F360074
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 248 | 185 | 238 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1655368|Ga0436365_1655368_23_541 |
| Length | 172 |
| Sequence | MEMRRALDWKRQGLAMAKNTICIWYDKDAEAAARFYAETFPDSAVSAVNRAPGDYPSGKAGDVLTVEFTVAGVACLGLNGGPMFKHSEAFSFQISTEDQEETDRYWNAIVGNGGQASACGWCKDKWGISWQITPRVLMEALRAGGAEAKRAFEAMMGMTKIDVAAIIAARRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 2 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 3 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 4 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 5 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 6 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 7 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 8 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 9 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 10 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 11 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 12 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 13 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 67 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 71 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 72 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 108 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 115 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 120 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 130 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 131 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 132 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 135 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 136 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 137 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 138 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 139 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 140 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 153 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 154 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 155 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 156 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 157 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 158 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 159 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 183 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.76 |
| Metatranscriptomes | 1.21 |
| Isolates | 4.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.84 |
| Nodule | 0.81 |
| Rhizoplane | 0.81 |
| Rhizosphere | 75.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000113 | 3300002704 | Bacteria | 42079 |
| 2 | JGI25156J39149_1000198 | 3300002705 | Bacteria | 42079 |
| 3 | JGI25154J39366_1000209 | 3300002738 | Bacteria | 41899 |
| 4 | JGI25157J39369_1000240 | 3300002741 | Bacteria | 42079 |
| 5 | rootL2_10154862 | 3300003322 | Bacteria | 6058 |
| 6 | JGI25404J52841_10006796 | 3300003659 | Bacteria | 2402 |
| 7 | Ga0055539_1007105 | 3300003752 | Bacteria | 1421 |
| 8 | Ga0055524_1000377 | 3300003775 | Bacteria | 38923 |
| 9 | Ga0065704_10295971 | 3300005289 | Bacteria | 894 |
| 10 | Ga0070658_10026608 | 3300005327 | Bacteria | 4641 |
| 11 | Ga0070658_11107088 | 3300005327 | Bacteria | 689 |
| 12 | Ga0070683_100045939 | 3300005329 | Bacteria | 4032 |
| 13 | Ga0070683_100098556 | 3300005329 | Bacteria | 2751 |
| 14 | Ga0070680_100520042 | 3300005336 | Bacteria | 1019 |
| 15 | Ga0070682_100427857 | 3300005337 | Bacteria | 1008 |
| 16 | Ga0070689_100587306 | 3300005340 | Bacteria | 963 |
| 17 | Ga0070671_100223116 | 3300005355 | Bacteria | 1599 |
| 18 | Ga0070709_10004622 | 3300005434 | Bacteria | 7434 |
| 19 | Ga0070714_100003003 | 3300005435 | Bacteria | 12511 |
| 20 | Ga0070713_100042139 | 3300005436 | Bacteria | 3724 |
| 21 | Ga0070710_10002230 | 3300005437 | Bacteria | 9159 |
| 22 | Ga0070711_100025527 | 3300005439 | Bacteria | 3867 |
| 23 | Ga0070681_10119636 | 3300005458 | Bacteria | 2570 |
| 24 | Ga0070684_100007593 | 3300005535 | Bacteria | 8449 |
| 25 | Ga0068853_100714120 | 3300005539 | Bacteria | 957 |
| 26 | Ga0070696_100224186 | 3300005546 | Bacteria | 1412 |
| 27 | Ga0070665_100142334 | 3300005548 | Bacteria | 2401 |
| 28 | Ga0070665_101266930 | 3300005548 | Bacteria | 747 |
| 29 | Ga0068855_100255047 | 3300005563 | Bacteria | 1956 |
| 30 | Ga0068855_100421067 | 3300005563 | Bacteria | 1461 |
| 31 | Ga0070664_100316690 | 3300005564 | Bacteria | 1413 |
| 32 | Ga0068857_100263999 | 3300005577 | Bacteria | 1581 |
| 33 | Ga0068854_100845733 | 3300005578 | Bacteria | 801 |
| 34 | Ga0068856_100255117 | 3300005614 | Bacteria | 1769 |
| 35 | Ga0068859_100334545 | 3300005617 | Bacteria | 1608 |
| 36 | Ga0068858_101761822 | 3300005842 | Bacteria | 612 |
| 37 | Ga0081455_10000431 | 3300005937 | Bacteria | 55069 |
| 38 | Ga0081540_1001417 | 3300005983 | Bacteria | 20744 |
| 39 | Ga0081540_1002136 | 3300005983 | Bacteria | 16449 |
| 40 | Ga0081540_1019939 | 3300005983 | Bacteria | 4053 |
| 41 | Ga0070717_10205935 | 3300006028 | Bacteria | 1725 |
| 42 | Ga0070717_10615041 | 3300006028 | Bacteria | 986 |
| 43 | Ga0075363_100129923 | 3300006048 | Bacteria | 1412 |
| 44 | Ga0070715_10037194 | 3300006163 | Bacteria | 2013 |
| 45 | Ga0070716_100012768 | 3300006173 | Bacteria | 4266 |
| 46 | Ga0070716_100037474 | 3300006173 | Bacteria | 2680 |
| 47 | Ga0070712_100031211 | 3300006175 | Bacteria | 3588 |
| 48 | Ga0070712_100151177 | 3300006175 | Bacteria | 1783 |
| 49 | Ga0075367_10174958 | 3300006178 | Bacteria | 1337 |
| 50 | Ga0097621_101358655 | 3300006237 | Bacteria | 672 |
| 51 | Ga0068871_101427997 | 3300006358 | Bacteria | 653 |
| 52 | Ga0097620_100262079 | 3300006931 | Bacteria | 1820 |
| 53 | Ga0097620_100334553 | 3300006931 | Bacteria | 1608 |
| 54 | Ga0105240_10182260 | 3300009093 | Bacteria | 2477 |
| 55 | Ga0105240_10397817 | 3300009093 | Bacteria | 1552 |
| 56 | Ga0105247_10070068 | 3300009101 | Bacteria | 2190 |
| 57 | Ga0105238_10090676 | 3300009551 | Bacteria | 3044 |
| 58 | Ga0105249_11760242 | 3300009553 | Bacteria | 692 |
| 59 | Ga0157373_10094205 | 3300013100 | Bacteria | 2109 |
| 60 | Ga0157371_10191265 | 3300013102 | Bacteria | 1465 |
| 61 | Ga0157370_10313323 | 3300013104 | Bacteria | 1448 |
| 62 | Ga0157370_10591066 | 3300013104 | Bacteria | 1017 |
| 63 | Ga0157370_10711095 | 3300013104 | Bacteria | 917 |
| 64 | Ga0157369_10024228 | 3300013105 | Bacteria | 6755 |
| 65 | Ga0157369_10056517 | 3300013105 | Bacteria | 4235 |
| 66 | Ga0157372_10035057 | 3300013307 | Bacteria | 5521 |
| 67 | Ga0157375_11340312 | 3300013308 | Bacteria | 842 |
| 68 | Ga0157380_10273531 | 3300014326 | Bacteria | 1541 |
| 69 | Ga0157377_10163932 | 3300014745 | Bacteria | 1384 |
| 70 | Ga0183365_10002 | 3300015684 | Bacteria | 545891 |
| 71 | Ga0206349_1383225 | 3300020075 | Bacteria | 651 |
| 72 | Ga0206352_10285815 | 3300020078 | Bacteria | 527 |
| 73 | Ga0206353_10468945 | 3300020082 | Bacteria | 865 |
| 74 | Ga0213876_10080681 | 3300021384 | Bacteria | 1720 |
| 75 | Ga0213876_10114382 | 3300021384 | Bacteria | 1432 |
| 76 | Ga0213875_10000085 | 3300021388 | Bacteria | 108455 |
| 77 | Ga0209435_100091 | 3300025206 | Bacteria | 41951 |
| 78 | Ga0209646_1000295 | 3300025246 | Bacteria | 41951 |
| 79 | Ga0209026_1000366 | 3300025250 | Bacteria | 41951 |
| 80 | Ga0209677_101028 | 3300025253 | Bacteria | 13312 |
| 81 | Ga0209759_1000513 | 3300025256 | Bacteria | 41951 |
| 82 | Ga0209233_1001723 | 3300025261 | Bacteria | 8456 |
| 83 | Ga0209455_1009152 | 3300025272 | Bacteria | 2623 |
| 84 | Ga0209025_1068367 | 3300025294 | Bacteria | 1277 |
| 85 | Ga0209256_1000073 | 3300025299 | Bacteria | 237553 |
| 86 | Ga0207692_10009279 | 3300025898 | Bacteria | 4102 |
| 87 | Ga0207710_10061915 | 3300025900 | Bacteria | 1699 |
| 88 | Ga0207699_10005319 | 3300025906 | Bacteria | 6166 |
| 89 | Ga0207705_10072707 | 3300025909 | Bacteria | 2495 |
| 90 | Ga0207705_10692873 | 3300025909 | Bacteria | 792 |
| 91 | Ga0207695_10197929 | 3300025913 | Bacteria | 1925 |
| 92 | Ga0207695_10352129 | 3300025913 | Bacteria | 1359 |
| 93 | Ga0207695_10621222 | 3300025913 | Bacteria | 962 |
| 94 | Ga0207671_10949039 | 3300025914 | Bacteria | 679 |
| 95 | Ga0207693_10018282 | 3300025915 | Bacteria | 5585 |
| 96 | Ga0207693_10019254 | 3300025915 | Bacteria | 5431 |
| 97 | Ga0207663_10004356 | 3300025916 | Bacteria | 7028 |
| 98 | Ga0207694_10132791 | 3300025924 | Bacteria | 1996 |
| 99 | Ga0207700_10019023 | 3300025928 | Bacteria | 4631 |
| 100 | Ga0207700_10386400 | 3300025928 | Bacteria | 1225 |
| 101 | Ga0207664_10007739 | 3300025929 | Bacteria | 7457 |
| 102 | Ga0207670_10118435 | 3300025936 | Bacteria | 1921 |
| 103 | Ga0207665_10020174 | 3300025939 | Bacteria | 4379 |
| 104 | Ga0207711_10447219 | 3300025941 | Bacteria | 1203 |
| 105 | Ga0207711_11218043 | 3300025941 | Bacteria | 694 |
| 106 | Ga0207661_10000232 | 3300025944 | Bacteria | 36587 |
| 107 | Ga0207667_10187557 | 3300025949 | Bacteria | 2123 |
| 108 | Ga0207651_10251028 | 3300025960 | Bacteria | 1447 |
| 109 | Ga0207703_10432849 | 3300026035 | Bacteria | 1226 |
| 110 | Ga0207703_11142236 | 3300026035 | Bacteria | 748 |
| 111 | Ga0207639_10631213 | 3300026041 | Bacteria | 990 |
| 112 | Ga0207702_10275012 | 3300026078 | Bacteria | 1590 |
| 113 | Ga0207641_10963158 | 3300026088 | Bacteria | 849 |
| 114 | Ga0207641_11298272 | 3300026088 | Bacteria | 728 |
| 115 | Ga0207675_101261414 | 3300026118 | Bacteria | 759 |
| 116 | Ga0265337_1009412 | 3300028556 | Bacteria | 3489 |
| 117 | Ga0265326_10150151 | 3300028558 | Bacteria | 665 |
| 118 | Ga0265319_1010077 | 3300028563 | Bacteria | 3963 |
| 119 | Ga0265323_10002640 | 3300028653 | Bacteria | 8115 |
| 120 | Ga0265323_10003237 | 3300028653 | Bacteria | 7254 |
| 121 | Ga0265322_10015840 | 3300028654 | Bacteria | 2176 |
| 122 | Ga0265336_10000428 | 3300028666 | Bacteria | 26005 |
| 123 | Ga0265338_10000094 | 3300028800 | Bacteria | 168366 |
| 124 | Ga0265339_10036479 | 3300031249 | Bacteria | 2752 |
| 125 | Ga0265331_10030058 | 3300031250 | Bacteria | 2707 |
| 126 | Ga0307513_10056064 | 3300031456 | Bacteria | 4211 |
| 127 | Ga0307408_100997910 | 3300031548 | Bacteria | 771 |
| 128 | Ga0307508_10174458 | 3300031616 | Bacteria | 1753 |
| 129 | Ga0265314_10019064 | 3300031711 | Bacteria | 5323 |
| 130 | Ga0265342_10028873 | 3300031712 | Bacteria | 3449 |
| 131 | Ga0307410_10770932 | 3300031852 | Bacteria | 816 |
| 132 | Ga0307412_11046261 | 3300031911 | Bacteria | 724 |
| 133 | Ga0307510_10006737 | 3300033180 | Bacteria | 13697 |
| 134 | Ga0373941_0396440 | 3300035115 | Bacteria | 570 |
| 135 | Ga0373935_0048405 | 3300035692 | Bacteria | 2692 |
| 136 | Ga0373933_0000031 | 3300035724 | Bacteria | 85038 |
| 137 | Ga0373925_0463012 | 3300037068 | Bacteria | 1039 |
| 138 | Ga0373925_1165355 | 3300037068 | Bacteria | 634 |
| 139 | Ga0395900_0011713 | 3300037418 | Bacteria | 8967 |
| 140 | Ga0395898_0482615 | 3300037466 | Bacteria | 1179 |
| 141 | Ga0395905_0340557 | 3300037471 | Bacteria | 1391 |
| 142 | Ga0436364_0222016 | 3300037853 | Bacteria | 56574 |
| 143 | Ga0436364_0874918 | 3300037853 | Bacteria | 1097 |
| 144 | Ga0436364_1241478 | 3300037853 | Bacteria | 739 |
| 145 | Ga0395901_0168042 | 3300038443 | Bacteria | 2302 |
| 146 | Ga0395901_1547440 | 3300038443 | Bacteria | 618 |
| 147 | Ga0436365_0126117 | 3300039437 | Bacteria | 989 |
| 148 | Ga0436365_0128891 | 3300039437 | Bacteria | 1291 |
| 149 | Ga0436365_0533844 | 3300039437 | Bacteria | 2073 |
| 150 | Ga0436365_0899481 | 3300039437 | Bacteria | 681 |
| 151 | Ga0436365_0901770 | 3300039437 | Bacteria | 2103 |
| 152 | Ga0436365_1655368 | 3300039437 | Bacteria | 742 |
| 153 | Ga0436363_0525522 | 3300039450 | Bacteria | 3097 |
| 154 | Ga0436362_0322292 | 3300039453 | Bacteria | 2541 |
| 155 | Ga0436362_0589594 | 3300039453 | Bacteria | 538 |
| 156 | Ga0451577_0190374 | 3300042876 | Bacteria | 1851 |
| 157 | Ga0466969_0137762 | 3300044656 | Bacteria | 1129 |
| 158 | Ga0466966_0024491 | 3300044684 | Bacteria | 3947 |
| 159 | Ga0453684_0811112 | 3300044712 | Bacteria | 1008 |
| 160 | Ga0466971_0072005 | 3300044719 | Bacteria | 1570 |
| 161 | Ga0466970_0572160 | 3300044765 | Bacteria | 654 |
| 162 | Ga0466957_0403905 | 3300044842 | Bacteria | 935 |
| 163 | Ga0466959_0058000 | 3300045049 | Bacteria | 2821 |
| 164 | Ga0466959_0173417 | 3300045049 | Bacteria | 1512 |
| 165 | Ga0495650_0114249 | 3300046471 | Bacteria | 999 |
| 166 | Ga0495606_0006063 | 3300046507 | Bacteria | 11295 |
| 167 | Ga0495606_0296804 | 3300046507 | Bacteria | 877 |
| 168 | Ga0495610_0002231 | 3300046512 | Bacteria | 16389 |
| 169 | Ga0495620_0083826 | 3300046515 | Bacteria | 1286 |
| 170 | Ga0495630_1269810 | 3300046517 | Bacteria | 556 |
| 171 | Ga0495643_0053979 | 3300046522 | Bacteria | 2153 |
| 172 | Ga0495661_0188811 | 3300046665 | Bacteria | 1087 |
| 173 | Ga0495671_0145077 | 3300046692 | Bacteria | 1156 |
| 174 | Ga0495673_0060757 | 3300047469 | Bacteria | 1620 |
| 175 | Ga0495686_0003677 | 3300047472 | Bacteria | 13109 |
| 176 | Ga0495686_0053879 | 3300047472 | Bacteria | 2520 |
| 177 | Ga0496100_0718240 | 3300048903 | Bacteria | 780 |
| 178 | Ga0496110_0206734 | 3300048913 | Bacteria | 1784 |
| 179 | Ga0496116_0076098 | 3300048919 | Bacteria | 2104 |
| 180 | Ga0496117_0160730 | 3300048920 | Bacteria | 1316 |
| 181 | Ga0496119_0064077 | 3300048922 | Bacteria | 2184 |
| 182 | Ga0496121_0045378 | 3300048924 | Bacteria | 3777 |
| 183 | Ga0496122_0428846 | 3300048925 | Bacteria | 662 |
| 184 | Ga0496123_0016295 | 3300048926 | Bacteria | 6045 |
| 185 | Ga0496124_0003763 | 3300048927 | Bacteria | 18246 |
| 186 | Ga0496124_0397721 | 3300048927 | Bacteria | 957 |
| 187 | Ga0496125_0043820 | 3300048928 | Bacteria | 3792 |
| 188 | Ga0496125_0051139 | 3300048928 | Bacteria | 3411 |
| 189 | Ga0496126_0026322 | 3300048929 | Bacteria | 5579 |
| 190 | Ga0496126_0067049 | 3300048929 | Bacteria | 3207 |
| 191 | Ga0495678_068359 | 3300049459 | Bacteria | 1310 |
| 192 | Ga0501032_0085265 | 3300049569 | Bacteria | 2100 |
| 193 | Ga0501033_0013315 | 3300049570 | Bacteria | 6268 |
| 194 | Ga0501033_0351089 | 3300049570 | Bacteria | 1033 |
| 195 | Ga0501034_0001044 | 3300049571 | Bacteria | 39462 |
| 196 | Ga0501034_0003233 | 3300049571 | Bacteria | 18655 |
| 197 | Ga0501034_0051899 | 3300049571 | Bacteria | 4134 |
| 198 | Ga0501034_0055364 | 3300049571 | Bacteria | 3991 |
| 199 | Ga0501034_0105408 | 3300049571 | Bacteria | 2812 |
| 200 | Ga0501034_0465711 | 3300049571 | Bacteria | 1180 |
| 201 | Ga0501034_1218135 | 3300049571 | Bacteria | 631 |
| 202 | Ga0501036_0073631 | 3300049572 | Bacteria | 2888 |
| 203 | Ga0501036_0201853 | 3300049572 | Bacteria | 1672 |
| 204 | Ga0501037_0038024 | 3300049573 | Bacteria | 3548 |
| 205 | Ga0501038_0027024 | 3300049574 | Bacteria | 5108 |
| 206 | Ga0501039_0097002 | 3300049575 | Bacteria | 2299 |
| 207 | Ga0501039_0104103 | 3300049575 | Bacteria | 2216 |
| 208 | Ga0501043_0227437 | 3300049579 | Bacteria | 1441 |
| 209 | Ga0501043_0434987 | 3300049579 | Bacteria | 988 |
| 210 | Ga0501046_0713160 | 3300049580 | Bacteria | 706 |
| 211 | Ga0501047_0019151 | 3300049581 | Bacteria | 6566 |
| 212 | Ga0501047_0049911 | 3300049581 | Bacteria | 4040 |
| 213 | Ga0501047_0126224 | 3300049581 | Bacteria | 2439 |
| 214 | Ga0501047_0190484 | 3300049581 | Bacteria | 1915 |
| 215 | Ga0501068_0043392 | 3300049584 | Bacteria | 2705 |
| 216 | Ga0501068_0050379 | 3300049584 | Bacteria | 2517 |
| 217 | Ga0501070_0037884 | 3300049586 | Bacteria | 4024 |
| 218 | Ga0501070_0134890 | 3300049586 | Bacteria | 2038 |
| 219 | Ga0501073_0045847 | 3300049589 | Bacteria | 3078 |
| 220 | Ga0501073_0053869 | 3300049589 | Bacteria | 2816 |
| 221 | Ga0501074_0992025 | 3300049590 | Bacteria | 591 |
| 222 | Ga0501080_0019047 | 3300049742 | Bacteria | 6355 |
| 223 | Ga0501080_0063680 | 3300049742 | Bacteria | 3431 |
| 224 | Ga0501080_0177316 | 3300049742 | Bacteria | 1963 |
| 225 | Ga0501080_0339736 | 3300049742 | Bacteria | 1357 |
| 226 | Ga0501081_0946866 | 3300049743 | Bacteria | 650 |
| 227 | Ga0501083_0024157 | 3300049744 | Bacteria | 4214 |
| 228 | Ga0501271_013312 | 3300049768 | Bacteria | 900 |
| 229 | Ga0501035_0101765 | 3300049822 | Bacteria | 2521 |
| 230 | Ga0501044_0002968 | 3300049823 | Bacteria | 19271 |
| 231 | Ga0501044_0058031 | 3300049823 | Bacteria | 3970 |
| 232 | Ga0501044_0068048 | 3300049823 | Bacteria | 3628 |
| 233 | Ga0501044_0088206 | 3300049823 | Bacteria | 3132 |
| 234 | Ga0501044_0134451 | 3300049823 | Bacteria | 2465 |
| 235 | nmdc:mga0k408_33591_c2 | 3300050493 | Bacteria | 2163 |
| 236 | Ga0495601_0418574 | 3300053077 | Bacteria | 868 |
| 237 | Ga0500595_001391 | 3300053119 | Bacteria | 12967 |
| 238 | Ga0500616_0039599 | 3300053153 | Bacteria | 2540 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053077 | Ga0495601_0418574 | Ga0495601_0418574_433_852 | 138 |
| 2 | 3300039453 | Ga0436362_0589594 | Ga0436362_0589594_10_462 | 149 |
| 3 | iso_pu_bacteria | 2513237104 | 2513716030 | 153 |
| 4 | iso_pu_bacteria | 2643221610 | 2644064078 | 153 |
| 5 | iso_pu_bacteria | 2643221668 | 2644375684 | 153 |
| 6 | iso_pu_bacteria | 2643221675 | 2644415910 | 153 |
| 7 | iso_pu_bacteria | 2643221680 | 2644448951 | 153 |
| 8 | iso_pu_bacteria | 2643221726 | 2644686525 | 153 |
| 9 | iso_pu_bacteria | 2791355265 | 2793357427 | 153 |
| 10 | iso_pu_bacteria | 2765235841 | 2765583387 | 154 |
| 11 | iso_pu_bacteria | 2738543024 | 2739310693 | 155 |
| 12 | iso_pu_bacteria | 2883291878 | 2883292000 | 155 |
| 13 | 3300002704 | JGI25155J39150_1000113 | JGI25155J39150_100011335 | 157 |
| 14 | 3300002705 | JGI25156J39149_1000198 | JGI25156J39149_100019835 | 157 |
| 15 | 3300002738 | JGI25154J39366_1000209 | JGI25154J39366_100020935 | 157 |
| 16 | 3300002741 | JGI25157J39369_1000240 | JGI25157J39369_100024035 | 157 |
| 17 | 3300003322 | rootL2_10154862 | rootL2_101548624 | 157 |
| 18 | 3300003659 | JGI25404J52841_10006796 | JGI25404J52841_100067962 | 157 |
| 19 | 3300003752 | Ga0055539_1007105 | Ga0055539_10071052 | 157 |
| 20 | 3300003775 | Ga0055524_1000377 | Ga0055524_100037729 | 157 |
| 21 | 3300005289 | Ga0065704_10295971 | Ga0065704_102959712 | 157 |
| 22 | 3300005327 | Ga0070658_10026608 | Ga0070658_100266085 | 157 |
| 23 | 3300005327 | Ga0070658_11107088 | Ga0070658_111070881 | 157 |
| 24 | 3300005329 | Ga0070683_100045939 | Ga0070683_1000459392 | 157 |
| 25 | 3300005329 | Ga0070683_100098556 | Ga0070683_1000985563 | 157 |
| 26 | 3300005336 | Ga0070680_100520042 | Ga0070680_1005200421 | 157 |
| 27 | 3300005337 | Ga0070682_100427857 | Ga0070682_1004278572 | 157 |
| 28 | 3300005340 | Ga0070689_100587306 | Ga0070689_1005873062 | 157 |
| 29 | 3300005355 | Ga0070671_100223116 | Ga0070671_1002231162 | 157 |
| 30 | 3300005434 | Ga0070709_10004622 | Ga0070709_100046226 | 157 |
| 31 | 3300005435 | Ga0070714_100003003 | Ga0070714_1000030034 | 157 |
| 32 | 3300005436 | Ga0070713_100042139 | Ga0070713_1000421393 | 157 |
| 33 | 3300005437 | Ga0070710_10002230 | Ga0070710_100022302 | 157 |
| 34 | 3300005439 | Ga0070711_100025527 | Ga0070711_1000255275 | 157 |
| 35 | 3300005458 | Ga0070681_10119636 | Ga0070681_101196363 | 157 |
| 36 | 3300005535 | Ga0070684_100007593 | Ga0070684_1000075933 | 157 |
| 37 | 3300005539 | Ga0068853_100714120 | Ga0068853_1007141202 | 157 |
| 38 | 3300005546 | Ga0070696_100224186 | Ga0070696_1002241861 | 157 |
| 39 | 3300005548 | Ga0070665_100142334 | Ga0070665_1001423343 | 157 |
| 40 | 3300005548 | Ga0070665_101266930 | Ga0070665_1012669302 | 157 |
| 41 | 3300005563 | Ga0068855_100255047 | Ga0068855_1002550472 | 157 |
| 42 | 3300005563 | Ga0068855_100421067 | Ga0068855_1004210672 | 157 |
| 43 | 3300005564 | Ga0070664_100316690 | Ga0070664_1003166902 | 157 |
| 44 | 3300005577 | Ga0068857_100263999 | Ga0068857_1002639993 | 157 |
| 45 | 3300005578 | Ga0068854_100845733 | Ga0068854_1008457331 | 157 |
| 46 | 3300005614 | Ga0068856_100255117 | Ga0068856_1002551172 | 157 |
| 47 | 3300005617 | Ga0068859_100334545 | Ga0068859_1003345451 | 157 |
| 48 | 3300005842 | Ga0068858_101761822 | Ga0068858_1017618221 | 157 |
| 49 | 3300005937 | Ga0081455_10000431 | Ga0081455_100004312 | 157 |
| 50 | 3300005983 | Ga0081540_1001417 | Ga0081540_10014173 | 157 |
| 51 | 3300005983 | Ga0081540_1002136 | Ga0081540_10021366 | 157 |
| 52 | 3300005983 | Ga0081540_1019939 | Ga0081540_10199393 | 157 |
| 53 | 3300006028 | Ga0070717_10205935 | Ga0070717_102059352 | 157 |
| 54 | 3300006028 | Ga0070717_10615041 | Ga0070717_106150412 | 157 |
| 55 | 3300006048 | Ga0075363_100129923 | Ga0075363_1001299233 | 157 |
| 56 | 3300006163 | Ga0070715_10037194 | Ga0070715_100371942 | 157 |
| 57 | 3300006173 | Ga0070716_100012768 | Ga0070716_1000127685 | 157 |
| 58 | 3300006173 | Ga0070716_100037474 | Ga0070716_1000374742 | 157 |
| 59 | 3300006175 | Ga0070712_100031211 | Ga0070712_1000312113 | 157 |
| 60 | 3300006175 | Ga0070712_100151177 | Ga0070712_1001511772 | 157 |
| 61 | 3300006178 | Ga0075367_10174958 | Ga0075367_101749583 | 157 |
| 62 | 3300006237 | Ga0097621_101358655 | Ga0097621_1013586552 | 157 |
| 63 | 3300006358 | Ga0068871_101427997 | Ga0068871_1014279972 | 157 |
| 64 | 3300006931 | Ga0097620_100262079 | Ga0097620_1002620792 | 157 |
| 65 | 3300006931 | Ga0097620_100334553 | Ga0097620_1003345531 | 157 |
| 66 | 3300009093 | Ga0105240_10182260 | Ga0105240_101822602 | 157 |
| 67 | 3300009093 | Ga0105240_10397817 | Ga0105240_103978172 | 157 |
| 68 | 3300009101 | Ga0105247_10070068 | Ga0105247_100700682 | 157 |
| 69 | 3300009551 | Ga0105238_10090676 | Ga0105238_100906763 | 157 |
| 70 | 3300009553 | Ga0105249_11760242 | Ga0105249_117602421 | 157 |
| 71 | 3300013100 | Ga0157373_10094205 | Ga0157373_100942051 | 157 |
| 72 | 3300013102 | Ga0157371_10191265 | Ga0157371_101912652 | 157 |
| 73 | 3300013104 | Ga0157370_10313323 | Ga0157370_103133231 | 157 |
| 74 | 3300013104 | Ga0157370_10591066 | Ga0157370_105910661 | 157 |
| 75 | 3300013104 | Ga0157370_10711095 | Ga0157370_107110951 | 157 |
| 76 | 3300013105 | Ga0157369_10024228 | Ga0157369_100242282 | 157 |
| 77 | 3300013105 | Ga0157369_10056517 | Ga0157369_100565171 | 157 |
| 78 | 3300013307 | Ga0157372_10035057 | Ga0157372_100350572 | 157 |
| 79 | 3300013308 | Ga0157375_11340312 | Ga0157375_113403121 | 157 |
| 80 | 3300014326 | Ga0157380_10273531 | Ga0157380_102735314 | 157 |
| 81 | 3300014745 | Ga0157377_10163932 | Ga0157377_101639323 | 157 |
| 82 | 3300015684 | Ga0183365_10002 | Ga0183365_10002182 | 157 |
| 83 | 3300020075 | Ga0206349_1383225 | Ga0206349_13832252 | 157 |
| 84 | 3300020078 | Ga0206352_10285815 | Ga0206352_102858151 | 157 |
| 85 | 3300020082 | Ga0206353_10468945 | Ga0206353_104689451 | 157 |
| 86 | 3300021384 | Ga0213876_10080681 | Ga0213876_100806812 | 157 |
| 87 | 3300021384 | Ga0213876_10114382 | Ga0213876_101143822 | 157 |
| 88 | 3300021388 | Ga0213875_10000085 | Ga0213875_1000008512 | 157 |
| 89 | 3300025206 | Ga0209435_100091 | Ga0209435_10009114 | 157 |
| 90 | 3300025246 | Ga0209646_1000295 | Ga0209646_100029514 | 157 |
| 91 | 3300025250 | Ga0209026_1000366 | Ga0209026_100036614 | 157 |
| 92 | 3300025253 | Ga0209677_101028 | Ga0209677_1010288 | 157 |
| 93 | 3300025256 | Ga0209759_1000513 | Ga0209759_100051332 | 157 |
| 94 | 3300025261 | Ga0209233_1001723 | Ga0209233_10017234 | 157 |
| 95 | 3300025272 | Ga0209455_1009152 | Ga0209455_10091522 | 157 |
| 96 | 3300025294 | Ga0209025_1068367 | Ga0209025_10683672 | 157 |
| 97 | 3300025299 | Ga0209256_1000073 | Ga0209256_1000073142 | 157 |
| 98 | 3300025898 | Ga0207692_10009279 | Ga0207692_100092792 | 157 |
| 99 | 3300025900 | Ga0207710_10061915 | Ga0207710_100619152 | 157 |
| 100 | 3300025906 | Ga0207699_10005319 | Ga0207699_100053196 | 157 |
| 101 | 3300025909 | Ga0207705_10072707 | Ga0207705_100727074 | 157 |
| 102 | 3300025909 | Ga0207705_10692873 | Ga0207705_106928732 | 157 |
| 103 | 3300025913 | Ga0207695_10197929 | Ga0207695_101979292 | 157 |
| 104 | 3300025913 | Ga0207695_10352129 | Ga0207695_103521292 | 157 |
| 105 | 3300025913 | Ga0207695_10621222 | Ga0207695_106212222 | 157 |
| 106 | 3300025914 | Ga0207671_10949039 | Ga0207671_109490392 | 157 |
| 107 | 3300025915 | Ga0207693_10018282 | Ga0207693_100182823 | 157 |
| 108 | 3300025915 | Ga0207693_10019254 | Ga0207693_100192544 | 157 |
| 109 | 3300025916 | Ga0207663_10004356 | Ga0207663_1000435610 | 157 |
| 110 | 3300025924 | Ga0207694_10132791 | Ga0207694_101327912 | 157 |
| 111 | 3300025928 | Ga0207700_10019023 | Ga0207700_100190232 | 157 |
| 112 | 3300025928 | Ga0207700_10386400 | Ga0207700_103864002 | 157 |
| 113 | 3300025929 | Ga0207664_10007739 | Ga0207664_100077395 | 157 |
| 114 | 3300025936 | Ga0207670_10118435 | Ga0207670_101184353 | 157 |
| 115 | 3300025939 | Ga0207665_10020174 | Ga0207665_100201745 | 157 |
| 116 | 3300025941 | Ga0207711_10447219 | Ga0207711_104472193 | 157 |
| 117 | 3300025941 | Ga0207711_11218043 | Ga0207711_112180432 | 157 |
| 118 | 3300025944 | Ga0207661_10000232 | Ga0207661_1000023226 | 157 |
| 119 | 3300025949 | Ga0207667_10187557 | Ga0207667_101875572 | 157 |
| 120 | 3300025960 | Ga0207651_10251028 | Ga0207651_102510282 | 157 |
| 121 | 3300026035 | Ga0207703_10432849 | Ga0207703_104328491 | 157 |
| 122 | 3300026035 | Ga0207703_11142236 | Ga0207703_111422362 | 157 |
| 123 | 3300026041 | Ga0207639_10631213 | Ga0207639_106312131 | 157 |
| 124 | 3300026078 | Ga0207702_10275012 | Ga0207702_102750122 | 157 |
| 125 | 3300026088 | Ga0207641_10963158 | Ga0207641_109631582 | 157 |
| 126 | 3300026088 | Ga0207641_11298272 | Ga0207641_112982721 | 157 |
| 127 | 3300026118 | Ga0207675_101261414 | Ga0207675_1012614141 | 157 |
| 128 | 3300028556 | Ga0265337_1009412 | Ga0265337_10094122 | 157 |
| 129 | 3300028558 | Ga0265326_10150151 | Ga0265326_101501511 | 157 |
| 130 | 3300028563 | Ga0265319_1010077 | Ga0265319_10100772 | 157 |
| 131 | 3300028653 | Ga0265323_10002640 | Ga0265323_1000264012 | 157 |
| 132 | 3300028653 | Ga0265323_10003237 | Ga0265323_100032372 | 157 |
| 133 | 3300028654 | Ga0265322_10015840 | Ga0265322_100158402 | 157 |
| 134 | 3300028666 | Ga0265336_10000428 | Ga0265336_1000042828 | 157 |
| 135 | 3300028800 | Ga0265338_10000094 | Ga0265338_100000942 | 157 |
| 136 | 3300031249 | Ga0265339_10036479 | Ga0265339_100364792 | 157 |
| 137 | 3300031250 | Ga0265331_10030058 | Ga0265331_100300584 | 157 |
| 138 | 3300031456 | Ga0307513_10056064 | Ga0307513_100560644 | 157 |
| 139 | 3300031548 | Ga0307408_100997910 | Ga0307408_1009979102 | 157 |
| 140 | 3300031616 | Ga0307508_10174458 | Ga0307508_101744584 | 157 |
| 141 | 3300031711 | Ga0265314_10019064 | Ga0265314_100190642 | 157 |
| 142 | 3300031712 | Ga0265342_10028873 | Ga0265342_100288734 | 157 |
| 143 | 3300031852 | Ga0307410_10770932 | Ga0307410_107709322 | 157 |
| 144 | 3300031911 | Ga0307412_11046261 | Ga0307412_110462612 | 157 |
| 145 | 3300033180 | Ga0307510_10006737 | Ga0307510_1000673712 | 157 |
| 146 | 3300035115 | Ga0373941_0396440 | Ga0373941_0396440_21_494 | 157 |
| 147 | 3300035692 | Ga0373935_0048405 | Ga0373935_0048405_853_1329 | 157 |
| 148 | 3300035724 | Ga0373933_0000031 | Ga0373933_0000031_6830_7303 | 157 |
| 149 | 3300037068 | Ga0373925_0463012 | Ga0373925_0463012_545_1018 | 157 |
| 150 | 3300037068 | Ga0373925_1165355 | Ga0373925_1165355_45_518 | 157 |
| 151 | 3300037418 | Ga0395900_0011713 | Ga0395900_0011713_6753_7232 | 157 |
| 152 | 3300037466 | Ga0395898_0482615 | Ga0395898_0482615_415_894 | 157 |
| 153 | 3300037471 | Ga0395905_0340557 | Ga0395905_0340557_199_672 | 157 |
| 154 | 3300037853 | Ga0436364_0222016 | Ga0436364_0222016_45788_46261 | 157 |
| 155 | 3300037853 | Ga0436364_0874918 | Ga0436364_0874918_324_797 | 157 |
| 156 | 3300037853 | Ga0436364_1241478 | Ga0436364_1241478_98_586 | 157 |
| 157 | 3300038443 | Ga0395901_0168042 | Ga0395901_0168042_408_887 | 157 |
| 158 | 3300038443 | Ga0395901_1547440 | Ga0395901_1547440_71_547 | 157 |
| 159 | 3300039437 | Ga0436365_0126117 | Ga0436365_0126117_11_490 | 157 |
| 160 | 3300039437 | Ga0436365_0128891 | Ga0436365_0128891_252_731 | 157 |
| 161 | 3300039437 | Ga0436365_0533844 | Ga0436365_0533844_845_1318 | 157 |
| 162 | 3300039437 | Ga0436365_0899481 | Ga0436365_0899481_116_589 | 157 |
| 163 | 3300039437 | Ga0436365_0901770 | Ga0436365_0901770_609_1082 | 157 |
| 164 | 3300039437 | Ga0436365_1655368 | Ga0436365_1655368_23_541 | 157 |
| 165 | 3300039450 | Ga0436363_0525522 | Ga0436363_0525522_2097_2582 | 157 |
| 166 | 3300039453 | Ga0436362_0322292 | Ga0436362_0322292_414_887 | 157 |
| 167 | 3300042876 | Ga0451577_0190374 | Ga0451577_0190374_1050_1547 | 157 |
| 168 | 3300044656 | Ga0466969_0137762 | Ga0466969_0137762_78_551 | 157 |
| 169 | 3300044684 | Ga0466966_0024491 | Ga0466966_0024491_1796_2269 | 157 |
| 170 | 3300044712 | Ga0453684_0811112 | Ga0453684_0811112_30_527 | 157 |
| 171 | 3300044719 | Ga0466971_0072005 | Ga0466971_0072005_115_588 | 157 |
| 172 | 3300044765 | Ga0466970_0572160 | Ga0466970_0572160_153_626 | 157 |
| 173 | 3300044842 | Ga0466957_0403905 | Ga0466957_0403905_357_830 | 157 |
| 174 | 3300045049 | Ga0466959_0058000 | Ga0466959_0058000_1534_2007 | 157 |
| 175 | 3300045049 | Ga0466959_0173417 | Ga0466959_0173417_459_941 | 157 |
| 176 | 3300046471 | Ga0495650_0114249 | Ga0495650_0114249_473_946 | 157 |
| 177 | 3300046507 | Ga0495606_0006063 | Ga0495606_0006063_2650_3123 | 157 |
| 178 | 3300046507 | Ga0495606_0296804 | Ga0495606_0296804_267_746 | 157 |
| 179 | 3300046512 | Ga0495610_0002231 | Ga0495610_0002231_15449_15922 | 157 |
| 180 | 3300046515 | Ga0495620_0083826 | Ga0495620_0083826_308_781 | 157 |
| 181 | 3300046517 | Ga0495630_1269810 | Ga0495630_1269810_71_544 | 157 |
| 182 | 3300046522 | Ga0495643_0053979 | Ga0495643_0053979_441_914 | 157 |
| 183 | 3300046665 | Ga0495661_0188811 | Ga0495661_0188811_103_576 | 157 |
| 184 | 3300046692 | Ga0495671_0145077 | Ga0495671_0145077_487_960 | 157 |
| 185 | 3300047469 | Ga0495673_0060757 | Ga0495673_0060757_456_929 | 157 |
| 186 | 3300047472 | Ga0495686_0003677 | Ga0495686_0003677_473_946 | 157 |
| 187 | 3300047472 | Ga0495686_0053879 | Ga0495686_0053879_706_1185 | 157 |
| 188 | 3300048903 | Ga0496100_0718240 | Ga0496100_0718240_205_678 | 157 |
| 189 | 3300048913 | Ga0496110_0206734 | Ga0496110_0206734_432_911 | 157 |
| 190 | 3300048919 | Ga0496116_0076098 | Ga0496116_0076098_1513_2001 | 157 |
| 191 | 3300048920 | Ga0496117_0160730 | Ga0496117_0160730_315_788 | 157 |
| 192 | 3300048922 | Ga0496119_0064077 | Ga0496119_0064077_810_1283 | 157 |
| 193 | 3300048924 | Ga0496121_0045378 | Ga0496121_0045378_2714_3187 | 157 |
| 194 | 3300048925 | Ga0496122_0428846 | Ga0496122_0428846_51_530 | 157 |
| 195 | 3300048926 | Ga0496123_0016295 | Ga0496123_0016295_4695_5174 | 157 |
| 196 | 3300048927 | Ga0496124_0003763 | Ga0496124_0003763_14933_15412 | 157 |
| 197 | 3300048927 | Ga0496124_0397721 | Ga0496124_0397721_51_524 | 157 |
| 198 | 3300048928 | Ga0496125_0043820 | Ga0496125_0043820_2838_3317 | 157 |
| 199 | 3300048928 | Ga0496125_0051139 | Ga0496125_0051139_2491_2970 | 157 |
| 200 | 3300048929 | Ga0496126_0026322 | Ga0496126_0026322_1086_1565 | 157 |
| 201 | 3300048929 | Ga0496126_0067049 | Ga0496126_0067049_2675_3154 | 157 |
| 202 | 3300049459 | Ga0495678_068359 | Ga0495678_068359_483_956 | 157 |
| 203 | 3300049569 | Ga0501032_0085265 | Ga0501032_0085265_496_975 | 157 |
| 204 | 3300049570 | Ga0501033_0013315 | Ga0501033_0013315_5414_5893 | 157 |
| 205 | 3300049570 | Ga0501033_0351089 | Ga0501033_0351089_200_679 | 157 |
| 206 | 3300049571 | Ga0501034_0001044 | Ga0501034_0001044_32087_32560 | 157 |
| 207 | 3300049571 | Ga0501034_0003233 | Ga0501034_0003233_3088_3561 | 157 |
| 208 | 3300049571 | Ga0501034_0051899 | Ga0501034_0051899_2397_2870 | 157 |
| 209 | 3300049571 | Ga0501034_0055364 | Ga0501034_0055364_3178_3657 | 157 |
| 210 | 3300049571 | Ga0501034_0105408 | Ga0501034_0105408_1052_1531 | 157 |
| 211 | 3300049571 | Ga0501034_0465711 | Ga0501034_0465711_31_519 | 157 |
| 212 | 3300049571 | Ga0501034_1218135 | Ga0501034_1218135_67_585 | 157 |
| 213 | 3300049572 | Ga0501036_0073631 | Ga0501036_0073631_468_941 | 157 |
| 214 | 3300049572 | Ga0501036_0201853 | Ga0501036_0201853_588_1067 | 157 |
| 215 | 3300049573 | Ga0501037_0038024 | Ga0501037_0038024_2648_3121 | 157 |
| 216 | 3300049574 | Ga0501038_0027024 | Ga0501038_0027024_4435_4908 | 157 |
| 217 | 3300049575 | Ga0501039_0097002 | Ga0501039_0097002_640_1113 | 157 |
| 218 | 3300049575 | Ga0501039_0104103 | Ga0501039_0104103_1075_1554 | 157 |
| 219 | 3300049579 | Ga0501043_0227437 | Ga0501043_0227437_805_1284 | 157 |
| 220 | 3300049579 | Ga0501043_0434987 | Ga0501043_0434987_31_510 | 157 |
| 221 | 3300049580 | Ga0501046_0713160 | Ga0501046_0713160_131_610 | 157 |
| 222 | 3300049581 | Ga0501047_0019151 | Ga0501047_0019151_1043_1522 | 157 |
| 223 | 3300049581 | Ga0501047_0049911 | Ga0501047_0049911_2907_3386 | 157 |
| 224 | 3300049581 | Ga0501047_0126224 | Ga0501047_0126224_15_488 | 157 |
| 225 | 3300049581 | Ga0501047_0190484 | Ga0501047_0190484_1327_1806 | 157 |
| 226 | 3300049584 | Ga0501068_0043392 | Ga0501068_0043392_555_1028 | 157 |
| 227 | 3300049584 | Ga0501068_0050379 | Ga0501068_0050379_995_1474 | 157 |
| 228 | 3300049586 | Ga0501070_0037884 | Ga0501070_0037884_1219_1698 | 157 |
| 229 | 3300049586 | Ga0501070_0134890 | Ga0501070_0134890_992_1471 | 157 |
| 230 | 3300049589 | Ga0501073_0045847 | Ga0501073_0045847_1711_2190 | 157 |
| 231 | 3300049589 | Ga0501073_0053869 | Ga0501073_0053869_679_1158 | 157 |
| 232 | 3300049590 | Ga0501074_0992025 | Ga0501074_0992025_91_570 | 157 |
| 233 | 3300049742 | Ga0501080_0019047 | Ga0501080_0019047_4769_5248 | 157 |
| 234 | 3300049742 | Ga0501080_0063680 | Ga0501080_0063680_2466_2945 | 157 |
| 235 | 3300049742 | Ga0501080_0177316 | Ga0501080_0177316_173_646 | 157 |
| 236 | 3300049742 | Ga0501080_0339736 | Ga0501080_0339736_37_516 | 157 |
| 237 | 3300049743 | Ga0501081_0946866 | Ga0501081_0946866_133_633 | 157 |
| 238 | 3300049744 | Ga0501083_0024157 | Ga0501083_0024157_138_611 | 157 |
| 239 | 3300049768 | Ga0501271_013312 | Ga0501271_013312_103_591 | 157 |
| 240 | 3300049822 | Ga0501035_0101765 | Ga0501035_0101765_736_1215 | 157 |
| 241 | 3300049823 | Ga0501044_0002968 | Ga0501044_0002968_17895_18374 | 157 |
| 242 | 3300049823 | Ga0501044_0058031 | Ga0501044_0058031_684_1163 | 157 |
| 243 | 3300049823 | Ga0501044_0068048 | Ga0501044_0068048_877_1350 | 157 |
| 244 | 3300049823 | Ga0501044_0088206 | Ga0501044_0088206_1659_2138 | 157 |
| 245 | 3300049823 | Ga0501044_0134451 | Ga0501044_0134451_578_1051 | 157 |
| 246 | 3300050493 | nmdc:mga0k408_33591_c2 | nmdc:mga0k408_33591_c2_1041_1514 | 157 |
| 247 | 3300053119 | Ga0500595_001391 | Ga0500595_001391_1594_2073 | 157 |
| 248 | 3300053153 | Ga0500616_0039599 | Ga0500616_0039599_547_1020 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u69-assembly2.cif.gz_D | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9714 | 2 | 155 |
| 1u69-assembly3.cif.gz_C | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9702 | 2 | 155 |
| 1u69-assembly1.cif.gz_A | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9586 | 2 | 155 |
| 1u69-assembly2.cif.gz_D | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9584 | 2 | 155 |
| 1u69-assembly3.cif.gz_C | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9574 | 2 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1u69D00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9659 | 2 | 155 | 3.10.180.10 |
| 1u69D00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9528 | 2 | 155 | 3.10.180.10 |
| 4hnvB02 | Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain | 0.7999 | 28 | 63 | 3.10.600.10 |
| 3zl8A02 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.7728 | 27 | 66 | 3.40.1190.10 |
| 1ebdB02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7519 | 27 | 61 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435UWU8-F1-model_v4 | deleted | 0.9945 | 77 | 157 |
|
| AF-A0A1G4T9J9-F1-model_v4 | 3-demethylubiquinone-9 3-methyltransferase | 0.9943 | 78 | 157 |
GO:0008168
GO:0032259 |
| AF-A0A3N5MPH9-F1-model_v4 | VOC family protein | 0.9908 | 74 | 157 |
|
| AF-A0A1C9I172-F1-model_v4 | 3-demethylubiquinone-9 3-methyltransferase | 0.9892 | 52 | 157 |
GO:0008168
GO:0032259 |
| AF-A0A2V8C288-F1-model_v4 | PhnB-like domain-containing protein | 0.9879 | 57 | 156 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar