F358814

General Info

Members Datasets Scaffolds Average Seq Length
247 180 239 219

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100000066|Ga0068867_10000006645
Length 232
Sequence MVTGIERAEFVAIRLTAELAALSTVLLLIIGTPIAWWLARTRSRLKPISSALVAMPIVLPPSVLGFYLLLLMGPTGPVGQLTQALGLGRLPFTFAGLVVASVLYSMPFVVQPLQQAFEAIPERMLEAAATLRASPWDRFASVALPLARPGFVTASVLGFAHTVGEFGVVLMIGGNIPGETRVLSVAIYDHVEAGEFARAHQLAAGMVAFSLLVLVTLYVVNRPHKDGVETAR

Samples

Sample ID Description Type Environment
1 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
2 2739367700 Dyella sp. YR388 Isolate Unclassified
3 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
4 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
5 2884411467 Dyella sp. AD56 Isolate Rhizosphere
6 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
7 2928963466 Dyella japonica 1073 Isolate Unclassified
8 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
55 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
107 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
108 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
118 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
119 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
120 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
123 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.4
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.62
Nodule 0
Rhizoplane 2.43
Rhizosphere 60.32
Stem 0
Stem Tuber 0
Unclassified 18.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10014551 3300002067 Bacteria 2463
2 JGI25162J39368_1000276 3300002737 Bacteria 48822
3 JGI25162J39368_1000425 3300002737 Bacteria 34158
4 JGI25157J39369_1000411 3300002741 Bacteria 28952
5 JGI25157J39369_1000627 3300002741 Bacteria 19835
6 JGI25157J39369_1000810 3300002741 Bacteria 15708
7 JGI25163J39215_1000312 3300002771 Bacteria 16385
8 JGI25164J39214_1000281 3300002772 Bacteria 36721
9 JGI25165J46597_1000377 3300003214 Bacteria 48822
10 Ga0055538_1001174 3300003751 Bacteria 5539
11 Ga0055535_1001144 3300003761 Bacteria 15713
12 Ga0055542_1000199 3300003762 Bacteria 74029
13 Ga0055542_1000347 3300003762 Bacteria 48822
14 Ga0055529_1000369 3300003763 Bacteria 48822
15 Ga0070682_100118011 3300005337 Bacteria 1777
16 Ga0070689_100005288 3300005340 Bacteria 8798
17 Ga0070661_100010618 3300005344 Bacteria 6407
18 Ga0070661_100050747 3300005344 Bacteria 3035
19 Ga0070709_10224442 3300005434 Bacteria 1341
20 Ga0070714_100004435 3300005435 Bacteria 10567
21 Ga0070713_100003316 3300005436 Bacteria 10617
22 Ga0068867_100000066 3300005459 Bacteria 63559
23 Ga0070685_10002738 3300005466 Bacteria 9029
24 Ga0070684_100661034 3300005535 Bacteria 973
25 Ga0068853_100002508 3300005539 Bacteria 13777
26 Ga0068857_100226736 3300005577 Bacteria 1708
27 Ga0068852_100062757 3300005616 Bacteria 3233
28 Ga0068851_10001558 3300005834 Bacteria 10055
29 Ga0068860_100243470 3300005843 Bacteria 1750
30 Ga0075363_100271934 3300006048 Bacteria 979
31 Ga0075364_10002649 3300006051 Bacteria 10050
32 Ga0070712_100204537 3300006175 Bacteria 1553
33 Ga0075362_10000333 3300006177 Bacteria 13448
34 Ga0075367_10007565 3300006178 Bacteria 5572
35 Ga0075366_10008235 3300006195 Bacteria 5786
36 Ga0075428_100040317 3300006844 Bacteria 5138
37 Ga0075430_100369569 3300006846 Bacteria 1184
38 Ga0075431_100070131 3300006847 Bacteria 3616
39 Ga0075429_100039638 3300006880 Bacteria 4099
40 Ga0105240_10135811 3300009093 Bacteria 2946
41 Ga0105245_10236159 3300009098 Bacteria 1770
42 Ga0114129_10053347 3300009147 Bacteria 5671
43 Ga0105243_10003572 3300009148 Bacteria 12555
44 Ga0105241_10389611 3300009174 Bacteria 1220
45 Ga0105237_10016165 3300009545 Bacteria 7762
46 Ga0105239_10034756 3300010375 Bacteria 5536
47 Ga0163162_10998695 3300013306 Bacteria 946
48 Ga0157377_10000035 3300014745 Bacteria 116860
49 Ga0183368_1004 3300015687 Bacteria 1211761
50 Ga0213875_10000152 3300021388 Bacteria 73219
51 Ga0209435_106197 3300025206 Bacteria 1333
52 Ga0209760_100430 3300025207 Bacteria 9887
53 Ga0209784_100158 3300025224 Bacteria 61452
54 Ga0209566_102586 3300025225 Bacteria 3241
55 Ga0209674_100016 3300025226 Bacteria 696756
56 Ga0209674_105379 3300025226 Bacteria 1905
57 Ga0209672_101386 3300025228 Bacteria 8976
58 Ga0207427_100013 3300025231 Bacteria 581419
59 Ga0207427_102384 3300025231 Bacteria 5112
60 Ga0207427_108087 3300025231 Bacteria 1192
61 Ga0209437_100015 3300025233 Bacteria 713457
62 Ga0209437_100106 3300025233 Bacteria 219071
63 Ga0209258_100043 3300025242 Bacteria 380685
64 Ga0209258_101025 3300025242 Bacteria 12594
65 Ga0209258_102284 3300025242 Bacteria 5119
66 Ga0209646_1000511 3300025246 Bacteria 17457
67 Ga0209026_1000069 3300025250 Bacteria 207574
68 Ga0209026_1000092 3300025250 Bacteria 170960
69 Ga0209026_1002260 3300025250 Bacteria 7386
70 Ga0209148_1000002 3300025254 Bacteria 2399500
71 Ga0209148_1000010 3300025254 Bacteria 1265567
72 Ga0209759_1000683 3300025256 Bacteria 30620
73 Ga0209759_1017643 3300025256 Bacteria 1751
74 Ga0209233_1000009 3300025261 Bacteria 1265567
75 Ga0209233_1018390 3300025261 Bacteria 1882
76 Ga0209455_1000020 3300025272 Bacteria 702259
77 Ga0209676_1000547 3300025292 Bacteria 57868
78 Ga0209050_1018437 3300025298 Bacteria 2712
79 Ga0207647_10264372 3300025904 Bacteria 984
80 Ga0207654_10251035 3300025911 Bacteria 1186
81 Ga0207695_10146488 3300025913 Bacteria 2305
82 Ga0207693_10179561 3300025915 Bacteria 1665
83 Ga0207649_10001752 3300025920 Bacteria 12456
84 Ga0207649_10071325 3300025920 Bacteria 2218
85 Ga0207700_10007245 3300025928 Bacteria 6766
86 Ga0207664_10017175 3300025929 Bacteria 5297
87 Ga0207709_10000858 3300025935 Bacteria 23259
88 Ga0207670_10009153 3300025936 Bacteria 5632
89 Ga0207667_10050389 3300025949 Bacteria 4394
90 Ga0207640_10024637 3300025981 Bacteria 3633
91 Ga0207639_10009959 3300026041 Bacteria 6568
92 Ga0207702_10239908 3300026078 Bacteria 1698
93 Ga0207648_10000040 3300026089 Bacteria 116539
94 Ga0207674_10076139 3300026116 Bacteria 3364
95 Ga0207698_10003586 3300026142 Bacteria 9367
96 Ga0209966_1002453 3300027695 Bacteria 3096
97 Ga0209813_10009827 3300027866 Bacteria 2459
98 Ga0209974_10012707 3300027876 Bacteria 2812
99 Ga0209974_10031918 3300027876 Bacteria 1745
100 Ga0268265_10149506 3300028380 Bacteria 1968
101 Ga0268264_10437338 3300028381 Bacteria 1265
102 Ga0265336_10000013 3300028666 Bacteria 252156
103 Ga0307515_10128455 3300028794 Bacteria 2810
104 Ga0265338_10007811 3300028800 Bacteria 13152
105 Ga0265324_10000536 3300029957 Bacteria 26052
106 Ga0265324_10051523 3300029957 Bacteria 1414
107 Ga0307512_10030456 3300030522 Bacteria 4694
108 Ga0265327_10002273 3300031251 Bacteria 20658
109 Ga0307513_10186769 3300031456 Bacteria 1929
110 Ga0307513_10434730 3300031456 Bacteria 1040
111 Ga0307509_10003432 3300031507 Bacteria 24057
112 Ga0316575_10029589 3300031665 Bacteria 2139
113 Ga0316579_10012370 3300031691 Bacteria 3650
114 Ga0265314_10209393 3300031711 Bacteria 1146
115 Ga0316578_10026786 3300031728 Bacteria 3253
116 Ga0316577_10065730 3300031733 Bacteria 2025
117 Ga0307416_100378720 3300032002 Bacteria 1444
118 Ga0316583_10006996 3300032133 Bacteria 4058
119 Ga0316580_10043362 3300032139 Bacteria 1388
120 Ga0316593_10024239 3300032168 Bacteria 1922
121 Ga0307510_10008022 3300033180 Bacteria 12565
122 Ga0373960_0006112 3300035121 Bacteria 2814
123 Ga0316574_0078900 3300035398 Bacteria 2088
124 Ga0316582_0002562 3300036647 Bacteria 8603
125 Ga0316582_0003011 3300036647 Bacteria 8122
126 Ga0316582_0057829 3300036647 Bacteria 2478
127 Ga0316584_0026579 3300036712 Bacteria 4255
128 Ga0316584_0081652 3300036712 Bacteria 2421
129 Ga0316584_0087943 3300036712 Bacteria 2326
130 Ga0316584_0428236 3300036712 Bacteria 939
131 Ga0395905_0002350 3300037471 Bacteria 21082
132 Ga0395905_0074385 3300037471 Bacteria 3183
133 Ga0316581_0038660 3300037588 Bacteria 1451
134 Ga0436364_0154218 3300037853 Bacteria 60339
135 Ga0400484_26948 3300038725 Bacteria 1186
136 Ga0400484_30075 3300038725 Bacteria 1402
137 Ga0400484_41442 3300038725 Bacteria 10512
138 Ga0400490_05939 3300038726 Bacteria 1424
139 Ga0400490_40571 3300038726 Bacteria 1614
140 Ga0400488_24814 3300038741 Bacteria 2895
141 Ga0400488_34438 3300038741 Bacteria 1899
142 Ga0400486_23976 3300038742 Bacteria 5770
143 Ga0400486_30663 3300038742 Bacteria 1374
144 Ga0400483_018351 3300039062 Bacteria 1561
145 Ga0400483_060649 3300039062 Bacteria 3884
146 Ga0400483_072945 3300039062 Bacteria 13871
147 Ga0400483_215965 3300039062 Bacteria 11975
148 Ga0400483_290988 3300039062 Bacteria 3067
149 Ga0400489_09434 3300039093 Bacteria 1457
150 Ga0400487_41089 3300039110 Bacteria 2372
151 Ga0400487_60392 3300039110 Bacteria 1982
152 Ga0436360_0475935 3300039438 Bacteria 2697
153 Ga0451795_0535428 3300041456 Bacteria 1510
154 Ga0439435_0000610 3300042436 Bacteria 5832
155 Ga0439460_0202667 3300042461 Bacteria 676
156 Ga0451577_0001952 3300042876 Bacteria 26006
157 Ga0451577_0010194 3300042876 Bacteria 8999
158 Ga0451577_0024291 3300042876 Bacteria 5515
159 Ga0451577_0338622 3300042876 Bacteria 1364
160 Ga0451577_0751307 3300042876 Bacteria 882
161 Ga0453683_0000059 3300044673 Bacteria 187158
162 Ga0453684_0000237 3300044712 Bacteria 236999
163 Ga0453684_0000585 3300044712 Bacteria 135647
164 Ga0453684_0003373 3300044712 Bacteria 36143
165 Ga0453684_0007149 3300044712 Bacteria 20770
166 Ga0453684_0010999 3300044712 Bacteria 15294
167 Ga0453684_0522678 3300044712 Bacteria 1311
168 Ga0453684_0699959 3300044712 Bacteria 1101
169 Ga0451576_0000018 3300045051 Bacteria 550689
170 Ga0451576_0008944 3300045051 Bacteria 11681
171 Ga0451576_0047514 3300045051 Bacteria 4512
172 Ga0451576_0617811 3300045051 Bacteria 1139
173 Ga0495592_0000203 3300046454 Bacteria 50733
174 Ga0495638_0000049 3300046460 Bacteria 206725
175 Ga0495638_0001093 3300046460 Bacteria 26413
176 Ga0495650_0000150 3300046471 Bacteria 158574
177 Ga0495606_0000639 3300046507 Bacteria 54940
178 Ga0495597_0151704 3300046542 Bacteria 950
179 Ga0495625_0012942 3300046660 Bacteria 6733
180 Ga0495671_0165057 3300046692 Bacteria 1077
181 Ga0495649_0001173 3300046694 Bacteria 20313
182 Ga0495686_0074845 3300047472 Bacteria 2077
183 Ga0496114_0051507 3300048917 Bacteria 3428
184 Ga0496115_0000045 3300048918 Bacteria 113665
185 Ga0496115_0000360 3300048918 Bacteria 38094
186 Ga0496115_0003637 3300048918 Bacteria 11095
187 Ga0496115_0012684 3300048918 Bacteria 6350
188 Ga0496121_0058846 3300048924 Bacteria 3173
189 Ga0496125_0004650 3300048928 Bacteria 15661
190 Ga0496126_0008352 3300048929 Bacteria 11175
191 Ga0496126_0021234 3300048929 Bacteria 6347
192 Ga0496126_0077832 3300048929 Bacteria 2939
193 Ga0495678_057456 3300049459 Bacteria 1474
194 Ga0495682_0010779 3300049460 Bacteria 3528
195 Ga0501031_0015598 3300049568 Bacteria 4932
196 Ga0501031_0069137 3300049568 Bacteria 2300
197 Ga0501032_0026255 3300049569 Bacteria 4008
198 Ga0501033_0017026 3300049570 Bacteria 5494
199 Ga0501033_0143314 3300049570 Bacteria 1727
200 Ga0501034_0256477 3300049571 Bacteria 1692
201 Ga0501034_0868245 3300049571 Bacteria 791
202 Ga0501036_0173622 3300049572 Bacteria 1815
203 Ga0501037_0122853 3300049573 Bacteria 1866
204 Ga0501037_0167680 3300049573 Bacteria 1562
205 Ga0501038_0065324 3300049574 Bacteria 3100
206 Ga0501043_0173290 3300049579 Bacteria 1683
207 Ga0501043_0181916 3300049579 Bacteria 1637
208 Ga0501047_0007818 3300049581 Bacteria 10069
209 Ga0501047_0042317 3300049581 Bacteria 4402
210 Ga0501048_0127080 3300049582 Bacteria 1803
211 Ga0501070_0578819 3300049586 Bacteria 897
212 Ga0501071_0347670 3300049587 Bacteria 1128
213 Ga0501071_0501846 3300049587 Bacteria 931
214 Ga0501072_0082429 3300049588 Bacteria 2550
215 Ga0501076_0357379 3300049592 Bacteria 1200
216 Ga0501076_0634760 3300049592 Bacteria 881
217 Ga0501079_0128093 3300049741 Bacteria 1975
218 Ga0501080_0416596 3300049742 Bacteria 1207
219 Ga0501035_0009408 3300049822 Bacteria 9085
220 Ga0501035_0015825 3300049822 Bacteria 6961
221 Ga0501035_0629104 3300049822 Bacteria 872
222 Ga0501044_0043283 3300049823 Bacteria 4679
223 Ga0501044_0737431 3300049823 Bacteria 868
224 Ga0501045_0262815 3300049824 Bacteria 1285
225 nmdc:mga03683_736_c1 3300050489 Bacteria 9350
226 nmdc:mga03n38_21716_c2 3300050490 Bacteria 1553
227 nmdc:mga00v17_6431_c1 3300050491 Bacteria 6234
228 nmdc:mga0k408_20648_c1 3300050493 Bacteria 3692
229 nmdc:mga0k408_45834_c1 3300050493 Bacteria 2524
230 nmdc:mga06z11_3247_c1 3300050494 Bacteria 6284
231 nmdc:mga04h51_6228_c1 3300050495 Bacteria 3082
232 nmdc:mga07m45_138074_c1 3300050496 Bacteria 1411
233 nmdc:mga05p37_185351_c1 3300050507 Bacteria 2530
234 nmdc:mga09592_91557_c1 3300050508 Bacteria 2599
235 nmdc:mga0qj67_39303_c1 3300050509 Bacteria 3715
236 nmdc:mga06r32_210959_c1 3300050510 Bacteria 1930
237 Ga0500619_008139 3300053154 Bacteria 2528
238 Ga0501082_0202441 3300060353 Bacteria 1727
239 Ga0530510_0239951 3300061734 Bacteria 1349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038726 Ga0400490_40571 Ga0400490_40571_854_1522 192
2 3300039110 Ga0400487_60392 Ga0400487_60392_855_1520 192
3 3300028800 Ga0265338_10007811 Ga0265338_1000781111 193
4 3300039438 Ga0436360_0475935 Ga0436360_0475935_669_1355 198
5 3300049573 Ga0501037_0122853 Ga0501037_0122853_1169_1843 200
6 3300038726 Ga0400490_05939 Ga0400490_05939_753_1364 201
7 3300038725 Ga0400484_41442 Ga0400484_41442_9856_10473 202
8 3300049586 Ga0501070_0578819 Ga0501070_0578819_56_742 202
9 3300049587 Ga0501071_0347670 Ga0501071_0347670_101_787 202
10 3300049588 Ga0501072_0082429 Ga0501072_0082429_757_1443 202
11 3300049592 Ga0501076_0357379 Ga0501076_0357379_162_848 202
12 3300049741 Ga0501079_0128093 Ga0501079_0128093_197_883 202
13 3300049824 Ga0501045_0262815 Ga0501045_0262815_476_1162 202
14 3300060353 Ga0501082_0202441 Ga0501082_0202441_408_1094 202
15 3300061734 Ga0530510_0239951 Ga0530510_0239951_103_789 202
16 3300025292 Ga0209676_1000547 Ga0209676_100054732 204
17 3300025298 Ga0209050_1018437 Ga0209050_10184372 204
18 3300006177 Ga0075362_10000333 Ga0075362_1000033311 205
19 3300050489 nmdc:mga03683_736_c1 nmdc:mga03683_736_c1_7530_8213 205
20 3300005466 Ga0070685_10002738 Ga0070685_1000273810 208
21 3300005337 Ga0070682_100118011 Ga0070682_1001180112 209
22 3300005340 Ga0070689_100005288 Ga0070689_1000052884 209
23 3300005344 Ga0070661_100050747 Ga0070661_1000507472 209
24 3300005843 Ga0068860_100243470 Ga0068860_1002434702 209
25 3300006844 Ga0075428_100040317 Ga0075428_1000403174 209
26 3300006847 Ga0075431_100070131 Ga0075431_1000701313 209
27 3300006880 Ga0075429_100039638 Ga0075429_1000396383 209
28 3300009147 Ga0114129_10053347 Ga0114129_100533473 209
29 3300013306 Ga0163162_10998695 Ga0163162_109986952 209
30 3300025920 Ga0207649_10071325 Ga0207649_100713253 209
31 3300025936 Ga0207670_10009153 Ga0207670_100091534 209
32 3300027695 Ga0209966_1002453 Ga0209966_10024532 209
33 3300028380 Ga0268265_10149506 Ga0268265_101495062 209
34 3300042436 Ga0439435_0000610 Ga0439435_0000610_5151_5780 209
35 3300042461 Ga0439460_0202667 Ga0439460_0202667_10_639 209
36 3300046460 Ga0495638_0000049 Ga0495638_0000049_189024_189707 209
37 3300046471 Ga0495650_0000150 Ga0495650_0000150_91680_92363 209
38 3300046660 Ga0495625_0012942 Ga0495625_0012942_4157_4840 209
39 3300048917 Ga0496114_0051507 Ga0496114_0051507_984_1667 209
40 3300048918 Ga0496115_0012684 Ga0496115_0012684_3015_3698 209
41 3300048924 Ga0496121_0058846 Ga0496121_0058846_166_849 209
42 3300048929 Ga0496126_0077832 Ga0496126_0077832_336_1019 209
43 3300050507 nmdc:mga05p37_185351_c1 nmdc:mga05p37_185351_c1_1193_1822 209
44 3300050508 nmdc:mga09592_91557_c1 nmdc:mga09592_91557_c1_355_984 209
45 3300050509 nmdc:mga0qj67_39303_c1 nmdc:mga0qj67_39303_c1_2516_3145 209
46 3300050510 nmdc:mga06r32_210959_c1 nmdc:mga06r32_210959_c1_483_1112 209
47 3300025228 Ga0209672_101386 Ga0209672_1013869 210
48 3300048918 Ga0496115_0003637 Ga0496115_0003637_8350_9033 210
49 3300048929 Ga0496126_0021234 Ga0496126_0021234_3544_4227 210
50 3300006051 Ga0075364_10002649 Ga0075364_100026498 212
51 3300037471 Ga0395905_0002350 Ga0395905_0002350_5513_6193 212
52 3300050491 nmdc:mga00v17_6431_c1 nmdc:mga00v17_6431_c1_1643_2323 212
53 3300002737 JGI25162J39368_1000276 JGI25162J39368_100027638 213
54 3300002741 JGI25157J39369_1000411 JGI25157J39369_10004114 213
55 3300002741 JGI25157J39369_1000627 JGI25157J39369_100062711 213
56 3300002741 JGI25157J39369_1000810 JGI25157J39369_100081011 213
57 3300002771 JGI25163J39215_1000312 JGI25163J39215_100031213 213
58 3300002772 JGI25164J39214_1000281 JGI25164J39214_100028111 213
59 3300003214 JGI25165J46597_1000377 JGI25165J46597_100037738 213
60 3300003751 Ga0055538_1001174 Ga0055538_10011742 213
61 3300003761 Ga0055535_1001144 Ga0055535_100114411 213
62 3300003762 Ga0055542_1000347 Ga0055542_100034738 213
63 3300003763 Ga0055529_1000369 Ga0055529_100036911 213
64 3300005344 Ga0070661_100010618 Ga0070661_1000106186 213
65 3300005435 Ga0070714_100004435 Ga0070714_1000044358 213
66 3300005436 Ga0070713_100003316 Ga0070713_1000033165 213
67 3300005535 Ga0070684_100661034 Ga0070684_1006610341 213
68 3300005539 Ga0068853_100002508 Ga0068853_1000025088 213
69 3300005577 Ga0068857_100226736 Ga0068857_1002267362 213
70 3300005616 Ga0068852_100062757 Ga0068852_1000627572 213
71 3300005834 Ga0068851_10001558 Ga0068851_100015588 213
72 3300006175 Ga0070712_100204537 Ga0070712_1002045372 213
73 3300009098 Ga0105245_10236159 Ga0105245_102361592 213
74 3300009174 Ga0105241_10389611 Ga0105241_103896111 213
75 3300009545 Ga0105237_10016165 Ga0105237_100161655 213
76 3300010375 Ga0105239_10034756 Ga0105239_100347565 213
77 3300025206 Ga0209435_106197 Ga0209435_1061972 213
78 3300025207 Ga0209760_100430 Ga0209760_1004302 213
79 3300025224 Ga0209784_100158 Ga0209784_10015850 213
80 3300025226 Ga0209674_105379 Ga0209674_1053792 213
81 3300025231 Ga0207427_100013 Ga0207427_100013163 213
82 3300025233 Ga0209437_100015 Ga0209437_100015374 213
83 3300025242 Ga0209258_100043 Ga0209258_100043260 213
84 3300025246 Ga0209646_1000511 Ga0209646_100051116 213
85 3300025250 Ga0209026_1000069 Ga0209026_100006967 213
86 3300025250 Ga0209026_1000092 Ga0209026_1000092120 213
87 3300025254 Ga0209148_1000010 Ga0209148_1000010540 213
88 3300025256 Ga0209759_1000683 Ga0209759_100068323 213
89 3300025256 Ga0209759_1017643 Ga0209759_10176432 213
90 3300025261 Ga0209233_1000009 Ga0209233_1000009631 213
91 3300025272 Ga0209455_1000020 Ga0209455_100002064 213
92 3300025911 Ga0207654_10251035 Ga0207654_102510352 213
93 3300025915 Ga0207693_10179561 Ga0207693_101795612 213
94 3300025920 Ga0207649_10001752 Ga0207649_100017528 213
95 3300025928 Ga0207700_10007245 Ga0207700_100072457 213
96 3300025929 Ga0207664_10017175 Ga0207664_100171752 213
97 3300025949 Ga0207667_10050389 Ga0207667_100503891 213
98 3300025981 Ga0207640_10024637 Ga0207640_100246372 213
99 3300026041 Ga0207639_10009959 Ga0207639_100099595 213
100 3300026078 Ga0207702_10239908 Ga0207702_102399081 213
101 3300026116 Ga0207674_10076139 Ga0207674_100761392 213
102 3300026142 Ga0207698_10003586 Ga0207698_1000358610 213
103 3300046460 Ga0495638_0001093 Ga0495638_0001093_10413_11096 213
104 3300038725 Ga0400484_30075 Ga0400484_30075_615_1292 214
105 3300038741 Ga0400488_24814 Ga0400488_24814_2107_2781 214
106 3300039062 Ga0400483_072945 Ga0400483_072945_9121_9798 214
107 3300039062 Ga0400483_215965 Ga0400483_215965_4558_5235 214
108 3300039110 Ga0400487_41089 Ga0400487_41089_1251_1925 214
109 3300005434 Ga0070709_10224442 Ga0070709_102244422 215
110 3300038741 Ga0400488_34438 Ga0400488_34438_584_1261 215
111 3300039062 Ga0400483_060649 Ga0400483_060649_2375_3052 215
112 3300041456 Ga0451795_0535428 Ga0451795_0535428_194_886 215
113 3300049571 Ga0501034_0256477 Ga0501034_0256477_850_1524 215
114 3300049572 Ga0501036_0173622 Ga0501036_0173622_366_1049 215
115 3300049582 Ga0501048_0127080 Ga0501048_0127080_597_1280 215
116 3300050493 nmdc:mga0k408_45834_c1 nmdc:mga0k408_45834_c1_250_936 215
117 iso_pu_bacteria 2891048133 2891050029 215
118 iso_pu_bacteria 2995392953 2995395419 215
119 iso_pu_bacteria 2597490356 2599104146 216
120 iso_pu_bacteria 2846952575 2846956457 216
121 iso_pu_bacteria 2848858292 2848862705 216
122 3300038742 Ga0400486_23976 Ga0400486_23976_3300_3977 217
123 3300006846 Ga0075430_100369569 Ga0075430_1003695692 218
124 3300049568 Ga0501031_0015598 Ga0501031_0015598_386_1069 218
125 3300049569 Ga0501032_0026255 Ga0501032_0026255_365_1048 218
126 3300049573 Ga0501037_0167680 Ga0501037_0167680_825_1508 218
127 3300049574 Ga0501038_0065324 Ga0501038_0065324_2316_2999 218
128 3300049579 Ga0501043_0181916 Ga0501043_0181916_473_1156 218
129 3300049581 Ga0501047_0007818 Ga0501047_0007818_114_797 218
130 3300049587 Ga0501071_0501846 Ga0501071_0501846_203_886 218
131 3300049742 Ga0501080_0416596 Ga0501080_0416596_368_1051 218
132 3300049822 Ga0501035_0015825 Ga0501035_0015825_392_1075 218
133 3300031456 Ga0307513_10186769 Ga0307513_101867692 219
134 3300031456 Ga0307513_10434730 Ga0307513_104347302 219
135 3300031728 Ga0316578_10026786 Ga0316578_100267862 220
136 3300031733 Ga0316577_10065730 Ga0316577_100657302 220
137 3300032139 Ga0316580_10043362 Ga0316580_100433622 220
138 3300035398 Ga0316574_0078900 Ga0316574_0078900_751_1428 220
139 3300036712 Ga0316584_0026579 Ga0316584_0026579_1866_2528 220
140 3300028666 Ga0265336_10000013 Ga0265336_1000001391 221
141 3300029957 Ga0265324_10000536 Ga0265324_1000053633 221
142 3300006195 Ga0075366_10008235 Ga0075366_100082355 222
143 3300021388 Ga0213875_10000152 Ga0213875_1000015232 222
144 3300027876 Ga0209974_10031918 Ga0209974_100319182 222
145 3300030522 Ga0307512_10030456 Ga0307512_100304565 222
146 3300031507 Ga0307509_10003432 Ga0307509_1000343211 222
147 3300031665 Ga0316575_10029589 Ga0316575_100295892 222
148 3300031691 Ga0316579_10012370 Ga0316579_100123702 222
149 3300032002 Ga0307416_100378720 Ga0307416_1003787202 222
150 3300032133 Ga0316583_10006996 Ga0316583_100069963 222
151 3300032168 Ga0316593_10024239 Ga0316593_100242392 222
152 3300033180 Ga0307510_10008022 Ga0307510_1000802211 222
153 3300036647 Ga0316582_0003011 Ga0316582_0003011_2650_3327 222
154 3300036647 Ga0316582_0057829 Ga0316582_0057829_242_922 222
155 3300036712 Ga0316584_0081652 Ga0316584_0081652_1547_2227 222
156 3300036712 Ga0316584_0087943 Ga0316584_0087943_655_1332 222
157 3300037588 Ga0316581_0038660 Ga0316581_0038660_182_862 222
158 3300037853 Ga0436364_0154218 Ga0436364_0154218_11912_12586 222
159 3300038725 Ga0400484_26948 Ga0400484_26948_40_714 222
160 3300038742 Ga0400486_30663 Ga0400486_30663_296_970 222
161 3300039062 Ga0400483_018351 Ga0400483_018351_386_1060 222
162 3300039062 Ga0400483_290988 Ga0400483_290988_2354_3028 222
163 3300039093 Ga0400489_09434 Ga0400489_09434_491_1165 222
164 3300042876 Ga0451577_0024291 Ga0451577_0024291_212_898 222
165 3300044712 Ga0453684_0003373 Ga0453684_0003373_33272_33946 222
166 3300044712 Ga0453684_0010999 Ga0453684_0010999_10167_10853 222
167 3300044712 Ga0453684_0522678 Ga0453684_0522678_195_869 222
168 3300044712 Ga0453684_0699959 Ga0453684_0699959_130_816 222
169 3300045051 Ga0451576_0617811 Ga0451576_0617811_437_1120 222
170 3300046454 Ga0495592_0000203 Ga0495592_0000203_30170_30856 222
171 3300046692 Ga0495671_0165057 Ga0495671_0165057_325_1014 222
172 3300050493 nmdc:mga0k408_20648_c1 nmdc:mga0k408_20648_c1_749_1435 222
173 3300050496 nmdc:mga07m45_138074_c1 nmdc:mga07m45_138074_c1_398_1081 222
174 3300053154 Ga0500619_008139 Ga0500619_008139_986_1672 222
175 3300009093 Ga0105240_10135811 Ga0105240_101358112 223
176 3300025913 Ga0207695_10146488 Ga0207695_101464882 223
177 3300028794 Ga0307515_10128455 Ga0307515_101284553 223
178 3300036647 Ga0316582_0002562 Ga0316582_0002562_1189_1869 223
179 3300037471 Ga0395905_0074385 Ga0395905_0074385_422_1111 223
180 3300042876 Ga0451577_0338622 Ga0451577_0338622_331_1020 223
181 3300048928 Ga0496125_0004650 Ga0496125_0004650_7291_7962 223
182 3300049570 Ga0501033_0143314 Ga0501033_0143314_10_693 223
183 3300049579 Ga0501043_0173290 Ga0501043_0173290_459_1142 223
184 3300049581 Ga0501047_0042317 Ga0501047_0042317_1673_2356 223
185 3300049822 Ga0501035_0009408 Ga0501035_0009408_6231_6914 223
186 3300049823 Ga0501044_0043283 Ga0501044_0043283_3585_4268 223
187 iso_pu_bacteria 2739367700 2739730619 223
188 iso_pu_bacteria 2884411467 2884415152 223
189 iso_pu_bacteria 2928963466 2928964320 223
190 3300027876 Ga0209974_10012707 Ga0209974_100127073 224
191 3300028381 Ga0268264_10437338 Ga0268264_104373382 224
192 3300031251 Ga0265327_10002273 Ga0265327_1000227319 224
193 3300045051 Ga0451576_0047514 Ga0451576_0047514_2805_3485 224
194 3300047472 Ga0495686_0074845 Ga0495686_0074845_228_908 224
195 3300049571 Ga0501034_0868245 Ga0501034_0868245_86_769 224
196 3300049592 Ga0501076_0634760 Ga0501076_0634760_47_730 224
197 3300049823 Ga0501044_0737431 Ga0501044_0737431_163_846 224
198 3300005459 Ga0068867_100000066 Ga0068867_10000006645 225
199 3300009148 Ga0105243_10003572 Ga0105243_1000357210 225
200 3300014745 Ga0157377_10000035 Ga0157377_1000003545 225
201 3300025935 Ga0207709_10000858 Ga0207709_1000085818 225
202 3300026089 Ga0207648_10000040 Ga0207648_1000004044 225
203 3300035121 Ga0373960_0006112 Ga0373960_0006112_984_1667 225
204 3300006048 Ga0075363_100271934 Ga0075363_1002719342 226
205 3300006178 Ga0075367_10007565 Ga0075367_100075653 226
206 3300025225 Ga0209566_102586 Ga0209566_1025864 226
207 3300027866 Ga0209813_10009827 Ga0209813_100098272 226
208 3300029957 Ga0265324_10051523 Ga0265324_100515231 226
209 3300031711 Ga0265314_10209393 Ga0265314_102093931 226
210 3300036712 Ga0316584_0428236 Ga0316584_0428236_177_869 226
211 3300042876 Ga0451577_0001952 Ga0451577_0001952_24729_25415 226
212 3300042876 Ga0451577_0010194 Ga0451577_0010194_2318_3004 226
213 3300042876 Ga0451577_0751307 Ga0451577_0751307_147_833 226
214 3300044673 Ga0453683_0000059 Ga0453683_0000059_151726_152412 226
215 3300044712 Ga0453684_0000237 Ga0453684_0000237_6150_6836 226
216 3300044712 Ga0453684_0000585 Ga0453684_0000585_100215_100901 226
217 3300044712 Ga0453684_0007149 Ga0453684_0007149_5790_6476 226
218 3300045051 Ga0451576_0000018 Ga0451576_0000018_34747_35433 226
219 3300045051 Ga0451576_0008944 Ga0451576_0008944_2905_3591 226
220 3300049568 Ga0501031_0069137 Ga0501031_0069137_142_828 226
221 3300049570 Ga0501033_0017026 Ga0501033_0017026_1874_2560 226
222 3300049822 Ga0501035_0629104 Ga0501035_0629104_156_842 226
223 3300050490 nmdc:mga03n38_21716_c2 nmdc:mga03n38_21716_c2_203_892 226
224 3300050494 nmdc:mga06z11_3247_c1 nmdc:mga06z11_3247_c1_1482_2171 226
225 3300050495 nmdc:mga04h51_6228_c1 nmdc:mga04h51_6228_c1_1713_2402 226
226 3300002067 JGI24735J21928_10014551 JGI24735J21928_100145512 227
227 3300002737 JGI25162J39368_1000425 JGI25162J39368_100042528 227
228 3300003762 Ga0055542_1000199 Ga0055542_100019930 227
229 3300015687 Ga0183368_1004 Ga0183368_100474 227
230 3300025226 Ga0209674_100016 Ga0209674_100016557 227
231 3300025231 Ga0207427_102384 Ga0207427_1023844 227
232 3300025231 Ga0207427_108087 Ga0207427_1080872 227
233 3300025233 Ga0209437_100106 Ga0209437_100106142 227
234 3300025242 Ga0209258_101025 Ga0209258_1010257 227
235 3300025242 Ga0209258_102284 Ga0209258_1022844 227
236 3300025250 Ga0209026_1002260 Ga0209026_10022604 227
237 3300025254 Ga0209148_1000002 Ga0209148_10000021788 227
238 3300025261 Ga0209233_1018390 Ga0209233_10183902 227
239 3300025904 Ga0207647_10264372 Ga0207647_102643721 227
240 3300046507 Ga0495606_0000639 Ga0495606_0000639_39388_40071 227
241 3300046542 Ga0495597_0151704 Ga0495597_0151704_109_792 227
242 3300046694 Ga0495649_0001173 Ga0495649_0001173_3863_4546 227
243 3300048918 Ga0496115_0000045 Ga0496115_0000045_80686_81369 227
244 3300048918 Ga0496115_0000360 Ga0496115_0000360_12522_13205 227
245 3300048929 Ga0496126_0008352 Ga0496126_0008352_7754_8437 227
246 3300049459 Ga0495678_057456 Ga0495678_057456_234_917 227
247 3300049460 Ga0495682_0010779 Ga0495682_0010779_422_1105 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

31

223

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.9267 8 218
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.9198 5 215
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8924 6 218
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8718 5 215
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8406 6 218
ID Description Score Start End Superfamily
af_P9WG13_10_255_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9481 5 216 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9369 5 218 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9367 5 222 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9355 4 218 1.10.3720.10
af_P16701_14_273_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9235 7 225 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A259DLC4-F1-model_v4 Molybdenum transport system permease 0.9924 4 200 GO:0005886
GO:0015098
AF-A0A7R8ZVD9-F1-model_v4 Uncharacterized protein 0.9913 5 161 GO:0005886
GO:0015689
GO:0055085
AF-A0A370K658-F1-model_v4 Molybdenum transport system permease 0.9855 1 226 GO:0005886
GO:0015098
AF-A0A5C5TRC6-F1-model_v4 Molybdenum transport system permease 0.9848 4 194 GO:0005886
GO:0015098
AF-A0A2E8GCF5-F1-model_v4 Molybdenum transport system permease 0.9835 4 205 GO:0005886
GO:0015098

Feature Viewer

pLDDT pTM Quality
85.11 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map