F359305

General Info

Members Datasets Scaffolds Average Seq Length
247 169 215 317

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0018335|Ga0495648_0018335_3741_4766
Length 341
Sequence MKGNWGINMTDTMRALVVESLAPDFAGCAVREVPTLTPGPGQVLVRVRAASVNFPDLLMTRGEYQFKPPLPFTPGLDLAGEVAALGEGVTGWSVGDAVVGGARLGGFAEYAVLSADALKPKPARLSFGEAAAYGAAYLTAYVALVRRARLEPGEWVLVHGAAGGVGLAAVDLAKALGARVIAASASDAKLAQIQRLYAPDAVVNVTDGFREQVKAITGGHGADVIYDPVGGDVFDESVRCIAFDGRLLVIGFTSGRIPNVSVNMPLIKGFSVMGVRAGEYGRQFPEKGRENAEAVWRMADEGVIRPHVHAELPLDRWREAFELLANRQVVGKAVIRPDLPG

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2517572101 Frankia sp. DC12 Isolate Nodule
4 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
5 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
6 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
7 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
8 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
9 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
10 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
11 2643221583 Caulobacter sp. Root655 Isolate Unclassified
12 2643221584 Caulobacter sp. Root656 Isolate Unclassified
13 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
14 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
15 2643221640 Caulobacter sp. Root342 Isolate Unclassified
16 2643221642 Caulobacter sp. Root343 Isolate Unclassified
17 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
18 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
19 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
24 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
25 2849560528 Caulobacter zeae 410 Isolate Unclassified
26 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
27 2851153111 Caulobacter radicis 736 Isolate Unclassified
28 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
29 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
30 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
31 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
32 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
121 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
155 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
158 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
159 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
160 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
161 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.04
Metatranscriptomes 0
Isolates 12.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.48
Nodule 0.81
Rhizoplane 1.62
Rhizosphere 61.13
Stem 0
Stem Tuber 0.4
Unclassified 12.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10002795 3300003320 Bacteria 3470
2 rootL2_10042783 3300003322 Bacteria 9470
3 Ga0055526_1021471 3300003771 Bacteria 2245
4 Ga0055537_1002937 3300003773 Bacteria 5422
5 Ga0055524_1027796 3300003775 Bacteria 1707
6 Ga0055536_1002914 3300003781 Bacteria 9395
7 Ga0055536_1003512 3300003781 Bacteria 8396
8 Ga0055536_1004154 3300003781 Bacteria 7497
9 Ga0055536_1004156 3300003781 Bacteria 7496
10 Ga0055536_1004159 3300003781 Bacteria 7494
11 Ga0055536_1023008 3300003781 Bacteria 1843
12 Ga0055528_1008178 3300003790 Bacteria 4524
13 Ga0055530_10000949 3300003791 Bacteria 23707
14 Ga0055530_10007949 3300003791 Bacteria 4342
15 Ga0055531_10001263 3300003794 Bacteria 19144
16 Ga0055531_10001330 3300003794 Bacteria 18455
17 Ga0055531_10013985 3300003794 Bacteria 3653
18 Ga0065165_1001262 3300005262 Bacteria 28613
19 Ga0065165_1006945 3300005262 Bacteria 5740
20 Ga0070670_100031404 3300005331 Bacteria 4574
21 Ga0070668_100022010 3300005347 Bacteria 4818
22 Ga0070668_100039922 3300005347 Bacteria 3590
23 Ga0070669_100012467 3300005353 Bacteria 6031
24 Ga0070667_100012081 3300005367 Bacteria 7149
25 Ga0068855_100257792 3300005563 Bacteria 1944
26 Ga0068854_100034855 3300005578 Bacteria 3519
27 Ga0068859_100013271 3300005617 Bacteria 8265
28 Ga0068861_100358237 3300005719 Bacteria 1282
29 Ga0068863_100032251 3300005841 Bacteria 4993
30 Ga0068860_100000226 3300005843 Bacteria 87552
31 Ga0068860_100004103 3300005843 Bacteria 14913
32 Ga0068862_100013756 3300005844 Bacteria 6706
33 Ga0068862_100270423 3300005844 Bacteria 1554
34 Ga0070712_100001904 3300006175 Bacteria 12753
35 Ga0075369_10017354 3300006186 Bacteria 2916
36 Ga0075428_100002603 3300006844 Bacteria 19620
37 Ga0097620_100013270 3300006931 Bacteria 8265
38 Ga0105240_10000206 3300009093 Bacteria 119835
39 Ga0105240_10128849 3300009093 Bacteria 3037
40 Ga0111539_10036787 3300009094 Bacteria 5915
41 Ga0105248_10685704 3300009177 Bacteria 1156
42 Ga0105237_10000715 3300009545 Bacteria 45940
43 Ga0105237_10320675 3300009545 Bacteria 1553
44 Ga0157373_10006014 3300013100 Bacteria 9073
45 Ga0157373_10009367 3300013100 Bacteria 7237
46 Ga0157369_10094975 3300013105 Bacteria 3182
47 Ga0157372_10095017 3300013307 Bacteria 3396
48 Ga0157379_10011036 3300014968 Bacteria 7874
49 Ga0209565_1000402 3300025263 Bacteria 36267
50 Ga0209673_1002756 3300025273 Bacteria 11496
51 Ga0209676_1000043 3300025292 Bacteria 418680
52 Ga0209676_1002709 3300025292 Bacteria 11951
53 Ga0209564_1010368 3300025295 Bacteria 4300
54 Ga0209758_1000654 3300025297 Bacteria 52302
55 Ga0209758_1002783 3300025297 Bacteria 17108
56 Ga0209758_1005534 3300025297 Bacteria 9640
57 Ga0209050_1000173 3300025298 Bacteria 149800
58 Ga0209050_1000793 3300025298 Bacteria 44679
59 Ga0209050_1001099 3300025298 Bacteria 32819
60 Ga0209256_1000829 3300025299 Bacteria 39149
61 Ga0209256_1011196 3300025299 Bacteria 3622
62 Ga0209256_1014461 3300025299 Bacteria 2838
63 Ga0209051_1001909 3300025303 Bacteria 16211
64 Ga0209257_1000036 3300025304 Bacteria 616006
65 Ga0209257_1000134 3300025304 Bacteria 207628
66 Ga0209257_1000196 3300025304 Bacteria 149656
67 Ga0209257_1005157 3300025304 Bacteria 9428
68 Ga0207695_10000340 3300025913 Bacteria 110235
69 Ga0207695_10100999 3300025913 Bacteria 2880
70 Ga0207671_10000865 3300025914 Bacteria 38348
71 Ga0207650_10298357 3300025925 Bacteria 1315
72 Ga0207711_10140841 3300025941 Bacteria 2170
73 Ga0207668_10001729 3300025972 Bacteria 12793
74 Ga0207668_10002616 3300025972 Bacteria 10531
75 Ga0207658_10028243 3300025986 Bacteria 3949
76 Ga0207703_10078884 3300026035 Bacteria 2737
77 Ga0207641_10011460 3300026088 Bacteria 7278
78 Ga0207675_100014177 3300026118 Bacteria 7433
79 Ga0207698_10550435 3300026142 Bacteria 1131
80 Ga0268265_10001536 3300028380 Bacteria 19196
81 Ga0268265_10010244 3300028380 Bacteria 6331
82 Ga0268264_10000110 3300028381 Bacteria 206663
83 Ga0268264_10008703 3300028381 Bacteria 8431
84 Ga0307515_10168648 3300028794 Bacteria 2194
85 Ga0307515_10241959 3300028794 Bacteria 1573
86 Ga0265338_10008421 3300028800 Bacteria 12525
87 Ga0265340_10016214 3300031247 Unclassified 3862
88 Ga0265327_10000280 3300031251 Bacteria 100757
89 Ga0265327_10003270 3300031251 Bacteria 15700
90 Ga0307414_10173058 3300032004 Bacteria 1728
91 Ga0307510_10131376 3300033180 Bacteria 2175
92 Ga0395899_0000498 3300037312 Bacteria 43627
93 Ga0395900_0000008 3300037418 Bacteria 480459
94 Ga0395900_0008575 3300037418 Bacteria 10508
95 Ga0395901_0000008 3300038443 Bacteria 495962
96 Ga0395901_0127744 3300038443 Bacteria 2672
97 Ga0436365_0590560 3300039437 Bacteria 3402
98 Ga0436361_0177120 3300039447 Bacteria 8563
99 Ga0436362_0769434 3300039453 Bacteria 2711
100 Ga0439435_0063543 3300042436 Bacteria 1080
101 Ga0453684_0161113 3300044712 Bacteria 2654
102 Ga0495627_001705 3300046453 Bacteria 12027
103 Ga0495590_0059711 3300046457 Bacteria 1334
104 Ga0495638_0000958 3300046460 Bacteria 29269
105 Ga0495638_0001620 3300046460 Bacteria 20035
106 Ga0495638_0001650 3300046460 Bacteria 19756
107 Ga0495638_0013070 3300046460 Bacteria 5667
108 Ga0495638_0102558 3300046460 Bacteria 1709
109 Ga0495650_0000403 3300046471 Bacteria 71792
110 Ga0495583_0000013 3300046506 Bacteria 323372
111 Ga0495606_0007407 3300046507 Bacteria 9838
112 Ga0495606_0025778 3300046507 Bacteria 4202
113 Ga0495610_0000484 3300046512 Bacteria 40825
114 Ga0495610_0000611 3300046512 Bacteria 35413
115 Ga0495610_0009526 3300046512 Bacteria 6129
116 Ga0495616_0000172 3300046513 Bacteria 54960
117 Ga0495616_0081105 3300046513 Bacteria 1552
118 Ga0495632_0008804 3300046519 Bacteria 6148
119 Ga0495632_0024494 3300046519 Bacteria 3204
120 Ga0495632_0027036 3300046519 Bacteria 3011
121 Ga0495637_0002369 3300046520 Bacteria 10445
122 Ga0495637_0067269 3300046520 Bacteria 1454
123 Ga0495648_0000067 3300046524 Bacteria 140250
124 Ga0495648_0018335 3300046524 Bacteria 4960
125 Ga0495642_0001770 3300046528 Bacteria 9314
126 Ga0495654_0000023 3300046530 Bacteria 243798
127 Ga0495609_0041049 3300046538 Bacteria 2081
128 Ga0495668_0000061 3300046616 Bacteria 192499
129 Ga0495668_0013690 3300046616 Bacteria 4774
130 Ga0495668_0042549 3300046616 Bacteria 2529
131 Ga0495625_0000081 3300046660 Bacteria 156254
132 Ga0495625_0000590 3300046660 Bacteria 52780
133 Ga0495625_0052260 3300046660 Bacteria 2926
134 Ga0495625_0071935 3300046660 Bacteria 2426
135 Ga0495625_0090285 3300046660 Bacteria 2119
136 Ga0495625_0159040 3300046660 Bacteria 1514
137 Ga0495625_0190760 3300046660 Bacteria 1358
138 Ga0495589_0026969 3300046794 Bacteria 2908
139 Ga0495660_0069595 3300046810 Bacteria 1870
140 Ga0495672_0000311 3300047320 Bacteria 65012
141 Ga0495679_008954 3300047446 Bacteria 4035
142 Ga0495673_0000025 3300047469 Bacteria 512352
143 Ga0495673_0000549 3300047469 Bacteria 38306
144 Ga0495673_0010307 3300047469 Bacteria 5093
145 Ga0495686_0000049 3300047472 Bacteria 275004
146 Ga0495686_0002855 3300047472 Bacteria 15568
147 Ga0495686_0006183 3300047472 Bacteria 9248
148 Ga0495686_0044957 3300047472 Bacteria 2795
149 Ga0495686_0069302 3300047472 Bacteria 2174
150 Ga0495686_0209161 3300047472 Bacteria 1115
151 Ga0496101_0073407 3300048904 Bacteria 2513
152 Ga0496106_0038539 3300048909 Bacteria 3577
153 Ga0496107_0000063 3300048910 Bacteria 52938
154 Ga0496115_0003621 3300048918 Bacteria 11112
155 Ga0496119_0000334 3300048922 Bacteria 65883
156 Ga0496120_0000481 3300048923 Bacteria 62579
157 Ga0496121_0004008 3300048924 Bacteria 20291
158 Ga0496121_0137884 3300048924 Bacteria 1815
159 Ga0496126_0002250 3300048929 Bacteria 26630
160 Ga0496126_0243646 3300048929 Bacteria 1501
161 Ga0495678_000322 3300049459 Bacteria 51143
162 Ga0501032_0001988 3300049569 Bacteria 16106
163 Ga0501034_0039979 3300049571 Bacteria 4749
164 Ga0501034_0116544 3300049571 Bacteria 2659
165 Ga0501034_0246054 3300049571 Bacteria 1733
166 Ga0501034_0408547 3300049571 Bacteria 1280
167 Ga0501036_0183517 3300049572 Bacteria 1761
168 Ga0501043_0027816 3300049579 Bacteria 4439
169 Ga0501047_0005686 3300049581 Bacteria 11733
170 Ga0501047_0163712 3300049581 Bacteria 2095
171 Ga0501067_0000017 3300049583 Bacteria 102087
172 Ga0501067_0005903 3300049583 Bacteria 6786
173 Ga0501067_0159261 3300049583 Bacteria 1257
174 Ga0501068_0000351 3300049584 Bacteria 23110
175 Ga0501072_0003016 3300049588 Bacteria 12697
176 Ga0501073_0000011 3300049589 Bacteria 161823
177 Ga0501073_0000124 3300049589 Bacteria 50139
178 Ga0501074_0045343 3300049590 Bacteria 3181
179 Ga0501077_0000011 3300049593 Bacteria 96805
180 Ga0501257_015737 3300049686 Bacteria 1749
181 Ga0501079_0116952 3300049741 Bacteria 2073
182 Ga0501080_0000388 3300049742 Bacteria 33889
183 Ga0501080_0114235 3300049742 Bacteria 2503
184 Ga0501083_0023732 3300049744 Bacteria 4254
185 Ga0501083_0041172 3300049744 Bacteria 3133
186 Ga0501083_0122423 3300049744 Bacteria 1706
187 Ga0501044_0012598 3300049823 Bacteria 9158
188 Ga0501044_0073631 3300049823 Bacteria 3471
189 nmdc:mga09592_394705_c1 3300050508 Bacteria 1196
190 nmdc:mga08y16_104122_c1 3300050511 Bacteria 2954
191 nmdc:mga0sz30_3563_c1 3300050516 Bacteria 5616
192 Ga0500578_0000161 3300053086 Bacteria 79058
193 Ga0500578_0051813 3300053086 Bacteria 2629
194 Ga0500643_031146 3300053087 Bacteria 1629
195 Ga0500644_0000166 3300053088 Bacteria 41856
196 Ga0500554_026082 3300053102 Bacteria 1675
197 Ga0500556_0000895 3300053104 Bacteria 16661
198 Ga0500562_023559 3300053108 Bacteria 1607
199 Ga0500592_009120 3300053116 Bacteria 1576
200 Ga0500594_0000263 3300053118 Bacteria 12318
201 Ga0500595_024451 3300053119 Bacteria 2108
202 Ga0500608_000239 3300053122 Bacteria 21608
203 Ga0500618_000180 3300053125 Bacteria 52492
204 Ga0500559_0000153 3300053136 Bacteria 54641
205 Ga0500559_0024409 3300053136 Bacteria 2572
206 Ga0500564_001600 3300053138 Bacteria 7932
207 Ga0500616_0027139 3300053153 Bacteria 3164
208 Ga0500622_0070986 3300053156 Bacteria 1760
209 Ga0500622_0124417 3300053156 Bacteria 1247
210 Ga0500645_011687 3300053730 Bacteria 2857
211 Ga0500609_001003 3300053731 Bacteria 4228
212 Ga0501084_0045442 3300054114 Bacteria 3676
213 Ga0501082_0025486 3300060353 Bacteria 5095
214 Ga0501082_0062486 3300060353 Bacteria 3206
215 Ga0501082_0564755 3300060353 Bacteria 995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0564755 Ga0501082_0564755_184_978 245
2 3300048929 Ga0496126_0243646 Ga0496126_0243646_634_1479 281
3 3300049571 Ga0501034_0408547 Ga0501034_0408547_15_860 281
4 3300046507 Ga0495606_0025778 Ga0495606_0025778_3286_4173 284
5 3300049571 Ga0501034_0039979 Ga0501034_0039979_3171_4154 291
6 3300049571 Ga0501034_0116544 Ga0501034_0116544_759_1742 291
7 3300049569 Ga0501032_0001988 Ga0501032_0001988_11948_12931 292
8 3300049572 Ga0501036_0183517 Ga0501036_0183517_178_1161 292
9 3300049583 Ga0501067_0000017 Ga0501067_0000017_77465_78448 292
10 3300049584 Ga0501068_0000351 Ga0501068_0000351_4092_5075 292
11 3300049589 Ga0501073_0000011 Ga0501073_0000011_625_1608 292
12 3300049593 Ga0501077_0000011 Ga0501077_0000011_4239_5222 292
13 3300049742 Ga0501080_0000388 Ga0501080_0000388_32409_33392 292
14 3300049744 Ga0501083_0122423 Ga0501083_0122423_127_1110 292
15 3300049823 Ga0501044_0012598 Ga0501044_0012598_6039_7022 292
16 iso_pu_bacteria 2824679649 2824682456 292
17 3300053153 Ga0500616_0027139 Ga0500616_0027139_2253_3140 293
18 3300046660 Ga0495625_0159040 Ga0495625_0159040_603_1499 297
19 3300006186 Ga0075369_10017354 Ga0075369_100173542 298
20 3300050516 nmdc:mga0sz30_3563_c1 nmdc:mga0sz30_3563_c1_2262_3239 298
21 3300046810 Ga0495660_0069595 Ga0495660_0069595_556_1539 299
22 3300046519 Ga0495632_0008804 Ga0495632_0008804_4089_5084 302
23 3300003781 Ga0055536_1003512 Ga0055536_10035121 303
24 3300003781 Ga0055536_1004154 Ga0055536_10041549 303
25 3300003781 Ga0055536_1004156 Ga0055536_10041561 303
26 3300003781 Ga0055536_1004159 Ga0055536_10041599 303
27 3300003781 Ga0055536_1023008 Ga0055536_10230081 303
28 3300003794 Ga0055531_10001330 Ga0055531_1000133010 303
29 3300013100 Ga0157373_10006014 Ga0157373_1000601413 303
30 3300025292 Ga0209676_1000043 Ga0209676_100004383 303
31 3300025298 Ga0209050_1001099 Ga0209050_100109913 303
32 3300025304 Ga0209257_1000134 Ga0209257_1000134144 303
33 3300046460 Ga0495638_0102558 Ga0495638_0102558_585_1562 303
34 3300048922 Ga0496119_0000334 Ga0496119_0000334_25840_26826 305
35 3300048923 Ga0496120_0000481 Ga0496120_0000481_22513_23499 305
36 3300005262 Ga0065165_1001262 Ga0065165_10012624 308
37 3300032004 Ga0307414_10173058 Ga0307414_101730582 308
38 3300039437 Ga0436365_0590560 Ga0436365_0590560_2414_3382 308
39 3300039447 Ga0436361_0177120 Ga0436361_0177120_6272_7249 308
40 3300039453 Ga0436362_0769434 Ga0436362_0769434_1089_2057 308
41 3300047472 Ga0495686_0209161 Ga0495686_0209161_98_1075 308
42 3300053108 Ga0500562_023559 Ga0500562_023559_522_1499 308
43 3300053119 Ga0500595_024451 Ga0500595_024451_99_1076 308
44 3300053156 Ga0500622_0070986 Ga0500622_0070986_37_1014 308
45 3300003791 Ga0055530_10000949 Ga0055530_100009494 309
46 3300003794 Ga0055531_10001263 Ga0055531_1000126321 309
47 3300005843 Ga0068860_100004103 Ga0068860_10000410311 309
48 3300005844 Ga0068862_100270423 Ga0068862_1002704232 309
49 3300025297 Ga0209758_1000654 Ga0209758_100065447 309
50 3300025298 Ga0209050_1000173 Ga0209050_100017387 309
51 3300025304 Ga0209257_1000196 Ga0209257_100019687 309
52 3300028381 Ga0268264_10008703 Ga0268264_100087039 309
53 3300044712 Ga0453684_0161113 Ga0453684_0161113_1255_2235 309
54 3300046524 Ga0495648_0000067 Ga0495648_0000067_38422_39399 309
55 3300046528 Ga0495642_0001770 Ga0495642_0001770_4509_5489 309
56 3300053087 Ga0500643_031146 Ga0500643_031146_632_1609 309
57 3300053088 Ga0500644_0000166 Ga0500644_0000166_9570_10547 309
58 3300053104 Ga0500556_0000895 Ga0500556_0000895_10819_11796 309
59 3300053138 Ga0500564_001600 Ga0500564_001600_111_1088 309
60 3300005331 Ga0070670_100031404 Ga0070670_1000314045 310
61 3300005347 Ga0070668_100022010 Ga0070668_1000220103 310
62 3300005353 Ga0070669_100012467 Ga0070669_1000124675 310
63 3300005367 Ga0070667_100012081 Ga0070667_1000120813 310
64 3300005617 Ga0068859_100013271 Ga0068859_1000132716 310
65 3300005841 Ga0068863_100032251 Ga0068863_1000322513 310
66 3300005844 Ga0068862_100013756 Ga0068862_1000137562 310
67 3300006931 Ga0097620_100013270 Ga0097620_1000132706 310
68 3300009177 Ga0105248_10685704 Ga0105248_106857041 310
69 3300025297 Ga0209758_1002783 Ga0209758_10027839 310
70 3300025925 Ga0207650_10298357 Ga0207650_102983572 310
71 3300025941 Ga0207711_10140841 Ga0207711_101408411 310
72 3300025972 Ga0207668_10001729 Ga0207668_100017293 310
73 3300025986 Ga0207658_10028243 Ga0207658_100282432 310
74 3300026088 Ga0207641_10011460 Ga0207641_100114608 310
75 3300026118 Ga0207675_100014177 Ga0207675_1000141778 310
76 3300028380 Ga0268265_10010244 Ga0268265_100102443 310
77 3300037312 Ga0395899_0000498 Ga0395899_0000498_42280_43260 310
78 3300037418 Ga0395900_0000008 Ga0395900_0000008_93896_94876 310
79 3300038443 Ga0395901_0000008 Ga0395901_0000008_385590_386570 310
80 3300046457 Ga0495590_0059711 Ga0495590_0059711_89_1099 310
81 3300046460 Ga0495638_0001650 Ga0495638_0001650_14828_15814 310
82 3300046512 Ga0495610_0000484 Ga0495610_0000484_9957_10943 310
83 3300046520 Ga0495637_0067269 Ga0495637_0067269_326_1309 310
84 3300046660 Ga0495625_0071935 Ga0495625_0071935_1478_2410 310
85 3300047320 Ga0495672_0000311 Ga0495672_0000311_54600_55586 310
86 3300047446 Ga0495679_008954 Ga0495679_008954_1157_2140 310
87 3300047472 Ga0495686_0002855 Ga0495686_0002855_14247_15227 310
88 3300048918 Ga0496115_0003621 Ga0496115_0003621_3125_4117 310
89 3300048924 Ga0496121_0137884 Ga0496121_0137884_323_1300 310
90 3300049581 Ga0501047_0005686 Ga0501047_0005686_2198_3178 310
91 iso_pu_bacteria 2643221614 2644087079 310
92 iso_pu_bacteria 2643221661 2644342033 310
93 iso_pu_bacteria 2643221666 2644368320 310
94 3300003322 rootL2_10042783 rootL2_100427836 311
95 3300005347 Ga0070668_100039922 Ga0070668_1000399224 311
96 3300005719 Ga0068861_100358237 Ga0068861_1003582372 311
97 3300025972 Ga0207668_10002616 Ga0207668_100026162 311
98 3300028380 Ga0268265_10001536 Ga0268265_1000153612 311
99 3300046460 Ga0495638_0013070 Ga0495638_0013070_339_1322 311
100 3300046507 Ga0495606_0007407 Ga0495606_0007407_8391_9374 311
101 3300047472 Ga0495686_0069302 Ga0495686_0069302_480_1466 311
102 3300053086 Ga0500578_0051813 Ga0500578_0051813_612_1595 311
103 3300053102 Ga0500554_026082 Ga0500554_026082_653_1636 311
104 3300028800 Ga0265338_10008421 Ga0265338_100084215 312
105 3300046660 Ga0495625_0190760 Ga0495625_0190760_247_1224 312
106 3300047472 Ga0495686_0000049 Ga0495686_0000049_146034_147017 312
107 3300028794 Ga0307515_10241959 Ga0307515_102419592 313
108 3300042436 Ga0439435_0063543 Ga0439435_0063543_52_1041 313
109 3300046513 Ga0495616_0000172 Ga0495616_0000172_51369_52352 313
110 3300046519 Ga0495632_0024494 Ga0495632_0024494_1938_2933 313
111 3300046519 Ga0495632_0027036 Ga0495632_0027036_1622_2605 313
112 3300046538 Ga0495609_0041049 Ga0495609_0041049_1087_2070 313
113 3300046660 Ga0495625_0090285 Ga0495625_0090285_701_1684 313
114 3300003773 Ga0055537_1002937 Ga0055537_10029374 314
115 3300003790 Ga0055528_1008178 Ga0055528_10081785 314
116 3300005843 Ga0068860_100000226 Ga0068860_10000022657 314
117 3300025263 Ga0209565_1000402 Ga0209565_10004023 314
118 3300025273 Ga0209673_1002756 Ga0209673_10027568 314
119 3300025297 Ga0209758_1005534 Ga0209758_10055349 314
120 3300025299 Ga0209256_1014461 Ga0209256_10144612 314
121 3300028381 Ga0268264_10000110 Ga0268264_10000110148 314
122 3300028794 Ga0307515_10168648 Ga0307515_101686481 314
123 3300046460 Ga0495638_0000958 Ga0495638_0000958_21981_22979 314
124 3300046512 Ga0495610_0009526 Ga0495610_0009526_233_1228 314
125 3300046520 Ga0495637_0002369 Ga0495637_0002369_4686_5693 314
126 3300046794 Ga0495589_0026969 Ga0495589_0026969_1734_2729 314
127 3300048929 Ga0496126_0002250 Ga0496126_0002250_9472_10449 314
128 3300049571 Ga0501034_0246054 Ga0501034_0246054_116_1144 314
129 3300049579 Ga0501043_0027816 Ga0501043_0027816_3292_4320 314
130 3300049581 Ga0501047_0163712 Ga0501047_0163712_939_1967 314
131 3300049583 Ga0501067_0159261 Ga0501067_0159261_90_1118 314
132 3300049589 Ga0501073_0000124 Ga0501073_0000124_940_1968 314
133 3300049741 Ga0501079_0116952 Ga0501079_0116952_787_1815 314
134 3300049742 Ga0501080_0114235 Ga0501080_0114235_179_1207 314
135 3300049744 Ga0501083_0023732 Ga0501083_0023732_38_1066 314
136 3300049823 Ga0501044_0073631 Ga0501044_0073631_2179_3207 314
137 3300053125 Ga0500618_000180 Ga0500618_000180_42566_43561 314
138 3300053731 Ga0500609_001003 Ga0500609_001003_2384_3367 314
139 3300060353 Ga0501082_0062486 Ga0501082_0062486_704_1732 314
140 3300003794 Ga0055531_10013985 Ga0055531_100139851 315
141 3300006844 Ga0075428_100002603 Ga0075428_10000260315 315
142 3300025304 Ga0209257_1000036 Ga0209257_1000036334 315
143 3300046460 Ga0495638_0001620 Ga0495638_0001620_17648_18631 315
144 3300046530 Ga0495654_0000023 Ga0495654_0000023_20923_21927 315
145 3300046616 Ga0495668_0000061 Ga0495668_0000061_48869_49846 315
146 3300046660 Ga0495625_0000590 Ga0495625_0000590_45160_46155 315
147 3300050508 nmdc:mga09592_394705_c1 nmdc:mga09592_394705_c1_119_1111 315
148 3300047472 Ga0495686_0006183 Ga0495686_0006183_6564_7547 316
149 3300048904 Ga0496101_0073407 Ga0496101_0073407_82_1074 316
150 3300048909 Ga0496106_0038539 Ga0496106_0038539_989_1981 316
151 3300048910 Ga0496107_0000063 Ga0496107_0000063_45157_46149 316
152 3300048924 Ga0496121_0004008 Ga0496121_0004008_8423_9415 316
153 3300003775 Ga0055524_1027796 Ga0055524_10277962 317
154 3300025299 Ga0209256_1000829 Ga0209256_100082910 317
155 3300046506 Ga0495583_0000013 Ga0495583_0000013_201855_202850 317
156 iso_pu_bacteria 2517572101 2517763189 317
157 3300047469 Ga0495673_0000549 Ga0495673_0000549_24437_25429 318
158 3300003781 Ga0055536_1002914 Ga0055536_10029142 319
159 3300003791 Ga0055530_10007949 Ga0055530_100079491 319
160 3300025292 Ga0209676_1002709 Ga0209676_10027092 319
161 3300025298 Ga0209050_1000793 Ga0209050_100079311 319
162 3300025303 Ga0209051_1001909 Ga0209051_10019096 319
163 3300025304 Ga0209257_1005157 Ga0209257_10051579 319
164 3300047472 Ga0495686_0044957 Ga0495686_0044957_582_1580 319
165 3300049583 Ga0501067_0005903 Ga0501067_0005903_2364_3341 319
166 3300049588 Ga0501072_0003016 Ga0501072_0003016_5852_6829 319
167 3300049590 Ga0501074_0045343 Ga0501074_0045343_1319_2296 319
168 3300049744 Ga0501083_0041172 Ga0501083_0041172_1022_1999 319
169 3300054114 Ga0501084_0045442 Ga0501084_0045442_476_1453 319
170 3300060353 Ga0501082_0025486 Ga0501082_0025486_2055_3032 319
171 iso_pu_bacteria 2899370129 2899371038 319
172 3300046471 Ga0495650_0000403 Ga0495650_0000403_23769_24800 320
173 3300053136 Ga0500559_0000153 Ga0500559_0000153_44914_45897 320
174 iso_pu_bacteria 2513237104 2513721385 320
175 iso_pu_bacteria 2643221560 2643822374 320
176 3300006175 Ga0070712_100001904 Ga0070712_1000019045 321
177 3300014968 Ga0157379_10011036 Ga0157379_100110369 321
178 3300026035 Ga0207703_10078884 Ga0207703_100788842 321
179 3300047469 Ga0495673_0000025 Ga0495673_0000025_196642_197637 321
180 3300053136 Ga0500559_0024409 Ga0500559_0024409_739_1722 321
181 iso_pu_bacteria 2582581279 2585146539 321
182 iso_pu_bacteria 2643221598 2643998894 321
183 iso_pu_bacteria 2791355048 2792461679 321
184 iso_pu_bacteria 2843744320 2843746138 321
185 iso_pu_bacteria 2849560528 2849561609 321
186 iso_pu_bacteria 2849573788 2849574500 321
187 iso_pu_bacteria 2851153111 2851153886 321
188 iso_pu_bacteria 2857504554 2857507091 321
189 iso_pu_bacteria 2898329390 2898330497 321
190 3300047469 Ga0495673_0010307 Ga0495673_0010307_2101_3084 322
191 3300031247 Ga0265340_10016214 Ga0265340_100162143 323
192 iso_pu_bacteria 2510917020 2511122922 323
193 iso_pu_bacteria 2643221583 2643922875 323
194 3300005563 Ga0068855_100257792 Ga0068855_1002577921 324
195 3300009094 Ga0111539_10036787 Ga0111539_100367876 324
196 3300026142 Ga0207698_10550435 Ga0207698_105504351 324
197 3300050511 nmdc:mga08y16_104122_c1 nmdc:mga08y16_104122_c1_1658_2635 324
198 3300009545 Ga0105237_10000715 Ga0105237_100007154 325
199 3300013100 Ga0157373_10009367 Ga0157373_100093677 325
200 3300025299 Ga0209256_1011196 Ga0209256_10111962 325
201 3300025914 Ga0207671_10000865 Ga0207671_100008654 325
202 3300031251 Ga0265327_10000280 Ga0265327_1000028069 325
203 3300046512 Ga0495610_0000611 Ga0495610_0000611_11398_12375 325
204 3300046513 Ga0495616_0081105 Ga0495616_0081105_450_1427 325
205 3300046616 Ga0495668_0013690 Ga0495668_0013690_1424_2401 325
206 3300053086 Ga0500578_0000161 Ga0500578_0000161_54861_55838 325
207 3300053122 Ga0500608_000239 Ga0500608_000239_13303_14280 325
208 3300053730 Ga0500645_011687 Ga0500645_011687_1522_2499 325
209 3300009093 Ga0105240_10000206 Ga0105240_1000020631 326
210 3300025913 Ga0207695_10000340 Ga0207695_1000034064 326
211 3300003771 Ga0055526_1021471 Ga0055526_10214714 327
212 3300005262 Ga0065165_1006945 Ga0065165_10069453 327
213 3300005578 Ga0068854_100034855 Ga0068854_1000348553 327
214 3300025295 Ga0209564_1010368 Ga0209564_10103682 327
215 3300031251 Ga0265327_10003270 Ga0265327_1000327016 327
216 3300033180 Ga0307510_10131376 Ga0307510_101313762 327
217 3300046660 Ga0495625_0000081 Ga0495625_0000081_14634_15632 327
218 3300049686 Ga0501257_015737 Ga0501257_015737_196_1182 327
219 iso_pu_bacteria 2582581280 2585151660 327
220 iso_pu_bacteria 2582581293 2585195466 327
221 iso_pu_bacteria 2585428106 2587917671 327
222 iso_pu_bacteria 2643221545 2643749176 327
223 iso_pu_bacteria 2643221552 2643781293 327
224 iso_pu_bacteria 2643221584 2643927125 327
225 iso_pu_bacteria 2643221640 2644226811 327
226 iso_pu_bacteria 2643221642 2644233720 327
227 iso_pu_bacteria 2643221691 2644509049 327
228 iso_pu_bacteria 2818991435 2819537478 327
229 iso_pu_bacteria 2818991454 2819646460 327
230 iso_pu_bacteria 2884960567 2884961815 327
231 iso_pu_bacteria 2928531327 2928536088 327
232 3300009093 Ga0105240_10128849 Ga0105240_101288492 329
233 3300009545 Ga0105237_10320675 Ga0105237_103206751 329
234 3300013105 Ga0157369_10094975 Ga0157369_100949752 329
235 3300013307 Ga0157372_10095017 Ga0157372_100950172 329
236 3300025913 Ga0207695_10100999 Ga0207695_101009993 329
237 3300037418 Ga0395900_0008575 Ga0395900_0008575_412_1500 329
238 3300038443 Ga0395901_0127744 Ga0395901_0127744_426_1514 329
239 3300046616 Ga0495668_0042549 Ga0495668_0042549_1309_2307 329
240 3300053116 Ga0500592_009120 Ga0500592_009120_429_1427 329
241 3300049459 Ga0495678_000322 Ga0495678_000322_20225_21220 330
242 3300053118 Ga0500594_0000263 Ga0500594_0000263_6728_7723 330
243 3300053156 Ga0500622_0124417 Ga0500622_0124417_202_1206 330
244 3300046453 Ga0495627_001705 Ga0495627_001705_3907_4908 331
245 3300003320 rootH2_10002795 rootH2_100027953 332
246 3300046524 Ga0495648_0018335 Ga0495648_0018335_3741_4766 332
247 3300046660 Ga0495625_0052260 Ga0495625_0052260_1189_2214 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

164

295

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

39

123

0.92

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

198

335

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9493 4 330
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9475 3 330
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9463 4 330
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9417 3 330
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.9257 4 329
ID Description Score Start End Superfamily
4a27B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.965 4 124 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9595 6 121 3.90.180.10
af_B0BNC9_25_138_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9545 4 119 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9544 6 124 3.90.180.10
af_A0A0P0WKK9_27_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9538 33 130 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A059DLV1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9902 88 330 GO:0016491
AF-A0A059DLV1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9781 88 330 GO:0016491
AF-A0A7X5WVL9-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9606 28 120 GO:0016491
AF-A0A7J8CMU9-F1-model_v4 Vesicle amine transport 1 like 0.9576 1 121
AF-A0A3D5V0E0-F1-model_v4 NADPH:quinone oxidoreductase 0.9558 6 266 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.12 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map