F360074

General Info

Members Datasets Scaffolds Average Seq Length
248 185 238 158

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1655368|Ga0436365_1655368_23_541
Length 172
Sequence MEMRRALDWKRQGLAMAKNTICIWYDKDAEAAARFYAETFPDSAVSAVNRAPGDYPSGKAGDVLTVEFTVAGVACLGLNGGPMFKHSEAFSFQISTEDQEETDRYWNAIVGNGGQASACGWCKDKWGISWQITPRVLMEALRAGGAEAKRAFEAMMGMTKIDVAAIIAARRG

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2643221610 Ensifer sp. Root74 Isolate Unclassified
3 2643221668 Ensifer sp. Root423 Isolate Unclassified
4 2643221675 Ensifer sp. Root1298 Isolate Unclassified
5 2643221680 Ensifer sp. Root1312 Isolate Unclassified
6 2643221726 Ensifer sp. Root954 Isolate Unclassified
7 2738543024 Aminobacter sp. AP02 Isolate Unclassified
8 2765235841 Pseudomonas putida AA7 Isolate Unclassified
9 2791355265 Rhizobium sp. H4 Isolate Nodule
10 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
11 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
67 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.76
Metatranscriptomes 1.21
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 0.81
Rhizoplane 0.81
Rhizosphere 75.4
Stem 0
Stem Tuber 0
Unclassified 18.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000113 3300002704 Bacteria 42079
2 JGI25156J39149_1000198 3300002705 Bacteria 42079
3 JGI25154J39366_1000209 3300002738 Bacteria 41899
4 JGI25157J39369_1000240 3300002741 Bacteria 42079
5 rootL2_10154862 3300003322 Bacteria 6058
6 JGI25404J52841_10006796 3300003659 Bacteria 2402
7 Ga0055539_1007105 3300003752 Bacteria 1421
8 Ga0055524_1000377 3300003775 Bacteria 38923
9 Ga0065704_10295971 3300005289 Bacteria 894
10 Ga0070658_10026608 3300005327 Bacteria 4641
11 Ga0070658_11107088 3300005327 Bacteria 689
12 Ga0070683_100045939 3300005329 Bacteria 4032
13 Ga0070683_100098556 3300005329 Bacteria 2751
14 Ga0070680_100520042 3300005336 Bacteria 1019
15 Ga0070682_100427857 3300005337 Bacteria 1008
16 Ga0070689_100587306 3300005340 Bacteria 963
17 Ga0070671_100223116 3300005355 Bacteria 1599
18 Ga0070709_10004622 3300005434 Bacteria 7434
19 Ga0070714_100003003 3300005435 Bacteria 12511
20 Ga0070713_100042139 3300005436 Bacteria 3724
21 Ga0070710_10002230 3300005437 Bacteria 9159
22 Ga0070711_100025527 3300005439 Bacteria 3867
23 Ga0070681_10119636 3300005458 Bacteria 2570
24 Ga0070684_100007593 3300005535 Bacteria 8449
25 Ga0068853_100714120 3300005539 Bacteria 957
26 Ga0070696_100224186 3300005546 Bacteria 1412
27 Ga0070665_100142334 3300005548 Bacteria 2401
28 Ga0070665_101266930 3300005548 Bacteria 747
29 Ga0068855_100255047 3300005563 Bacteria 1956
30 Ga0068855_100421067 3300005563 Bacteria 1461
31 Ga0070664_100316690 3300005564 Bacteria 1413
32 Ga0068857_100263999 3300005577 Bacteria 1581
33 Ga0068854_100845733 3300005578 Bacteria 801
34 Ga0068856_100255117 3300005614 Bacteria 1769
35 Ga0068859_100334545 3300005617 Bacteria 1608
36 Ga0068858_101761822 3300005842 Bacteria 612
37 Ga0081455_10000431 3300005937 Bacteria 55069
38 Ga0081540_1001417 3300005983 Bacteria 20744
39 Ga0081540_1002136 3300005983 Bacteria 16449
40 Ga0081540_1019939 3300005983 Bacteria 4053
41 Ga0070717_10205935 3300006028 Bacteria 1725
42 Ga0070717_10615041 3300006028 Bacteria 986
43 Ga0075363_100129923 3300006048 Bacteria 1412
44 Ga0070715_10037194 3300006163 Bacteria 2013
45 Ga0070716_100012768 3300006173 Bacteria 4266
46 Ga0070716_100037474 3300006173 Bacteria 2680
47 Ga0070712_100031211 3300006175 Bacteria 3588
48 Ga0070712_100151177 3300006175 Bacteria 1783
49 Ga0075367_10174958 3300006178 Bacteria 1337
50 Ga0097621_101358655 3300006237 Bacteria 672
51 Ga0068871_101427997 3300006358 Bacteria 653
52 Ga0097620_100262079 3300006931 Bacteria 1820
53 Ga0097620_100334553 3300006931 Bacteria 1608
54 Ga0105240_10182260 3300009093 Bacteria 2477
55 Ga0105240_10397817 3300009093 Bacteria 1552
56 Ga0105247_10070068 3300009101 Bacteria 2190
57 Ga0105238_10090676 3300009551 Bacteria 3044
58 Ga0105249_11760242 3300009553 Bacteria 692
59 Ga0157373_10094205 3300013100 Bacteria 2109
60 Ga0157371_10191265 3300013102 Bacteria 1465
61 Ga0157370_10313323 3300013104 Bacteria 1448
62 Ga0157370_10591066 3300013104 Bacteria 1017
63 Ga0157370_10711095 3300013104 Bacteria 917
64 Ga0157369_10024228 3300013105 Bacteria 6755
65 Ga0157369_10056517 3300013105 Bacteria 4235
66 Ga0157372_10035057 3300013307 Bacteria 5521
67 Ga0157375_11340312 3300013308 Bacteria 842
68 Ga0157380_10273531 3300014326 Bacteria 1541
69 Ga0157377_10163932 3300014745 Bacteria 1384
70 Ga0183365_10002 3300015684 Bacteria 545891
71 Ga0206349_1383225 3300020075 Bacteria 651
72 Ga0206352_10285815 3300020078 Bacteria 527
73 Ga0206353_10468945 3300020082 Bacteria 865
74 Ga0213876_10080681 3300021384 Bacteria 1720
75 Ga0213876_10114382 3300021384 Bacteria 1432
76 Ga0213875_10000085 3300021388 Bacteria 108455
77 Ga0209435_100091 3300025206 Bacteria 41951
78 Ga0209646_1000295 3300025246 Bacteria 41951
79 Ga0209026_1000366 3300025250 Bacteria 41951
80 Ga0209677_101028 3300025253 Bacteria 13312
81 Ga0209759_1000513 3300025256 Bacteria 41951
82 Ga0209233_1001723 3300025261 Bacteria 8456
83 Ga0209455_1009152 3300025272 Bacteria 2623
84 Ga0209025_1068367 3300025294 Bacteria 1277
85 Ga0209256_1000073 3300025299 Bacteria 237553
86 Ga0207692_10009279 3300025898 Bacteria 4102
87 Ga0207710_10061915 3300025900 Bacteria 1699
88 Ga0207699_10005319 3300025906 Bacteria 6166
89 Ga0207705_10072707 3300025909 Bacteria 2495
90 Ga0207705_10692873 3300025909 Bacteria 792
91 Ga0207695_10197929 3300025913 Bacteria 1925
92 Ga0207695_10352129 3300025913 Bacteria 1359
93 Ga0207695_10621222 3300025913 Bacteria 962
94 Ga0207671_10949039 3300025914 Bacteria 679
95 Ga0207693_10018282 3300025915 Bacteria 5585
96 Ga0207693_10019254 3300025915 Bacteria 5431
97 Ga0207663_10004356 3300025916 Bacteria 7028
98 Ga0207694_10132791 3300025924 Bacteria 1996
99 Ga0207700_10019023 3300025928 Bacteria 4631
100 Ga0207700_10386400 3300025928 Bacteria 1225
101 Ga0207664_10007739 3300025929 Bacteria 7457
102 Ga0207670_10118435 3300025936 Bacteria 1921
103 Ga0207665_10020174 3300025939 Bacteria 4379
104 Ga0207711_10447219 3300025941 Bacteria 1203
105 Ga0207711_11218043 3300025941 Bacteria 694
106 Ga0207661_10000232 3300025944 Bacteria 36587
107 Ga0207667_10187557 3300025949 Bacteria 2123
108 Ga0207651_10251028 3300025960 Bacteria 1447
109 Ga0207703_10432849 3300026035 Bacteria 1226
110 Ga0207703_11142236 3300026035 Bacteria 748
111 Ga0207639_10631213 3300026041 Bacteria 990
112 Ga0207702_10275012 3300026078 Bacteria 1590
113 Ga0207641_10963158 3300026088 Bacteria 849
114 Ga0207641_11298272 3300026088 Bacteria 728
115 Ga0207675_101261414 3300026118 Bacteria 759
116 Ga0265337_1009412 3300028556 Bacteria 3489
117 Ga0265326_10150151 3300028558 Bacteria 665
118 Ga0265319_1010077 3300028563 Bacteria 3963
119 Ga0265323_10002640 3300028653 Bacteria 8115
120 Ga0265323_10003237 3300028653 Bacteria 7254
121 Ga0265322_10015840 3300028654 Bacteria 2176
122 Ga0265336_10000428 3300028666 Bacteria 26005
123 Ga0265338_10000094 3300028800 Bacteria 168366
124 Ga0265339_10036479 3300031249 Bacteria 2752
125 Ga0265331_10030058 3300031250 Bacteria 2707
126 Ga0307513_10056064 3300031456 Bacteria 4211
127 Ga0307408_100997910 3300031548 Bacteria 771
128 Ga0307508_10174458 3300031616 Bacteria 1753
129 Ga0265314_10019064 3300031711 Bacteria 5323
130 Ga0265342_10028873 3300031712 Bacteria 3449
131 Ga0307410_10770932 3300031852 Bacteria 816
132 Ga0307412_11046261 3300031911 Bacteria 724
133 Ga0307510_10006737 3300033180 Bacteria 13697
134 Ga0373941_0396440 3300035115 Bacteria 570
135 Ga0373935_0048405 3300035692 Bacteria 2692
136 Ga0373933_0000031 3300035724 Bacteria 85038
137 Ga0373925_0463012 3300037068 Bacteria 1039
138 Ga0373925_1165355 3300037068 Bacteria 634
139 Ga0395900_0011713 3300037418 Bacteria 8967
140 Ga0395898_0482615 3300037466 Bacteria 1179
141 Ga0395905_0340557 3300037471 Bacteria 1391
142 Ga0436364_0222016 3300037853 Bacteria 56574
143 Ga0436364_0874918 3300037853 Bacteria 1097
144 Ga0436364_1241478 3300037853 Bacteria 739
145 Ga0395901_0168042 3300038443 Bacteria 2302
146 Ga0395901_1547440 3300038443 Bacteria 618
147 Ga0436365_0126117 3300039437 Bacteria 989
148 Ga0436365_0128891 3300039437 Bacteria 1291
149 Ga0436365_0533844 3300039437 Bacteria 2073
150 Ga0436365_0899481 3300039437 Bacteria 681
151 Ga0436365_0901770 3300039437 Bacteria 2103
152 Ga0436365_1655368 3300039437 Bacteria 742
153 Ga0436363_0525522 3300039450 Bacteria 3097
154 Ga0436362_0322292 3300039453 Bacteria 2541
155 Ga0436362_0589594 3300039453 Bacteria 538
156 Ga0451577_0190374 3300042876 Bacteria 1851
157 Ga0466969_0137762 3300044656 Bacteria 1129
158 Ga0466966_0024491 3300044684 Bacteria 3947
159 Ga0453684_0811112 3300044712 Bacteria 1008
160 Ga0466971_0072005 3300044719 Bacteria 1570
161 Ga0466970_0572160 3300044765 Bacteria 654
162 Ga0466957_0403905 3300044842 Bacteria 935
163 Ga0466959_0058000 3300045049 Bacteria 2821
164 Ga0466959_0173417 3300045049 Bacteria 1512
165 Ga0495650_0114249 3300046471 Bacteria 999
166 Ga0495606_0006063 3300046507 Bacteria 11295
167 Ga0495606_0296804 3300046507 Bacteria 877
168 Ga0495610_0002231 3300046512 Bacteria 16389
169 Ga0495620_0083826 3300046515 Bacteria 1286
170 Ga0495630_1269810 3300046517 Bacteria 556
171 Ga0495643_0053979 3300046522 Bacteria 2153
172 Ga0495661_0188811 3300046665 Bacteria 1087
173 Ga0495671_0145077 3300046692 Bacteria 1156
174 Ga0495673_0060757 3300047469 Bacteria 1620
175 Ga0495686_0003677 3300047472 Bacteria 13109
176 Ga0495686_0053879 3300047472 Bacteria 2520
177 Ga0496100_0718240 3300048903 Bacteria 780
178 Ga0496110_0206734 3300048913 Bacteria 1784
179 Ga0496116_0076098 3300048919 Bacteria 2104
180 Ga0496117_0160730 3300048920 Bacteria 1316
181 Ga0496119_0064077 3300048922 Bacteria 2184
182 Ga0496121_0045378 3300048924 Bacteria 3777
183 Ga0496122_0428846 3300048925 Bacteria 662
184 Ga0496123_0016295 3300048926 Bacteria 6045
185 Ga0496124_0003763 3300048927 Bacteria 18246
186 Ga0496124_0397721 3300048927 Bacteria 957
187 Ga0496125_0043820 3300048928 Bacteria 3792
188 Ga0496125_0051139 3300048928 Bacteria 3411
189 Ga0496126_0026322 3300048929 Bacteria 5579
190 Ga0496126_0067049 3300048929 Bacteria 3207
191 Ga0495678_068359 3300049459 Bacteria 1310
192 Ga0501032_0085265 3300049569 Bacteria 2100
193 Ga0501033_0013315 3300049570 Bacteria 6268
194 Ga0501033_0351089 3300049570 Bacteria 1033
195 Ga0501034_0001044 3300049571 Bacteria 39462
196 Ga0501034_0003233 3300049571 Bacteria 18655
197 Ga0501034_0051899 3300049571 Bacteria 4134
198 Ga0501034_0055364 3300049571 Bacteria 3991
199 Ga0501034_0105408 3300049571 Bacteria 2812
200 Ga0501034_0465711 3300049571 Bacteria 1180
201 Ga0501034_1218135 3300049571 Bacteria 631
202 Ga0501036_0073631 3300049572 Bacteria 2888
203 Ga0501036_0201853 3300049572 Bacteria 1672
204 Ga0501037_0038024 3300049573 Bacteria 3548
205 Ga0501038_0027024 3300049574 Bacteria 5108
206 Ga0501039_0097002 3300049575 Bacteria 2299
207 Ga0501039_0104103 3300049575 Bacteria 2216
208 Ga0501043_0227437 3300049579 Bacteria 1441
209 Ga0501043_0434987 3300049579 Bacteria 988
210 Ga0501046_0713160 3300049580 Bacteria 706
211 Ga0501047_0019151 3300049581 Bacteria 6566
212 Ga0501047_0049911 3300049581 Bacteria 4040
213 Ga0501047_0126224 3300049581 Bacteria 2439
214 Ga0501047_0190484 3300049581 Bacteria 1915
215 Ga0501068_0043392 3300049584 Bacteria 2705
216 Ga0501068_0050379 3300049584 Bacteria 2517
217 Ga0501070_0037884 3300049586 Bacteria 4024
218 Ga0501070_0134890 3300049586 Bacteria 2038
219 Ga0501073_0045847 3300049589 Bacteria 3078
220 Ga0501073_0053869 3300049589 Bacteria 2816
221 Ga0501074_0992025 3300049590 Bacteria 591
222 Ga0501080_0019047 3300049742 Bacteria 6355
223 Ga0501080_0063680 3300049742 Bacteria 3431
224 Ga0501080_0177316 3300049742 Bacteria 1963
225 Ga0501080_0339736 3300049742 Bacteria 1357
226 Ga0501081_0946866 3300049743 Bacteria 650
227 Ga0501083_0024157 3300049744 Bacteria 4214
228 Ga0501271_013312 3300049768 Bacteria 900
229 Ga0501035_0101765 3300049822 Bacteria 2521
230 Ga0501044_0002968 3300049823 Bacteria 19271
231 Ga0501044_0058031 3300049823 Bacteria 3970
232 Ga0501044_0068048 3300049823 Bacteria 3628
233 Ga0501044_0088206 3300049823 Bacteria 3132
234 Ga0501044_0134451 3300049823 Bacteria 2465
235 nmdc:mga0k408_33591_c2 3300050493 Bacteria 2163
236 Ga0495601_0418574 3300053077 Bacteria 868
237 Ga0500595_001391 3300053119 Bacteria 12967
238 Ga0500616_0039599 3300053153 Bacteria 2540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0418574 Ga0495601_0418574_433_852 138
2 3300039453 Ga0436362_0589594 Ga0436362_0589594_10_462 149
3 iso_pu_bacteria 2513237104 2513716030 153
4 iso_pu_bacteria 2643221610 2644064078 153
5 iso_pu_bacteria 2643221668 2644375684 153
6 iso_pu_bacteria 2643221675 2644415910 153
7 iso_pu_bacteria 2643221680 2644448951 153
8 iso_pu_bacteria 2643221726 2644686525 153
9 iso_pu_bacteria 2791355265 2793357427 153
10 iso_pu_bacteria 2765235841 2765583387 154
11 iso_pu_bacteria 2738543024 2739310693 155
12 iso_pu_bacteria 2883291878 2883292000 155
13 3300002704 JGI25155J39150_1000113 JGI25155J39150_100011335 157
14 3300002705 JGI25156J39149_1000198 JGI25156J39149_100019835 157
15 3300002738 JGI25154J39366_1000209 JGI25154J39366_100020935 157
16 3300002741 JGI25157J39369_1000240 JGI25157J39369_100024035 157
17 3300003322 rootL2_10154862 rootL2_101548624 157
18 3300003659 JGI25404J52841_10006796 JGI25404J52841_100067962 157
19 3300003752 Ga0055539_1007105 Ga0055539_10071052 157
20 3300003775 Ga0055524_1000377 Ga0055524_100037729 157
21 3300005289 Ga0065704_10295971 Ga0065704_102959712 157
22 3300005327 Ga0070658_10026608 Ga0070658_100266085 157
23 3300005327 Ga0070658_11107088 Ga0070658_111070881 157
24 3300005329 Ga0070683_100045939 Ga0070683_1000459392 157
25 3300005329 Ga0070683_100098556 Ga0070683_1000985563 157
26 3300005336 Ga0070680_100520042 Ga0070680_1005200421 157
27 3300005337 Ga0070682_100427857 Ga0070682_1004278572 157
28 3300005340 Ga0070689_100587306 Ga0070689_1005873062 157
29 3300005355 Ga0070671_100223116 Ga0070671_1002231162 157
30 3300005434 Ga0070709_10004622 Ga0070709_100046226 157
31 3300005435 Ga0070714_100003003 Ga0070714_1000030034 157
32 3300005436 Ga0070713_100042139 Ga0070713_1000421393 157
33 3300005437 Ga0070710_10002230 Ga0070710_100022302 157
34 3300005439 Ga0070711_100025527 Ga0070711_1000255275 157
35 3300005458 Ga0070681_10119636 Ga0070681_101196363 157
36 3300005535 Ga0070684_100007593 Ga0070684_1000075933 157
37 3300005539 Ga0068853_100714120 Ga0068853_1007141202 157
38 3300005546 Ga0070696_100224186 Ga0070696_1002241861 157
39 3300005548 Ga0070665_100142334 Ga0070665_1001423343 157
40 3300005548 Ga0070665_101266930 Ga0070665_1012669302 157
41 3300005563 Ga0068855_100255047 Ga0068855_1002550472 157
42 3300005563 Ga0068855_100421067 Ga0068855_1004210672 157
43 3300005564 Ga0070664_100316690 Ga0070664_1003166902 157
44 3300005577 Ga0068857_100263999 Ga0068857_1002639993 157
45 3300005578 Ga0068854_100845733 Ga0068854_1008457331 157
46 3300005614 Ga0068856_100255117 Ga0068856_1002551172 157
47 3300005617 Ga0068859_100334545 Ga0068859_1003345451 157
48 3300005842 Ga0068858_101761822 Ga0068858_1017618221 157
49 3300005937 Ga0081455_10000431 Ga0081455_100004312 157
50 3300005983 Ga0081540_1001417 Ga0081540_10014173 157
51 3300005983 Ga0081540_1002136 Ga0081540_10021366 157
52 3300005983 Ga0081540_1019939 Ga0081540_10199393 157
53 3300006028 Ga0070717_10205935 Ga0070717_102059352 157
54 3300006028 Ga0070717_10615041 Ga0070717_106150412 157
55 3300006048 Ga0075363_100129923 Ga0075363_1001299233 157
56 3300006163 Ga0070715_10037194 Ga0070715_100371942 157
57 3300006173 Ga0070716_100012768 Ga0070716_1000127685 157
58 3300006173 Ga0070716_100037474 Ga0070716_1000374742 157
59 3300006175 Ga0070712_100031211 Ga0070712_1000312113 157
60 3300006175 Ga0070712_100151177 Ga0070712_1001511772 157
61 3300006178 Ga0075367_10174958 Ga0075367_101749583 157
62 3300006237 Ga0097621_101358655 Ga0097621_1013586552 157
63 3300006358 Ga0068871_101427997 Ga0068871_1014279972 157
64 3300006931 Ga0097620_100262079 Ga0097620_1002620792 157
65 3300006931 Ga0097620_100334553 Ga0097620_1003345531 157
66 3300009093 Ga0105240_10182260 Ga0105240_101822602 157
67 3300009093 Ga0105240_10397817 Ga0105240_103978172 157
68 3300009101 Ga0105247_10070068 Ga0105247_100700682 157
69 3300009551 Ga0105238_10090676 Ga0105238_100906763 157
70 3300009553 Ga0105249_11760242 Ga0105249_117602421 157
71 3300013100 Ga0157373_10094205 Ga0157373_100942051 157
72 3300013102 Ga0157371_10191265 Ga0157371_101912652 157
73 3300013104 Ga0157370_10313323 Ga0157370_103133231 157
74 3300013104 Ga0157370_10591066 Ga0157370_105910661 157
75 3300013104 Ga0157370_10711095 Ga0157370_107110951 157
76 3300013105 Ga0157369_10024228 Ga0157369_100242282 157
77 3300013105 Ga0157369_10056517 Ga0157369_100565171 157
78 3300013307 Ga0157372_10035057 Ga0157372_100350572 157
79 3300013308 Ga0157375_11340312 Ga0157375_113403121 157
80 3300014326 Ga0157380_10273531 Ga0157380_102735314 157
81 3300014745 Ga0157377_10163932 Ga0157377_101639323 157
82 3300015684 Ga0183365_10002 Ga0183365_10002182 157
83 3300020075 Ga0206349_1383225 Ga0206349_13832252 157
84 3300020078 Ga0206352_10285815 Ga0206352_102858151 157
85 3300020082 Ga0206353_10468945 Ga0206353_104689451 157
86 3300021384 Ga0213876_10080681 Ga0213876_100806812 157
87 3300021384 Ga0213876_10114382 Ga0213876_101143822 157
88 3300021388 Ga0213875_10000085 Ga0213875_1000008512 157
89 3300025206 Ga0209435_100091 Ga0209435_10009114 157
90 3300025246 Ga0209646_1000295 Ga0209646_100029514 157
91 3300025250 Ga0209026_1000366 Ga0209026_100036614 157
92 3300025253 Ga0209677_101028 Ga0209677_1010288 157
93 3300025256 Ga0209759_1000513 Ga0209759_100051332 157
94 3300025261 Ga0209233_1001723 Ga0209233_10017234 157
95 3300025272 Ga0209455_1009152 Ga0209455_10091522 157
96 3300025294 Ga0209025_1068367 Ga0209025_10683672 157
97 3300025299 Ga0209256_1000073 Ga0209256_1000073142 157
98 3300025898 Ga0207692_10009279 Ga0207692_100092792 157
99 3300025900 Ga0207710_10061915 Ga0207710_100619152 157
100 3300025906 Ga0207699_10005319 Ga0207699_100053196 157
101 3300025909 Ga0207705_10072707 Ga0207705_100727074 157
102 3300025909 Ga0207705_10692873 Ga0207705_106928732 157
103 3300025913 Ga0207695_10197929 Ga0207695_101979292 157
104 3300025913 Ga0207695_10352129 Ga0207695_103521292 157
105 3300025913 Ga0207695_10621222 Ga0207695_106212222 157
106 3300025914 Ga0207671_10949039 Ga0207671_109490392 157
107 3300025915 Ga0207693_10018282 Ga0207693_100182823 157
108 3300025915 Ga0207693_10019254 Ga0207693_100192544 157
109 3300025916 Ga0207663_10004356 Ga0207663_1000435610 157
110 3300025924 Ga0207694_10132791 Ga0207694_101327912 157
111 3300025928 Ga0207700_10019023 Ga0207700_100190232 157
112 3300025928 Ga0207700_10386400 Ga0207700_103864002 157
113 3300025929 Ga0207664_10007739 Ga0207664_100077395 157
114 3300025936 Ga0207670_10118435 Ga0207670_101184353 157
115 3300025939 Ga0207665_10020174 Ga0207665_100201745 157
116 3300025941 Ga0207711_10447219 Ga0207711_104472193 157
117 3300025941 Ga0207711_11218043 Ga0207711_112180432 157
118 3300025944 Ga0207661_10000232 Ga0207661_1000023226 157
119 3300025949 Ga0207667_10187557 Ga0207667_101875572 157
120 3300025960 Ga0207651_10251028 Ga0207651_102510282 157
121 3300026035 Ga0207703_10432849 Ga0207703_104328491 157
122 3300026035 Ga0207703_11142236 Ga0207703_111422362 157
123 3300026041 Ga0207639_10631213 Ga0207639_106312131 157
124 3300026078 Ga0207702_10275012 Ga0207702_102750122 157
125 3300026088 Ga0207641_10963158 Ga0207641_109631582 157
126 3300026088 Ga0207641_11298272 Ga0207641_112982721 157
127 3300026118 Ga0207675_101261414 Ga0207675_1012614141 157
128 3300028556 Ga0265337_1009412 Ga0265337_10094122 157
129 3300028558 Ga0265326_10150151 Ga0265326_101501511 157
130 3300028563 Ga0265319_1010077 Ga0265319_10100772 157
131 3300028653 Ga0265323_10002640 Ga0265323_1000264012 157
132 3300028653 Ga0265323_10003237 Ga0265323_100032372 157
133 3300028654 Ga0265322_10015840 Ga0265322_100158402 157
134 3300028666 Ga0265336_10000428 Ga0265336_1000042828 157
135 3300028800 Ga0265338_10000094 Ga0265338_100000942 157
136 3300031249 Ga0265339_10036479 Ga0265339_100364792 157
137 3300031250 Ga0265331_10030058 Ga0265331_100300584 157
138 3300031456 Ga0307513_10056064 Ga0307513_100560644 157
139 3300031548 Ga0307408_100997910 Ga0307408_1009979102 157
140 3300031616 Ga0307508_10174458 Ga0307508_101744584 157
141 3300031711 Ga0265314_10019064 Ga0265314_100190642 157
142 3300031712 Ga0265342_10028873 Ga0265342_100288734 157
143 3300031852 Ga0307410_10770932 Ga0307410_107709322 157
144 3300031911 Ga0307412_11046261 Ga0307412_110462612 157
145 3300033180 Ga0307510_10006737 Ga0307510_1000673712 157
146 3300035115 Ga0373941_0396440 Ga0373941_0396440_21_494 157
147 3300035692 Ga0373935_0048405 Ga0373935_0048405_853_1329 157
148 3300035724 Ga0373933_0000031 Ga0373933_0000031_6830_7303 157
149 3300037068 Ga0373925_0463012 Ga0373925_0463012_545_1018 157
150 3300037068 Ga0373925_1165355 Ga0373925_1165355_45_518 157
151 3300037418 Ga0395900_0011713 Ga0395900_0011713_6753_7232 157
152 3300037466 Ga0395898_0482615 Ga0395898_0482615_415_894 157
153 3300037471 Ga0395905_0340557 Ga0395905_0340557_199_672 157
154 3300037853 Ga0436364_0222016 Ga0436364_0222016_45788_46261 157
155 3300037853 Ga0436364_0874918 Ga0436364_0874918_324_797 157
156 3300037853 Ga0436364_1241478 Ga0436364_1241478_98_586 157
157 3300038443 Ga0395901_0168042 Ga0395901_0168042_408_887 157
158 3300038443 Ga0395901_1547440 Ga0395901_1547440_71_547 157
159 3300039437 Ga0436365_0126117 Ga0436365_0126117_11_490 157
160 3300039437 Ga0436365_0128891 Ga0436365_0128891_252_731 157
161 3300039437 Ga0436365_0533844 Ga0436365_0533844_845_1318 157
162 3300039437 Ga0436365_0899481 Ga0436365_0899481_116_589 157
163 3300039437 Ga0436365_0901770 Ga0436365_0901770_609_1082 157
164 3300039437 Ga0436365_1655368 Ga0436365_1655368_23_541 157
165 3300039450 Ga0436363_0525522 Ga0436363_0525522_2097_2582 157
166 3300039453 Ga0436362_0322292 Ga0436362_0322292_414_887 157
167 3300042876 Ga0451577_0190374 Ga0451577_0190374_1050_1547 157
168 3300044656 Ga0466969_0137762 Ga0466969_0137762_78_551 157
169 3300044684 Ga0466966_0024491 Ga0466966_0024491_1796_2269 157
170 3300044712 Ga0453684_0811112 Ga0453684_0811112_30_527 157
171 3300044719 Ga0466971_0072005 Ga0466971_0072005_115_588 157
172 3300044765 Ga0466970_0572160 Ga0466970_0572160_153_626 157
173 3300044842 Ga0466957_0403905 Ga0466957_0403905_357_830 157
174 3300045049 Ga0466959_0058000 Ga0466959_0058000_1534_2007 157
175 3300045049 Ga0466959_0173417 Ga0466959_0173417_459_941 157
176 3300046471 Ga0495650_0114249 Ga0495650_0114249_473_946 157
177 3300046507 Ga0495606_0006063 Ga0495606_0006063_2650_3123 157
178 3300046507 Ga0495606_0296804 Ga0495606_0296804_267_746 157
179 3300046512 Ga0495610_0002231 Ga0495610_0002231_15449_15922 157
180 3300046515 Ga0495620_0083826 Ga0495620_0083826_308_781 157
181 3300046517 Ga0495630_1269810 Ga0495630_1269810_71_544 157
182 3300046522 Ga0495643_0053979 Ga0495643_0053979_441_914 157
183 3300046665 Ga0495661_0188811 Ga0495661_0188811_103_576 157
184 3300046692 Ga0495671_0145077 Ga0495671_0145077_487_960 157
185 3300047469 Ga0495673_0060757 Ga0495673_0060757_456_929 157
186 3300047472 Ga0495686_0003677 Ga0495686_0003677_473_946 157
187 3300047472 Ga0495686_0053879 Ga0495686_0053879_706_1185 157
188 3300048903 Ga0496100_0718240 Ga0496100_0718240_205_678 157
189 3300048913 Ga0496110_0206734 Ga0496110_0206734_432_911 157
190 3300048919 Ga0496116_0076098 Ga0496116_0076098_1513_2001 157
191 3300048920 Ga0496117_0160730 Ga0496117_0160730_315_788 157
192 3300048922 Ga0496119_0064077 Ga0496119_0064077_810_1283 157
193 3300048924 Ga0496121_0045378 Ga0496121_0045378_2714_3187 157
194 3300048925 Ga0496122_0428846 Ga0496122_0428846_51_530 157
195 3300048926 Ga0496123_0016295 Ga0496123_0016295_4695_5174 157
196 3300048927 Ga0496124_0003763 Ga0496124_0003763_14933_15412 157
197 3300048927 Ga0496124_0397721 Ga0496124_0397721_51_524 157
198 3300048928 Ga0496125_0043820 Ga0496125_0043820_2838_3317 157
199 3300048928 Ga0496125_0051139 Ga0496125_0051139_2491_2970 157
200 3300048929 Ga0496126_0026322 Ga0496126_0026322_1086_1565 157
201 3300048929 Ga0496126_0067049 Ga0496126_0067049_2675_3154 157
202 3300049459 Ga0495678_068359 Ga0495678_068359_483_956 157
203 3300049569 Ga0501032_0085265 Ga0501032_0085265_496_975 157
204 3300049570 Ga0501033_0013315 Ga0501033_0013315_5414_5893 157
205 3300049570 Ga0501033_0351089 Ga0501033_0351089_200_679 157
206 3300049571 Ga0501034_0001044 Ga0501034_0001044_32087_32560 157
207 3300049571 Ga0501034_0003233 Ga0501034_0003233_3088_3561 157
208 3300049571 Ga0501034_0051899 Ga0501034_0051899_2397_2870 157
209 3300049571 Ga0501034_0055364 Ga0501034_0055364_3178_3657 157
210 3300049571 Ga0501034_0105408 Ga0501034_0105408_1052_1531 157
211 3300049571 Ga0501034_0465711 Ga0501034_0465711_31_519 157
212 3300049571 Ga0501034_1218135 Ga0501034_1218135_67_585 157
213 3300049572 Ga0501036_0073631 Ga0501036_0073631_468_941 157
214 3300049572 Ga0501036_0201853 Ga0501036_0201853_588_1067 157
215 3300049573 Ga0501037_0038024 Ga0501037_0038024_2648_3121 157
216 3300049574 Ga0501038_0027024 Ga0501038_0027024_4435_4908 157
217 3300049575 Ga0501039_0097002 Ga0501039_0097002_640_1113 157
218 3300049575 Ga0501039_0104103 Ga0501039_0104103_1075_1554 157
219 3300049579 Ga0501043_0227437 Ga0501043_0227437_805_1284 157
220 3300049579 Ga0501043_0434987 Ga0501043_0434987_31_510 157
221 3300049580 Ga0501046_0713160 Ga0501046_0713160_131_610 157
222 3300049581 Ga0501047_0019151 Ga0501047_0019151_1043_1522 157
223 3300049581 Ga0501047_0049911 Ga0501047_0049911_2907_3386 157
224 3300049581 Ga0501047_0126224 Ga0501047_0126224_15_488 157
225 3300049581 Ga0501047_0190484 Ga0501047_0190484_1327_1806 157
226 3300049584 Ga0501068_0043392 Ga0501068_0043392_555_1028 157
227 3300049584 Ga0501068_0050379 Ga0501068_0050379_995_1474 157
228 3300049586 Ga0501070_0037884 Ga0501070_0037884_1219_1698 157
229 3300049586 Ga0501070_0134890 Ga0501070_0134890_992_1471 157
230 3300049589 Ga0501073_0045847 Ga0501073_0045847_1711_2190 157
231 3300049589 Ga0501073_0053869 Ga0501073_0053869_679_1158 157
232 3300049590 Ga0501074_0992025 Ga0501074_0992025_91_570 157
233 3300049742 Ga0501080_0019047 Ga0501080_0019047_4769_5248 157
234 3300049742 Ga0501080_0063680 Ga0501080_0063680_2466_2945 157
235 3300049742 Ga0501080_0177316 Ga0501080_0177316_173_646 157
236 3300049742 Ga0501080_0339736 Ga0501080_0339736_37_516 157
237 3300049743 Ga0501081_0946866 Ga0501081_0946866_133_633 157
238 3300049744 Ga0501083_0024157 Ga0501083_0024157_138_611 157
239 3300049768 Ga0501271_013312 Ga0501271_013312_103_591 157
240 3300049822 Ga0501035_0101765 Ga0501035_0101765_736_1215 157
241 3300049823 Ga0501044_0002968 Ga0501044_0002968_17895_18374 157
242 3300049823 Ga0501044_0058031 Ga0501044_0058031_684_1163 157
243 3300049823 Ga0501044_0068048 Ga0501044_0068048_877_1350 157
244 3300049823 Ga0501044_0088206 Ga0501044_0088206_1659_2138 157
245 3300049823 Ga0501044_0134451 Ga0501044_0134451_578_1051 157
246 3300050493 nmdc:mga0k408_33591_c2 nmdc:mga0k408_33591_c2_1041_1514 157
247 3300053119 Ga0500595_001391 Ga0500595_001391_1594_2073 157
248 3300053153 Ga0500616_0039599 Ga0500616_0039599_547_1020 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

17

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9714 2 155
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9702 2 155
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9586 2 155
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9584 2 155
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9574 2 155
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9659 2 155 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9528 2 155 3.10.180.10
4hnvB02 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.7999 28 63 3.10.600.10
3zl8A02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.7728 27 66 3.40.1190.10
1ebdB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7519 27 61 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A435UWU8-F1-model_v4 deleted 0.9945 77 157
AF-A0A1G4T9J9-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9943 78 157 GO:0008168
GO:0032259
AF-A0A3N5MPH9-F1-model_v4 VOC family protein 0.9908 74 157
AF-A0A1C9I172-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9892 52 157 GO:0008168
GO:0032259
AF-A0A2V8C288-F1-model_v4 PhnB-like domain-containing protein 0.9879 57 156

Feature Viewer

pLDDT pTM Quality
91.89 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map