Ga0075430_100043183
314 Ga0075430_100047569
315 Ga0075430_100334272
316 Ga0075431_100000275
317 Ga0075431_100145487
318 Ga0075433_10002061
319 Ga0075433_10010482
320 Ga0075433_10746527
321 Ga0075434_100000994
322 Ga0075434_100028702
323 Ga0075434_100832441
324 Ga0075429_100004667
325 Ga0075429_100086763
326 Ga0075429_100191884
327 Ga0075436_100026556
328 Ga0097620_100187110
329 Ga0097620_101138136
330 Ga0075435_100010818
331 Ga0105240_11303283
332 Ga0111539_10000056
333 Ga0111539_10031324
334 Ga0111539_10036211
335 Ga0111539_10050159
336 Ga0111539_10075343
337 Ga0111539_10150772
338 Ga0111539_10412349
339 Ga0105245_10316070
340 Ga0114129_10085693
341 Ga0114129_10176847
342 Ga0114129_10314786
343 Ga0114129_10902318
344 Ga0105242_11588541
345 Ga0105242_11603804
346 Ga0105248_11027930
347 Ga0105238_10075194
348 Ga0105249_10642445
349 Ga0157380_10619163
350 Ga0157380_10717878
351 Ga0157377_10317323
352 Ga0213872_10011974
353 Ga0209130_1001492
354 Ga0209675_1015777
355 Ga0209025_1000509
356 Ga0209758_1000110
357 Ga0209758_1004952
358 Ga0207426_1000080
359 Ga0207426_1016714
360 Ga0207685_10458376
361 Ga0207684_10919187
362 Ga0207707_10042377
363 Ga0207695_10993083
364 Ga0207695_11067861
365 Ga0207671_10509457
366 Ga0207660_10250124
367 Ga0207646_10628733
368 Ga0207681_10779880
369 Ga0207681_10858586
370 Ga0207694_10181937
371 Ga0207650_10982902
372 Ga0207659_10035992
373 Ga0207690_10310418
374 Ga0207706_10660187
375 Ga0207670_10688275
376 Ga0207689_10164236
377 Ga0207689_11257267
378 Ga0207679_10044734
379 Ga0207651_10096159
380 Ga0207708_10582165
381 Ga0207641_10136021
382 Ga0207648_10071705
383 Ga0207648_10319194
384 Ga0207676_10816394
385 Ga0207674_10328904
386 Ga0207675_100054101
387 Ga0207675_100492220
388 Ga0207683_10139570
389 Ga0209970_1036635
390 Ga0209966_1076856
391 Ga0207428_10002483
392 Ga0207428_10073661
393 Ga0268266_10000520
394 Ga0268266_10591413
395 Ga0268265_10006506
396 Ga0268264_10501384
397 Ga0265318_10085384
398 Ga0307512_10278615
399 Ga0307416_100378360
400 Ga0316583_10185437
401 Ga0242420_035201
402 Ga0436360_0912806
403 Ga0436361_0012467
404 Ga0436361_0012669
405 Ga0451853_0658236
406 Ga0439435_0037239
407 Ga0453683_0472729
408 Ga0453684_0115871
409 Ga0451576_0152421
410 Ga0451576_0163085
411 Ga0495663_0189327
412 Ga0495621_0041803
413 Ga0495621_0235812
414 Ga0496109_0933865
415 Ga0496126_0706698
416 Ga0495682_0072134
417 Ga0501298_134462
418 Ga0501038_0185787
419 Ga0501042_0071410
420 Ga0501043_0547172
421 Ga0501046_0398102
422 Ga0501047_0005930
423 Ga0501047_0309629
424 Ga0501047_0380153
425 Ga0501048_0244230
426 Ga0501068_0014455
427 Ga0501070_0131091
428 Ga0501070_0222357
429 Ga0501072_0103645
430 Ga0501073_0002564
431 Ga0501073_0052968
432 Ga0501073_0211264
433 Ga0501074_0051932
434 Ga0501074_0267697
435 Ga0501075_0361930
436 Ga0501075_0868051
437 Ga0501076_0013353
438 Ga0501076_1192598
439 Ga0501079_0013121
440 Ga0501080_0012127
441 Ga0501080_0159097
442 Ga0501083_0043841
443 Ga0501083_0303031
444 Ga0501044_0015288
445 Ga0501044_0088304
446 nmdc:mga05p37_28714_c1
447 nmdc:mga05p37_492572_c1
448 nmdc:mga05p37_868403_c1
449 nmdc:mga09592_35327_c1
450 nmdc:mga09592_58209_c1
451 nmdc:mga0qj67_14098_c1
452 nmdc:mga0qj67_28336_c1
453 nmdc:mga0qj67_31825_c1
454 nmdc:mga0qj67_352083_c1
455 nmdc:mga0qj67_436353_c1
456 nmdc:mga0qj67_722118_c1
457 nmdc:mga0qj67_88657_c1
458 nmdc:mga06r32_330157_c1
459 nmdc:mga06r32_441446_c1
460 nmdc:mga06r32_4607_c1
461 nmdc:mga08y16_1311_c1
462 nmdc:mga08y16_34880_c1
463 nmdc:mga08y16_44849_c1
464 nmdc:mga08y16_66286_c1
465 nmdc:mga08y16_72739_c1
466 nmdc:mga0n895_270585_c1
467 nmdc:mga0n895_423152_c1
468 nmdc:mga0n895_5357_c1
469 nmdc:mga0n895_873_c1
470 nmdc:mga0rr50_13904_c1
471 nmdc:mga0rr50_371400_c1
472 nmdc:mga08x19_20724_c1
473 nmdc:mga08x19_415242_c1
474 nmdc:mga0a205_14834_c1
475 nmdc:mga0a205_8463_c1
476 Ga0500646_0015605
477 Ga0500647_0246876
478 Ga0500594_0010820
479 Ga0500595_093413
480 Ga0500568_0026445
481 Ga0500577_0125007
482 Ga0500588_0014638
483 Ga0500604_0001428
484 Ga0500622_0267894
485 Ga0500633_0078822
486 Ga0500611_050391
487 Ga0501084_0391712
488 Ga0501084_0703418
489 Ga0501084_0824699
490 Ga0590071_009661
491 Ga0590071_017893
492 Ga0501082_0176760
493 Ga0501082_0491314
494 Ga0501082_0650602
495 Ga0530510_0051658
496 2523105235
497 2821449313
498 2842340117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

44

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9526 3 160
4x44-assembly1.cif.gz_A-2 crystal structure of mutant r89q of human adenine phosphoribosyltransferase 0.9438 3 160
4mb6-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from yersinia pseudotuberculosis. 0.9436 3 160
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9419 2 160
6fci-assembly1.cif.gz_A crystal structure of human aprt wild type in complex with adenine, prpp and mg2+ 0.9419 3 160
ID Description Score Start End Superfamily
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9539 3 160 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9366 3 160 3.40.50.2020
1l1rA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9285 2 160 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9265 3 160 3.40.50.2020
af_A0A1D6HD26_34_217_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9257 3 160 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A402BXR6-F1-model_v4 Adenine phosphoribosyltransferase 0.9796 28 104 GO:0003999
GO:0005737
GO:0006166
AF-A0A535E6K3-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9783 1 160 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-X1U4I4-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9781 1 104 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-X1BDQ0-F1-model_v4 Adenine phosphoribosyltransferase 0.9773 1 74 GO:0003999
GO:0005737
GO:0006166
AF-A0A2E3RU79-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.976 3 160 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map