F360269

General Info

Members Datasets Scaffolds Average Seq Length
248 188 496 199

Family's Representative Sequence

Representative Sequence 3300049763|Ga0501266_017287|Ga0501266_017287_185_856
Length 223
Sequence LTNKRWSRFLLKNLFMPDFIYLASQSPRRRQLLEQLGVRHELLLPNTDGDIAEDAEAIEAVLPDESPDAYVTRVTALKLDAAVARCARRGLPPAPILCSDTTVALGATIYGKPDDAAHAERMLAELSGQTHRVLTAVALQLGTGLGSQRLQALSVSEVTFAALTPAQITAYVATGEPLGKAGAYGIQGAAAAFIPVLHGSYSGIMGLPMFETAQLLRSAGFAV

Samples

Sample ID Description Type Environment
1 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
134 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
135 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
142 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
174 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
177 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2547132374 Acidovorax radicis N35 Isolate Unclassified
180 2643221570 Acidovorax sp. Root568 Isolate Unclassified
181 2643221596 Acidovorax sp. Root70 Isolate Unclassified
182 2643221652 Acidovorax sp. Root402 Isolate Unclassified
183 2643221717 Acidovorax sp. Root267 Isolate Unclassified
184 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
185 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
186 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
187 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
188 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.97
Metatranscriptomes 0
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 0.4
Rhizoplane 4.44
Rhizosphere 80.24
Stem 0
Stem Tuber 0
Unclassified 4.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501266_017287 3300049763 Bacteria 963
2 rootL2_10037916 3300003322 Bacteria 2475
3 Ga0065707_10084801 3300005295 Bacteria 6768
4 Ga0070676_10064792 3300005328 Bacteria 2180
5 Ga0070676_10092895 3300005328 Unclassified 1851
6 Ga0070683_100096595 3300005329 Bacteria 2779
7 Ga0070670_100106719 3300005331 Bacteria 2413
8 Ga0070670_100793654 3300005331 Bacteria 855
9 Ga0070677_10000882 3300005333 Bacteria 9880
10 Ga0070677_10008014 3300005333 Bacteria 3540
11 Ga0068869_100236513 3300005334 Bacteria 1453
12 Ga0068869_100370889 3300005334 Bacteria 1171
13 Ga0070682_100035446 3300005337 Bacteria 3046
14 Ga0070682_100112027 3300005337 Bacteria 1820
15 Ga0070689_100184372 3300005340 Bacteria 1697
16 Ga0070668_100177821 3300005347 Bacteria 1736
17 Ga0070675_100002552 3300005354 Bacteria 13626
18 Ga0070675_100210831 3300005354 Bacteria 1688
19 Ga0070674_100113010 3300005356 Bacteria 1997
20 Ga0070673_100043834 3300005364 Bacteria 3460
21 Ga0070673_100218113 3300005364 Bacteria 1650
22 Ga0070688_100156091 3300005365 Bacteria 1564
23 Ga0070700_100105508 3300005441 Bacteria 1863
24 Ga0070700_100175110 3300005441 Bacteria 1488
25 Ga0070678_100045296 3300005456 Bacteria 3146
26 Ga0068867_100086519 3300005459 Bacteria 2371
27 Ga0070685_10036299 3300005466 Bacteria 2786
28 Ga0070685_10045359 3300005466 Bacteria 2521
29 Ga0070685_10107675 3300005466 Bacteria 1712
30 Ga0070685_10353540 3300005466 Bacteria 1005
31 Ga0070684_100067347 3300005535 Bacteria 3145
32 Ga0070672_100004762 3300005543 Bacteria 8901
33 Ga0070686_100630002 3300005544 Bacteria 848
34 Ga0070665_100001700 3300005548 Bacteria 25288
35 Ga0068855_100038003 3300005563 Bacteria 5722
36 Ga0068852_100738195 3300005616 Bacteria 996
37 Ga0068864_100244749 3300005618 Bacteria 1663
38 Ga0068864_100629472 3300005618 Bacteria 1043
39 Ga0068864_101423339 3300005618 Bacteria 695
40 Ga0068861_100021551 3300005719 Bacteria 4632
41 Ga0068861_100150063 3300005719 Bacteria 1911
42 Ga0068861_100670798 3300005719 Bacteria 960
43 Ga0068870_10004143 3300005840 Bacteria 6212
44 Ga0068863_100259577 3300005841 Bacteria 1679
45 Ga0068858_101237472 3300005842 Bacteria 734
46 Ga0068860_100979638 3300005843 Unclassified 863
47 Ga0068860_101039388 3300005843 Bacteria 838
48 Ga0068862_100012253 3300005844 Bacteria 7089
49 Ga0068862_100112896 3300005844 Bacteria 2387
50 Ga0068862_100176627 3300005844 Bacteria 1915
51 Ga0081539_10000011 3300005985 Bacteria 461887
52 Ga0075364_10128916 3300006051 Bacteria 1697
53 Ga0070715_10170035 3300006163 Bacteria 1085
54 Ga0075366_10003897 3300006195 Bacteria 7954
55 Ga0097621_100333286 3300006237 Bacteria 1346
56 Ga0097621_100455949 3300006237 Unclassified 1152
57 Ga0097621_100593755 3300006237 Bacteria 1011
58 Ga0068871_100471844 3300006358 Bacteria 1127
59 Ga0075428_100286422 3300006844 Bacteria 1772
60 Ga0075430_100032212 3300006846 Bacteria 4451
61 Ga0068865_100245826 3300006881 Bacteria 1410
62 Ga0068865_100930150 3300006881 Unclassified 758
63 Ga0099795_10050751 3300007788 Bacteria 1510
64 Ga0105240_10019698 3300009093 Bacteria 9011
65 Ga0105240_10106716 3300009093 Bacteria 3396
66 Ga0105240_10398577 3300009093 Bacteria 1550
67 Ga0111539_10566004 3300009094 Bacteria 1324
68 Ga0105243_10176603 3300009148 Bacteria 1854
69 Ga0105242_10020234 3300009176 Bacteria 5217
70 Ga0105248_10091382 3300009177 Bacteria 3428
71 Ga0105237_10835196 3300009545 Bacteria 928
72 Ga0105238_10571225 3300009551 Bacteria 1136
73 Ga0105238_10621166 3300009551 Bacteria 1089
74 Ga0105249_10388763 3300009553 Bacteria 1423
75 Ga0105239_10114575 3300010375 Bacteria 2990
76 Ga0163162_10073525 3300013306 Bacteria 3474
77 Ga0157375_11690135 3300013308 Unclassified 749
78 Ga0163163_10681518 3300014325 Bacteria 1091
79 Ga0163163_11727575 3300014325 Bacteria 686
80 Ga0157380_10004397 3300014326 Bacteria 9772
81 Ga0157380_10147820 3300014326 Bacteria 2027
82 Ga0157380_10285669 3300014326 Bacteria 1512
83 Ga0157379_10015264 3300014968 Bacteria 6737
84 Ga0157379_10049284 3300014968 Unclassified 3760
85 Ga0157376_10105547 3300014969 Bacteria 2470
86 Ga0157376_10388886 3300014969 Bacteria 1345
87 Ga0157376_10408184 3300014969 Unclassified 1315
88 Ga0163161_10031003 3300017792 Bacteria 3808
89 Ga0163161_10683182 3300017792 Bacteria 853
90 Ga0213872_10001418 3300021361 Bacteria 15732
91 Ga0213874_10020364 3300021377 Bacteria 1818
92 Ga0213876_10122893 3300021384 Bacteria 1379
93 Ga0207697_10273262 3300025315 Bacteria 749
94 Ga0207682_10004391 3300025893 Bacteria 5906
95 Ga0207682_10016476 3300025893 Bacteria 2883
96 Ga0207685_10153019 3300025905 Bacteria 1046
97 Ga0207645_10016268 3300025907 Bacteria 4926
98 Ga0207643_10000860 3300025908 Bacteria 18331
99 Ga0207707_10053698 3300025912 Bacteria 3508
100 Ga0207695_10027473 3300025913 Bacteria 6336
101 Ga0207695_10136807 3300025913 Bacteria 2402
102 Ga0207695_11009743 3300025913 Unclassified 712
103 Ga0207671_10019736 3300025914 Bacteria 5146
104 Ga0207660_10088530 3300025917 Bacteria 2290
105 Ga0207662_10144386 3300025918 Bacteria 1509
106 Ga0207694_10509914 3300025924 Bacteria 1008
107 Ga0207650_10191763 3300025925 Bacteria 1633
108 Ga0207650_10315252 3300025925 Bacteria 1280
109 Ga0207659_10033515 3300025926 Bacteria 3535
110 Ga0207659_10239073 3300025926 Bacteria 1468
111 Ga0207690_10556038 3300025932 Bacteria 933
112 Ga0207686_10017526 3300025934 Bacteria 4038
113 Ga0207665_10556781 3300025939 Bacteria 891
114 Ga0207691_10008321 3300025940 Bacteria 9963
115 Ga0207691_10017514 3300025940 Bacteria 6792
116 Ga0207691_10608647 3300025940 Bacteria 925
117 Ga0207711_10105625 3300025941 Bacteria 2498
118 Ga0207689_10260179 3300025942 Bacteria 1435
119 Ga0207667_10005460 3300025949 Bacteria 15495
120 Ga0207651_10167224 3300025960 Bacteria 1730
121 Ga0207668_10370774 3300025972 Bacteria 1202
122 Ga0207658_10363617 3300025986 Bacteria 1263
123 Ga0207677_10113207 3300026023 Bacteria 2025
124 Ga0207639_10204234 3300026041 Bacteria 1697
125 Ga0207708_10112741 3300026075 Bacteria 2112
126 Ga0207708_10412685 3300026075 Bacteria 1118
127 Ga0207641_10221813 3300026088 Bacteria 1753
128 Ga0207648_10057700 3300026089 Bacteria 3387
129 Ga0207648_10227709 3300026089 Bacteria 1658
130 Ga0207676_10341841 3300026095 Bacteria 1381
131 Ga0207675_100096885 3300026118 Bacteria 2777
132 Ga0207675_100667835 3300026118 Bacteria 1046
133 Ga0207683_10039541 3300026121 Bacteria 4115
134 Ga0207698_10811003 3300026142 Bacteria 939
135 Ga0209983_1043004 3300027665 Bacteria 980
136 Ga0209971_1018893 3300027682 Bacteria 1637
137 Ga0209974_10005579 3300027876 Bacteria 4421
138 Ga0209974_10012127 3300027876 Bacteria 2885
139 Ga0268266_10001105 3300028379 Bacteria 33805
140 Ga0268266_10052128 3300028379 Bacteria 3513
141 Ga0268265_10111322 3300028380 Bacteria 2236
142 Ga0268264_10333437 3300028381 Bacteria 1438
143 Ga0268264_11022843 3300028381 Bacteria 833
144 Ga0265330_10000099 3300031235 Bacteria 72344
145 Ga0265332_10000002 3300031238 Bacteria 709510
146 Ga0265340_10005843 3300031247 Bacteria 6811
147 Ga0265331_10005754 3300031250 Bacteria 7427
148 Ga0307513_10031961 3300031456 Bacteria 5947
149 Ga0307513_10083187 3300031456 Bacteria 3292
150 Ga0307513_10444747 3300031456 Unclassified 1022
151 Ga0307509_10150855 3300031507 Bacteria 2240
152 Ga0307509_10279187 3300031507 Bacteria 1433
153 Ga0307408_100000193 3300031548 Bacteria 65882
154 Ga0307514_10013325 3300031649 Bacteria 6822
155 Ga0307514_10082596 3300031649 Bacteria 2371
156 Ga0265314_10000089 3300031711 Bacteria 138050
157 Ga0307413_10116265 3300031824 Bacteria 1801
158 Ga0307410_10062795 3300031852 Bacteria 2546
159 Ga0307410_11061051 3300031852 Bacteria 701
160 Ga0307406_10016378 3300031901 Bacteria 4307
161 Ga0307407_10009161 3300031903 Bacteria 4594
162 Ga0307409_100011100 3300031995 Bacteria 5654
163 Ga0307416_100058693 3300032002 Bacteria 3122
164 Ga0307414_10000812 3300032004 Bacteria 15935
165 Ga0307411_10339482 3300032005 Bacteria 1220
166 Ga0307411_10747662 3300032005 Bacteria 856
167 Ga0373934_0119207 3300035086 Bacteria 1073
168 Ga0316574_0123701 3300035398 Bacteria 1662
169 Ga0373931_0208703 3300035691 Bacteria 1170
170 Ga0373937_0013365 3300036401 Bacteria 7233
171 Ga0316582_0021137 3300036647 Bacteria 3838
172 Ga0316584_0068815 3300036712 Bacteria 2654
173 Ga0395900_0000054 3300037418 Bacteria 220487
174 Ga0395900_0794833 3300037418 Bacteria 874
175 Ga0395898_0000798 3300037466 Bacteria 53358
176 Ga0395905_0043500 3300037471 Bacteria 4213
177 Ga0400483_267332 3300039062 Bacteria 16959
178 Ga0400489_29380 3300039093 Bacteria 3157
179 Ga0436365_0910866 3300039437 Bacteria 1890
180 Ga0436361_0704832 3300039447 Bacteria 27869
181 Ga0439436_0094323 3300041404 Bacteria 833
182 Ga0451791_1051307 3300041451 Bacteria 1798
183 Ga0451793_0659953 3300041452 Bacteria 804
184 Ga0451797_0698972 3300041453 Bacteria 1134
185 Ga0451795_1284766 3300041456 Bacteria 722
186 Ga0451798_0777596 3300041458 Bacteria 822
187 Ga0451802_1542278 3300041460 Bacteria 1348
188 Ga0451802_1976377 3300041460 Bacteria 1865
189 Ga0451807_0153777 3300041486 Bacteria 7322
190 Ga0451807_1840129 3300041486 Bacteria 3355
191 Ga0451837_0192360 3300041494 Bacteria 3343
192 Ga0451837_0798487 3300041494 Bacteria 2502
193 Ga0451853_3940681 3300041512 Bacteria 2025
194 Ga0439450_062069 3300042008 Bacteria 905
195 Ga0450909_020182 3300042185 Bacteria 992
196 Ga0450918_008875 3300042531 Bacteria 1765
197 Ga0453683_0002845 3300044673 Bacteria 13126
198 Ga0451576_0146107 3300045051 Bacteria 2465
199 Ga0495590_0045226 3300046457 Unclassified 1535
200 Ga0495638_0017921 3300046460 Bacteria 4713
201 Ga0495638_0078077 3300046460 Bacteria 2015
202 Ga0495580_0022270 3300046472 Bacteria 4665
203 Ga0495582_0280873 3300046473 Unclassified 956
204 Ga0495616_0010401 3300046513 Bacteria 5387
205 Ga0495642_0209637 3300046528 Unclassified 850
206 Ga0495656_0045269 3300046615 Bacteria 1857
207 Ga0495668_0015365 3300046616 Bacteria 4472
208 Ga0495611_0162743 3300046648 Bacteria 1043
209 Ga0495625_0030286 3300046660 Bacteria 4040
210 Ga0495671_0008905 3300046692 Bacteria 5637
211 Ga0495649_0005153 3300046694 Bacteria 8383
212 Ga0495686_0027602 3300047472 Bacteria 3705
213 Ga0495686_0221672 3300047472 Bacteria 1075
214 Ga0495602_0113101 3300048088 Bacteria 2201
215 Ga0496108_0364269 3300048911 Bacteria 1262
216 Ga0496108_1012080 3300048911 Bacteria 709
217 Ga0496126_0004870 3300048929 Bacteria 15724
218 Ga0496126_0518073 3300048929 Bacteria 951
219 Ga0501042_0082561 3300049578 Bacteria 2304
220 Ga0501042_0229333 3300049578 Bacteria 1340
221 Ga0501067_0312048 3300049583 Bacteria 876
222 Ga0501073_0239022 3300049589 Bacteria 1254
223 Ga0501076_0268126 3300049592 Bacteria 1398
224 Ga0501080_0575267 3300049742 Bacteria 1002
225 nmdc:mga00v17_129815_c1 3300050491 Bacteria 1610
226 nmdc:mga0k408_3061_c2 3300050493 Bacteria 8370
227 nmdc:mga09592_175160_c1 3300050508 Bacteria 1855
228 nmdc:mga0qj67_26249_c1 3300050509 Bacteria 4508
229 Ga0495612_0236055 3300053078 Bacteria 812
230 Ga0500646_0116826 3300053090 Bacteria 854
231 Ga0500651_0328958 3300053093 Bacteria 871
232 Ga0500556_0000313 3300053104 Bacteria 36728
233 Ga0500556_0187719 3300053104 Bacteria 817
234 Ga0500617_066273 3300053124 Bacteria 1590
235 Ga0500642_0091303 3300053130 Bacteria 1408
236 Ga0500637_0067752 3300053178 Bacteria 2051
237 Ga0500656_010977 3300053732 Bacteria 1000
238 Ga0530510_0168965 3300061734 Bacteria 1620
239 2548497416 2547132374 Bacteria 5530232
240 2643866550 2643221570 Bacteria 5103772
241 2643993302 2643221596 Bacteria 5006805
242 2644294093 2643221652 Bacteria 5140275
243 2644646096 2643221717 Bacteria 5676132
244 2842719552 2842718218 Bacteria 4560148
245 2894025503 2894023352 Bacteria 5167372
246 2945977179 2945972063 Bacteria 6086495
247 2974323388 2974320154 Bacteria 4571377
248 2990712264 2990710928 Bacteria 5002431
249 Ga0501266_017287
250 rootL2_10037916
251 Ga0065707_10084801
252 Ga0070676_10064792
253 Ga0070676_10092895
254 Ga0070683_100096595
255 Ga0070670_100106719
256 Ga0070670_100793654
257 Ga0070677_10000882
258 Ga0070677_10008014
259 Ga0068869_100236513
260 Ga0068869_100370889
261 Ga0070682_100035446
262 Ga0070682_100112027
263 Ga0070689_100184372
264 Ga0070668_100177821
265 Ga0070675_100002552
266 Ga0070675_100210831
267 Ga0070674_100113010
268 Ga0070673_100043834
269 Ga0070673_100218113
270 Ga0070688_100156091
271 Ga0070700_100105508
272 Ga0070700_100175110
273 Ga0070678_100045296
274 Ga0068867_100086519
275 Ga0070685_10036299
276 Ga0070685_10045359
277 Ga0070685_10107675
278 Ga0070685_10353540
279 Ga0070684_100067347
280 Ga0070672_100004762
281 Ga0070686_100630002
282 Ga0070665_100001700
283 Ga0068855_100038003
284 Ga0068852_100738195
285 Ga0068864_100244749
286 Ga0068864_100629472
287 Ga0068864_101423339
288 Ga0068861_100021551
289 Ga0068861_100150063
290 Ga0068861_100670798
291 Ga0068870_10004143
292 Ga0068863_100259577
293 Ga0068858_101237472
294 Ga0068860_100979638
295 Ga0068860_101039388
296 Ga0068862_100012253
297 Ga0068862_100112896
298 Ga0068862_100176627
299 Ga0081539_10000011
300 Ga0075364_10128916
301 Ga0070715_10170035
302 Ga0075366_10003897
303 Ga0097621_100333286
304 Ga0097621_100455949
305 Ga0097621_100593755
306 Ga0068871_100471844
307 Ga0075428_100286422
308 Ga0075430_100032212
309 Ga0068865_100245826
310 Ga0068865_100930150
311 Ga0099795_10050751
312 Ga0105240_10019698
313 Ga0105240_10106716
314 Ga0105240_10398577
315 Ga0111539_10566004
316 Ga0105243_10176603
317 Ga0105242_10020234
318 Ga0105248_10091382
319 Ga0105237_10835196
320 Ga0105238_10571225
321 Ga0105238_10621166
322 Ga0105249_10388763
323 Ga0105239_10114575
324 Ga0163162_10073525
325 Ga0157375_11690135
326 Ga0163163_10681518
327 Ga0163163_11727575
328 Ga0157380_10004397
329 Ga0157380_10147820
330 Ga0157380_10285669
331 Ga0157379_10015264
332 Ga0157379_10049284
333 Ga0157376_10105547
334 Ga0157376_10388886
335 Ga0157376_10408184
336 Ga0163161_10031003
337 Ga0163161_10683182
338 Ga0213872_10001418
339 Ga0213874_10020364
340 Ga0213876_10122893
341 Ga0207697_10273262
342 Ga0207682_10004391
343 Ga0207682_10016476
344 Ga0207685_10153019
345 Ga0207645_10016268
346 Ga0207643_10000860
347 Ga0207707_10053698
348 Ga0207695_10027473
349 Ga0207695_10136807
350 Ga0207695_11009743
351 Ga0207671_10019736
352 Ga0207660_10088530
353 Ga0207662_10144386
354 Ga0207694_10509914
355 Ga0207650_10191763
356 Ga0207650_10315252
357 Ga0207659_10033515
358 Ga0207659_10239073
359 Ga0207690_10556038
360 Ga0207686_10017526
361 Ga0207665_10556781
362 Ga0207691_10008321
363 Ga0207691_10017514
364 Ga0207691_10608647
365 Ga0207711_10105625
366 Ga0207689_10260179
367 Ga0207667_10005460
368 Ga0207651_10167224
369 Ga0207668_10370774
370 Ga0207658_10363617
371 Ga0207677_10113207
372 Ga0207639_10204234
373 Ga0207708_10112741
374 Ga0207708_10412685
375 Ga0207641_10221813
376 Ga0207648_10057700
377 Ga0207648_10227709
378 Ga0207676_10341841
379 Ga0207675_100096885
380 Ga0207675_100667835
381 Ga0207683_10039541
382 Ga0207698_10811003
383 Ga0209983_1043004
384 Ga0209971_1018893
385 Ga0209974_10005579
386 Ga0209974_10012127
387 Ga0268266_10001105
388 Ga0268266_10052128
389 Ga0268265_10111322
390 Ga0268264_10333437
391 Ga0268264_11022843
392 Ga0265330_10000099
393 Ga0265332_10000002
394 Ga0265340_10005843
395 Ga0265331_10005754
396 Ga0307513_10031961
397 Ga0307513_10083187
398 Ga0307513_10444747
399 Ga0307509_10150855
400 Ga0307509_10279187
401 Ga0307408_100000193
402 Ga0307514_10013325
403 Ga0307514_10082596
404 Ga0265314_10000089
405 Ga0307413_10116265
406 Ga0307410_10062795
407 Ga0307410_11061051
408 Ga0307406_10016378
409 Ga0307407_10009161
410 Ga0307409_100011100
411 Ga0307416_100058693
412 Ga0307414_10000812
413 Ga0307411_10339482
414 Ga0307411_10747662
415 Ga0373934_0119207
416 Ga0316574_0123701
417 Ga0373931_0208703
418 Ga0373937_0013365
419 Ga0316582_0021137
420 Ga0316584_0068815
421 Ga0395900_0000054
422 Ga0395900_0794833
423 Ga0395898_0000798
424 Ga0395905_0043500
425 Ga0400483_267332
426 Ga0400489_29380
427 Ga0436365_0910866
428 Ga0436361_0704832
429 Ga0439436_0094323
430 Ga0451791_1051307
431 Ga0451793_0659953
432 Ga0451797_0698972
433 Ga0451795_1284766
434 Ga0451798_0777596
435 Ga0451802_1542278
436 Ga0451802_1976377
437 Ga0451807_0153777
438 Ga0451807_1840129
439 Ga0451837_0192360
440 Ga0451837_0798487
441 Ga0451853_3940681
442 Ga0439450_062069
443 Ga0450909_020182
444 Ga0450918_008875
445 Ga0453683_0002845
446 Ga0451576_0146107
447 Ga0495590_0045226
448 Ga0495638_0017921
449 Ga0495638_0078077
450 Ga0495580_0022270
451 Ga0495582_0280873
452 Ga0495616_0010401
453 Ga0495642_0209637
454 Ga0495656_0045269
455 Ga0495668_0015365
456 Ga0495611_0162743
457 Ga0495625_0030286
458 Ga0495671_0008905
459 Ga0495649_0005153
460 Ga0495686_0027602
461 Ga0495686_0221672
462 Ga0495602_0113101
463 Ga0496108_0364269
464 Ga0496108_1012080
465 Ga0496126_0004870
466 Ga0496126_0518073
467 Ga0501042_0082561
468 Ga0501042_0229333
469 Ga0501067_0312048
470 Ga0501073_0239022
471 Ga0501076_0268126
472 Ga0501080_0575267
473 nmdc:mga00v17_129815_c1
474 nmdc:mga0k408_3061_c2
475 nmdc:mga09592_175160_c1
476 nmdc:mga0qj67_26249_c1
477 Ga0495612_0236055
478 Ga0500646_0116826
479 Ga0500651_0328958
480 Ga0500556_0000313
481 Ga0500556_0187719
482 Ga0500617_066273
483 Ga0500642_0091303
484 Ga0500637_0067752
485 Ga0500656_010977
486 Ga0530510_0168965
487 2548497416
488 2643866550
489 2643993302
490 2644294093
491 2644646096
492 2842719552
493 2894025503
494 2945977179
495 2974323388
496 2990712264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

19

219

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p0e-assembly1.cif.gz_A yhde e33a (p212121 space group) 0.9764 10 192
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9705 9 190
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.969 8 190
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9633 8 194
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9582 8 194
ID Description Score Start End Superfamily
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9705 9 190 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9657 11 192 3.90.950.10
af_Q86BM0_10_204_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9556 9 192 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9549 9 190 3.90.950.10
af_Q8IEH6_20_257_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9512 11 191 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A349TN85-F1-model_v4 Septum formation protein Maf 0.991 11 190 GO:0009117
GO:0047429
AF-A0A1F2VPB3-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9878 12 190 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379
AF-A0A2T5MJ87-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9871 9 196 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379
AF-A0A3D5XJH1-F1-model_v4 deleted 0.9867 34 166
AF-A0A7C7SIJ7-F1-model_v4 Maf-like protein 0.9851 11 118 GO:0047429

Map