F356741

General Info

Members Datasets Scaffolds Average Seq Length
244 188 209 158

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0966648|Ga0451576_0966648_40_579
Length 179
Sequence MDMQDITHRRSSAFIGSQVVSMPRLTHFDSKGNAAMVDVTAKAVTERTATAKGSVLMQPETIALISAGGVKKGDVLSVARLAGIMGAKRTPDLIPLCHPLALTSVQVDLAIDKKRNAVDITATCKLAGKTGVEMEALTAVAVAALTVYDMCKAVDRSMRLTEIRLIRKSGGKSGTYEAT

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
5 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
6 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
9 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
10 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
11 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
12 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
13 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
14 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
15 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
16 2855683550 Micromonospora sp. RP3T Isolate Unclassified
17 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
18 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
19 2858868258 Micromonospora sp. MH33 Isolate Unclassified
20 2858882152 Micromonospora noduli MED15 Isolate Nodule
21 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
22 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
23 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
24 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
25 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
26 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
27 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
28 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
29 2902582711 Micromonospora sp. AP08 Isolate Unclassified
30 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
31 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
104 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 649633069 Micromonospora sp. L5 Isolate Unclassified
186 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
187 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
188 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.84
Metatranscriptomes 0.82
Isolates 14.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 2.46
Rhizoplane 0
Rhizosphere 75.41
Stem 0
Stem Tuber 0
Unclassified 17.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000744 3300002773 Bacteria 16643
2 JGI25406J46586_10018052 3300003203 Bacteria 2903
3 Ga0055536_1018249 3300003781 Bacteria 2257
4 Ga0058692_1000955 3300003856 Bacteria 11366
5 Ga0058692_1002632 3300003856 Bacteria 5915
6 Ga0065704_10177229 3300005289 Bacteria 1257
7 Ga0065712_10390296 3300005290 Bacteria 742
8 Ga0070658_10722116 3300005327 Bacteria 865
9 Ga0070676_10751659 3300005328 Bacteria 716
10 Ga0070670_100138692 3300005331 Bacteria 2103
11 Ga0070680_100017505 3300005336 Bacteria 5652
12 Ga0070660_100029049 3300005339 Bacteria 4141
13 Ga0070668_100027806 3300005347 Bacteria 4293
14 Ga0070669_100033643 3300005353 Bacteria 3708
15 Ga0070674_100042190 3300005356 Bacteria 3097
16 Ga0070659_100131902 3300005366 Bacteria 2030
17 Ga0070708_101087408 3300005445 Bacteria 749
18 Ga0070681_10001274 3300005458 Bacteria 21993
19 Ga0070681_10080521 3300005458 Bacteria 3213
20 Ga0070681_10118631 3300005458 Bacteria 2582
21 Ga0070685_10057975 3300005466 Bacteria 2256
22 Ga0070698_100463672 3300005471 Bacteria 1203
23 Ga0070679_100036100 3300005530 Bacteria 4904
24 Ga0070679_100198580 3300005530 Bacteria 1972
25 Ga0070679_100621099 3300005530 Bacteria 1024
26 Ga0068853_101676665 3300005539 Bacteria 616
27 Ga0068855_100591081 3300005563 Bacteria 1198
28 Ga0068855_101447663 3300005563 Bacteria 707
29 Ga0068866_10069947 3300005718 Bacteria 1851
30 Ga0068863_101973936 3300005841 Bacteria 593
31 Ga0068862_100360148 3300005844 Bacteria 1352
32 Ga0081538_10015921 3300005981 Bacteria 5795
33 Ga0081539_10000070 3300005985 Bacteria 235651
34 Ga0070717_11234532 3300006028 Bacteria 680
35 Ga0070716_100769193 3300006173 Bacteria 743
36 Ga0075430_100154840 3300006846 Bacteria 1908
37 Ga0079104_1005246 3300006946 Bacteria 5228
38 Ga0105251_10000374 3300009011 Bacteria 43851
39 Ga0105251_10006664 3300009011 Bacteria 7301
40 Ga0105251_10108451 3300009011 Bacteria 1266
41 Ga0105244_10000006 3300009036 Bacteria 357997
42 Ga0105244_10001185 3300009036 Bacteria 21548
43 Ga0105244_10007370 3300009036 Bacteria 6991
44 Ga0105244_10021827 3300009036 Bacteria 3531
45 Ga0105244_10066222 3300009036 Bacteria 1809
46 Ga0105250_10019474 3300009092 Bacteria 2744
47 Ga0111539_11108735 3300009094 Bacteria 920
48 Ga0105247_10392774 3300009101 Bacteria 986
49 Ga0105248_10474553 3300009177 Bacteria 1410
50 Ga0105237_11038757 3300009545 Bacteria 826
51 Ga0105237_11902282 3300009545 Bacteria 603
52 Ga0105238_10395840 3300009551 Bacteria 1374
53 Ga0105249_10197737 3300009553 Bacteria 1966
54 Ga0157371_10156977 3300013102 Bacteria 1624
55 Ga0157370_10000567 3300013104 Bacteria 46134
56 Ga0157370_10033870 3300013104 Bacteria 4978
57 Ga0157370_10289353 3300013104 Bacteria 1513
58 Ga0157369_10009902 3300013105 Bacteria 10892
59 Ga0157369_10024023 3300013105 Bacteria 6783
60 Ga0157369_11470358 3300013105 Bacteria 693
61 Ga0157372_10059046 3300013307 Bacteria 4289
62 Ga0157372_12254133 3300013307 Bacteria 626
63 Ga0157375_10571411 3300013308 Bacteria 1291
64 Ga0163163_10221959 3300014325 Bacteria 1939
65 Ga0157379_10226354 3300014968 Bacteria 1695
66 Ga0154015_1294928 3300020610 Bacteria 588
67 Ga0213876_10000166 3300021384 Bacteria 69611
68 Ga0209148_1001073 3300025254 Bacteria 16706
69 Ga0209129_1000015 3300025258 Bacteria 487967
70 Ga0209455_1003349 3300025272 Bacteria 5727
71 Ga0209676_1000159 3300025292 Bacteria 161731
72 Ga0209050_1013871 3300025298 Bacteria 3532
73 Ga0207696_1001947 3300025711 Bacteria 10496
74 Ga0207655_1000149 3300025728 Bacteria 129937
75 Ga0207655_1019463 3300025728 Bacteria 3545
76 Ga0207655_1034567 3300025728 Bacteria 2270
77 Ga0207655_1162617 3300025728 Bacteria 696
78 Ga0207713_1036719 3300025735 Bacteria 2098
79 Ga0207713_1086685 3300025735 Bacteria 1111
80 Ga0207642_10057723 3300025899 Bacteria 1787
81 Ga0207705_10446181 3300025909 Bacteria 1003
82 Ga0207707_10027911 3300025912 Bacteria 4936
83 Ga0207707_10115410 3300025912 Bacteria 2346
84 Ga0207693_10542334 3300025915 Bacteria 907
85 Ga0207660_10073699 3300025917 Bacteria 2490
86 Ga0207660_10182257 3300025917 Bacteria 1631
87 Ga0207660_10459604 3300025917 Bacteria 1030
88 Ga0207657_10070634 3300025919 Bacteria 2959
89 Ga0207652_10067672 3300025921 Bacteria 3097
90 Ga0207652_10145591 3300025921 Bacteria 2120
91 Ga0207652_10388329 3300025921 Bacteria 1260
92 Ga0207681_10013307 3300025923 Bacteria 5089
93 Ga0207690_10011807 3300025932 Bacteria 5224
94 Ga0207709_11017107 3300025935 Bacteria 678
95 Ga0207669_10039317 3300025937 Bacteria 2732
96 Ga0207665_10454398 3300025939 Bacteria 983
97 Ga0209281_1004537 3300027111 Bacteria 4131
98 Ga0209371_1000047 3300027312 Bacteria 304732
99 Ga0209371_1000056 3300027312 Bacteria 242255
100 Ga0209371_1002999 3300027312 Bacteria 8745
101 Ga0268256_1000003 3300030500 Bacteria 1289401
102 Ga0268256_1000071 3300030500 Bacteria 187591
103 Ga0268256_1030732 3300030500 Bacteria 1297
104 Ga0265763_1003723 3300030763 Bacteria 1224
105 Ga0265331_10007170 3300031250 Bacteria 6483
106 Ga0265327_10000163 3300031251 Bacteria 143328
107 Ga0265327_10000242 3300031251 Bacteria 109219
108 Ga0265316_10168410 3300031344 Bacteria 1635
109 Ga0307513_10191011 3300031456 Bacteria 1900
110 Ga0265313_10003331 3300031595 Bacteria 13131
111 Ga0307410_10518450 3300031852 Bacteria 983
112 Ga0307406_10844477 3300031901 Bacteria 776
113 Ga0307406_11028565 3300031901 Bacteria 708
114 Ga0307407_10102180 3300031903 Bacteria 1782
115 Ga0307407_10118518 3300031903 Bacteria 1674
116 Ga0307416_100134324 3300032002 Bacteria 2235
117 Ga0307416_101885807 3300032002 Bacteria 701
118 Ga0307414_10258502 3300032004 Bacteria 1452
119 Ga0307411_11023294 3300032005 Bacteria 741
120 Ga0307415_101324262 3300032126 Bacteria 683
121 Ga0373938_0002040 3300034957 Bacteria 3239
122 Ga0373935_0006496 3300035692 Bacteria 6986
123 Ga0316584_0040508 3300036712 Bacteria 3471
124 Ga0316584_0250459 3300036712 Bacteria 1294
125 Ga0395900_0581668 3300037418 Bacteria 1062
126 Ga0395898_0001625 3300037466 Bacteria 30490
127 Ga0395901_0011778 3300038443 Bacteria 8868
128 Ga0436365_0105401 3300039437 Bacteria 69559
129 Ga0436360_0475164 3300039438 Bacteria 762
130 Ga0436360_1185953 3300039438 Bacteria 1940
131 Ga0436361_0282341 3300039447 Bacteria 8324
132 Ga0436361_0954393 3300039447 Bacteria 1239
133 Ga0439438_032469 3300041405 Bacteria 1384
134 Ga0439438_048992 3300041405 Bacteria 1080
135 Ga0451853_2363731 3300041512 Bacteria 619
136 Ga0451853_3738132 3300041512 Bacteria 1053
137 Ga0439452_000029 3300042010 Bacteria 197977
138 Ga0453684_0000006 3300044712 Bacteria 1364191
139 Ga0453684_0011270 3300044712 Bacteria 15040
140 Ga0453684_0030952 3300044712 Bacteria 7541
141 Ga0453684_0045205 3300044712 Bacteria 5878
142 Ga0451576_0091070 3300045051 Bacteria 3172
143 Ga0451576_0966648 3300045051 Bacteria 893
144 Ga0495603_0384230 3300046455 Bacteria 805
145 Ga0495591_004081 3300046458 Bacteria 7274
146 Ga0495638_0004017 3300046460 Bacteria 11289
147 Ga0495616_0083215 3300046513 Bacteria 1527
148 Ga0495620_0013817 3300046515 Bacteria 4124
149 Ga0495654_0003824 3300046530 Bacteria 9098
150 Ga0495654_0011345 3300046530 Bacteria 4824
151 Ga0495597_0001596 3300046542 Bacteria 15921
152 Ga0495625_0011116 3300046660 Bacteria 7372
153 Ga0495588_0029153 3300046674 Bacteria 2767
154 Ga0495649_0000984 3300046694 Bacteria 22473
155 Ga0495672_0000070 3300047320 Bacteria 184471
156 Ga0495679_000021 3300047446 Bacteria 226183
157 Ga0495679_000893 3300047446 Bacteria 18704
158 Ga0496117_0001907 3300048920 Bacteria 27984
159 Ga0496117_0018339 3300048920 Bacteria 5801
160 Ga0496118_0002095 3300048921 Bacteria 28029
161 Ga0496118_0302856 3300048921 Bacteria 876
162 Ga0496119_0001020 3300048922 Bacteria 35864
163 Ga0496120_0014421 3300048923 Bacteria 5267
164 Ga0496122_0019192 3300048925 Bacteria 6261
165 Ga0496122_0076837 3300048925 Bacteria 2348
166 Ga0496122_0293307 3300048925 Bacteria 881
167 Ga0496123_0000808 3300048926 Bacteria 50515
168 Ga0496123_0012809 3300048926 Bacteria 7110
169 Ga0496124_0076325 3300048927 Bacteria 2766
170 Ga0496125_0218446 3300048928 Bacteria 1230
171 Ga0496126_0118295 3300048929 Bacteria 2301
172 Ga0501034_0435073 3300049571 Bacteria 1231
173 Ga0501038_0158413 3300049574 Bacteria 1842
174 Ga0501039_0247530 3300049575 Bacteria 1402
175 Ga0501040_0275023 3300049576 Bacteria 1203
176 Ga0501041_0214601 3300049577 Bacteria 1207
177 Ga0501043_0341122 3300049579 Bacteria 1140
178 Ga0501046_0851860 3300049580 Bacteria 637
179 Ga0501047_0188956 3300049581 Bacteria 1924
180 Ga0501047_0421158 3300049581 Bacteria 1167
181 Ga0501047_0541320 3300049581 Bacteria 989
182 Ga0501048_0202932 3300049582 Bacteria 1406
183 Ga0501048_0221754 3300049582 Bacteria 1341
184 Ga0501067_0215838 3300049583 Bacteria 1068
185 Ga0501068_0988510 3300049584 Bacteria 555
186 Ga0501069_0261806 3300049585 Bacteria 1010
187 Ga0501070_0129164 3300049586 Bacteria 2088
188 Ga0501071_0114764 3300049587 Bacteria 1993
189 Ga0501072_0153309 3300049588 Bacteria 1837
190 Ga0501073_0225054 3300049589 Bacteria 1296
191 Ga0501076_0089548 3300049592 Bacteria 2474
192 Ga0501077_0029597 3300049593 Bacteria 3482
193 Ga0501079_0306120 3300049741 Bacteria 1243
194 Ga0501080_0125606 3300049742 Bacteria 2376
195 Ga0501081_0211984 3300049743 Bacteria 1407
196 Ga0501081_0622866 3300049743 Bacteria 808
197 Ga0501083_0014992 3300049744 Bacteria 5425
198 Ga0501035_1331027 3300049822 Bacteria 553
199 Ga0501044_0237225 3300049823 Bacteria 1769
200 Ga0501045_0278499 3300049824 Bacteria 1245
201 nmdc:mga08y16_370805_c1 3300050511 Bacteria 1468
202 Ga0500628_000938 3300053129 Bacteria 5126
203 Ga0500559_0031421 3300053136 Bacteria 2278
204 Ga0500616_0190096 3300053153 Bacteria 917
205 Ga0500616_0210109 3300053153 Bacteria 856
206 Ga0501084_0160617 3300054114 Bacteria 1896
207 Ga0590071_137717 3300059421 Bacteria 629
208 Ga0501082_0025890 3300060353 Bacteria 5056
209 Ga0530510_0152958 3300061734 Bacteria 1704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10018052 JGI25406J46586_100180523 125
2 3300005985 Ga0081539_10000070 Ga0081539_1000007090 125
3 3300032005 Ga0307411_11023294 Ga0307411_110232941 135
4 3300041512 Ga0451853_3738132 Ga0451853_3738132_289_810 136
5 3300053129 Ga0500628_000938 Ga0500628_000938_2247_2768 136
6 3300031456 Ga0307513_10191011 Ga0307513_101910113 140
7 3300034957 Ga0373938_0002040 Ga0373938_0002040_368_847 140
8 3300031852 Ga0307410_10518450 Ga0307410_105184501 141
9 3300048929 Ga0496126_0118295 Ga0496126_0118295_1343_1834 141
10 3300041512 Ga0451853_2363731 Ga0451853_2363731_22_462 144
11 3300053153 Ga0500616_0210109 Ga0500616_0210109_405_839 144
12 3300005445 Ga0070708_101087408 Ga0070708_1010874082 145
13 3300005471 Ga0070698_100463672 Ga0070698_1004636722 145
14 3300006028 Ga0070717_11234532 Ga0070717_112345322 145
15 3300039447 Ga0436361_0282341 Ga0436361_0282341_22_459 145
16 3300049575 Ga0501039_0247530 Ga0501039_0247530_568_1044 145
17 3300049577 Ga0501041_0214601 Ga0501041_0214601_172_648 145
18 3300049741 Ga0501079_0306120 Ga0501079_0306120_358_834 145
19 3300049743 Ga0501081_0211984 Ga0501081_0211984_33_509 145
20 3300049824 Ga0501045_0278499 Ga0501045_0278499_152_628 145
21 3300025728 Ga0207655_1162617 Ga0207655_11626171 147
22 3300032002 Ga0307416_101885807 Ga0307416_1018858072 149
23 3300005353 Ga0070669_100033643 Ga0070669_1000336432 150
24 3300005718 Ga0068866_10069947 Ga0068866_100699473 150
25 3300005844 Ga0068862_100360148 Ga0068862_1003601482 150
26 3300009553 Ga0105249_10197737 Ga0105249_101977372 150
27 3300025899 Ga0207642_10057723 Ga0207642_100577232 151
28 3300025923 Ga0207681_10013307 Ga0207681_100133073 151
29 3300025935 Ga0207709_11017107 Ga0207709_110171072 151
30 3300049743 Ga0501081_0622866 Ga0501081_0622866_130_594 152
31 3300005356 Ga0070674_100042190 Ga0070674_1000421902 153
32 3300009094 Ga0111539_11108735 Ga0111539_111087352 153
33 3300025937 Ga0207669_10039317 Ga0207669_100393172 153
34 3300031344 Ga0265316_10168410 Ga0265316_101684102 153
35 3300049582 Ga0501048_0221754 Ga0501048_0221754_222_683 153
36 3300049587 Ga0501071_0114764 Ga0501071_0114764_879_1355 153
37 3300049588 Ga0501072_0153309 Ga0501072_0153309_436_912 153
38 3300050511 nmdc:mga08y16_370805_c1 nmdc:mga08y16_370805_c1_832_1308 153
39 3300054114 Ga0501084_0160617 Ga0501084_0160617_463_939 153
40 3300049584 Ga0501068_0988510 Ga0501068_0988510_64_531 155
41 iso_pu_bacteria 2846540461 2846542161 155
42 iso_pu_bacteria 2711768156 2712470284 156
43 iso_pu_bacteria 2923525760 2923527848 156
44 3300031251 Ga0265327_10000163 Ga0265327_100001638 157
45 iso_pu_bacteria 2501939600 2501944837 157
46 iso_pu_bacteria 2511231221 2512032962 157
47 iso_pu_bacteria 2522572158 2523107799 157
48 iso_pu_bacteria 2622736626 2623585736 157
49 iso_pu_bacteria 2772190715 2772642860 157
50 iso_pu_bacteria 2831935698 2831938153 157
51 iso_pu_bacteria 2855670206 2855674137 157
52 iso_pu_bacteria 2855676851 2855679794 157
53 iso_pu_bacteria 2855683550 2855689815 157
54 iso_pu_bacteria 2856858025 2856859622 157
55 iso_pu_bacteria 2857288857 2857290790 157
56 iso_pu_bacteria 2858868258 2858870882 157
57 iso_pu_bacteria 2858882152 2858885209 157
58 iso_pu_bacteria 2858888857 2858891916 157
59 iso_pu_bacteria 2858895516 2858901940 157
60 iso_pu_bacteria 2869048445 2869053815 157
61 iso_pu_bacteria 2869061728 2869063507 157
62 iso_pu_bacteria 2869068681 2869071272 157
63 iso_pu_bacteria 2880489317 2880494501 157
64 iso_pu_bacteria 2891670763 2891673617 157
65 iso_pu_bacteria 2897803580 2897805555 157
66 iso_pu_bacteria 2902582711 2902588490 157
67 iso_pu_bacteria 2996221748 2996222849 157
68 iso_pu_bacteria 649633069 649816330 157
69 iso_pu_bacteria 8054002106 8054005001 157
70 iso_pu_bacteria 8054727385 8054729603 157
71 iso_pu_bacteria 8054734606 8054740445 157
72 3300003781 Ga0055536_1018249 Ga0055536_10182493 158
73 3300005289 Ga0065704_10177229 Ga0065704_101772292 158
74 3300005327 Ga0070658_10722116 Ga0070658_107221162 158
75 3300005328 Ga0070676_10751659 Ga0070676_107516591 158
76 3300005331 Ga0070670_100138692 Ga0070670_1001386921 158
77 3300005336 Ga0070680_100017505 Ga0070680_1000175053 158
78 3300005339 Ga0070660_100029049 Ga0070660_1000290495 158
79 3300005347 Ga0070668_100027806 Ga0070668_1000278062 158
80 3300005366 Ga0070659_100131902 Ga0070659_1001319023 158
81 3300005458 Ga0070681_10001274 Ga0070681_1000127419 158
82 3300005458 Ga0070681_10080521 Ga0070681_100805213 158
83 3300005466 Ga0070685_10057975 Ga0070685_100579751 158
84 3300005530 Ga0070679_100036100 Ga0070679_1000361006 158
85 3300005530 Ga0070679_100198580 Ga0070679_1001985802 158
86 3300005530 Ga0070679_100621099 Ga0070679_1006210991 158
87 3300005539 Ga0068853_101676665 Ga0068853_1016766651 158
88 3300005841 Ga0068863_101973936 Ga0068863_1019739361 158
89 3300005981 Ga0081538_10015921 Ga0081538_100159215 158
90 3300006846 Ga0075430_100154840 Ga0075430_1001548401 158
91 3300009101 Ga0105247_10392774 Ga0105247_103927741 158
92 3300009177 Ga0105248_10474553 Ga0105248_104745532 158
93 3300009545 Ga0105237_11038757 Ga0105237_110387572 158
94 3300009545 Ga0105237_11902282 Ga0105237_119022822 158
95 3300009551 Ga0105238_10395840 Ga0105238_103958402 158
96 3300013104 Ga0157370_10033870 Ga0157370_100338704 158
97 3300013105 Ga0157369_10009902 Ga0157369_100099024 158
98 3300013105 Ga0157369_11470358 Ga0157369_114703582 158
99 3300013307 Ga0157372_12254133 Ga0157372_122541331 158
100 3300013308 Ga0157375_10571411 Ga0157375_105714112 158
101 3300014325 Ga0163163_10221959 Ga0163163_102219592 158
102 3300014968 Ga0157379_10226354 Ga0157379_102263542 158
103 3300020610 Ga0154015_1294928 Ga0154015_12949281 158
104 3300025254 Ga0209148_1001073 Ga0209148_100107311 158
105 3300025272 Ga0209455_1003349 Ga0209455_10033495 158
106 3300025292 Ga0209676_1000159 Ga0209676_1000159167 158
107 3300025298 Ga0209050_1013871 Ga0209050_10138714 158
108 3300025909 Ga0207705_10446181 Ga0207705_104461812 158
109 3300025912 Ga0207707_10027911 Ga0207707_100279116 158
110 3300025912 Ga0207707_10115410 Ga0207707_101154101 158
111 3300025917 Ga0207660_10073699 Ga0207660_100736992 158
112 3300025917 Ga0207660_10459604 Ga0207660_104596042 158
113 3300025919 Ga0207657_10070634 Ga0207657_100706342 158
114 3300025921 Ga0207652_10067672 Ga0207652_100676722 158
115 3300025921 Ga0207652_10145591 Ga0207652_101455912 158
116 3300025932 Ga0207690_10011807 Ga0207690_100118072 158
117 3300031250 Ga0265331_10007170 Ga0265331_100071706 158
118 3300031251 Ga0265327_10000242 Ga0265327_1000024285 158
119 3300031595 Ga0265313_10003331 Ga0265313_100033316 158
120 3300031901 Ga0307406_10844477 Ga0307406_108444772 158
121 3300031901 Ga0307406_11028565 Ga0307406_110285651 158
122 3300031903 Ga0307407_10118518 Ga0307407_101185183 158
123 3300032002 Ga0307416_100134324 Ga0307416_1001343242 158
124 3300032004 Ga0307414_10258502 Ga0307414_102585021 158
125 3300032126 Ga0307415_101324262 Ga0307415_1013242621 158
126 3300035692 Ga0373935_0006496 Ga0373935_0006496_5031_5522 158
127 3300036712 Ga0316584_0040508 Ga0316584_0040508_1282_1758 158
128 3300036712 Ga0316584_0250459 Ga0316584_0250459_642_1118 158
129 3300037418 Ga0395900_0581668 Ga0395900_0581668_410_886 158
130 3300039438 Ga0436360_0475164 Ga0436360_0475164_141_647 158
131 3300039447 Ga0436361_0954393 Ga0436361_0954393_332_814 158
132 3300044712 Ga0453684_0000006 Ga0453684_0000006_696172_696648 158
133 3300044712 Ga0453684_0030952 Ga0453684_0030952_6377_6853 158
134 3300044712 Ga0453684_0045205 Ga0453684_0045205_4844_5320 158
135 3300045051 Ga0451576_0091070 Ga0451576_0091070_2582_3058 158
136 3300045051 Ga0451576_0966648 Ga0451576_0966648_40_579 158
137 3300046455 Ga0495603_0384230 Ga0495603_0384230_94_585 158
138 3300049571 Ga0501034_0435073 Ga0501034_0435073_99_575 158
139 3300049574 Ga0501038_0158413 Ga0501038_0158413_349_825 158
140 3300049576 Ga0501040_0275023 Ga0501040_0275023_395_871 158
141 3300049579 Ga0501043_0341122 Ga0501043_0341122_217_717 158
142 3300049580 Ga0501046_0851860 Ga0501046_0851860_54_530 158
143 3300049581 Ga0501047_0421158 Ga0501047_0421158_101_577 158
144 3300049581 Ga0501047_0541320 Ga0501047_0541320_25_504 158
145 3300049582 Ga0501048_0202932 Ga0501048_0202932_500_976 158
146 3300049583 Ga0501067_0215838 Ga0501067_0215838_83_559 158
147 3300049585 Ga0501069_0261806 Ga0501069_0261806_166_642 158
148 3300049586 Ga0501070_0129164 Ga0501070_0129164_169_645 158
149 3300049589 Ga0501073_0225054 Ga0501073_0225054_108_584 158
150 3300049592 Ga0501076_0089548 Ga0501076_0089548_1049_1525 158
151 3300049742 Ga0501080_0125606 Ga0501080_0125606_1251_1727 158
152 3300049744 Ga0501083_0014992 Ga0501083_0014992_791_1267 158
153 3300049823 Ga0501044_0237225 Ga0501044_0237225_1028_1507 158
154 3300053136 Ga0500559_0031421 Ga0500559_0031421_1214_1690 158
155 3300053153 Ga0500616_0190096 Ga0500616_0190096_191_667 158
156 3300059421 Ga0590071_137717 Ga0590071_137717_106_582 158
157 3300060353 Ga0501082_0025890 Ga0501082_0025890_965_1441 158
158 3300061734 Ga0530510_0152958 Ga0530510_0152958_290_766 158
159 iso_pu_bacteria 2515154129 2515721154 158
160 iso_pu_bacteria 2515154202 2516084239 158
161 iso_pu_bacteria 2597490356 2599101394 158
162 iso_pu_bacteria 2846952575 2846953882 158
163 iso_pu_bacteria 2848858292 2848859932 158
164 3300005458 Ga0070681_10118631 Ga0070681_101186313 159
165 3300005563 Ga0068855_100591081 Ga0068855_1005910812 159
166 3300005563 Ga0068855_101447663 Ga0068855_1014476632 159
167 3300006173 Ga0070716_100769193 Ga0070716_1007691932 159
168 3300009011 Ga0105251_10000374 Ga0105251_100003749 159
169 3300009036 Ga0105244_10000006 Ga0105244_10000006347 159
170 3300009036 Ga0105244_10001185 Ga0105244_1000118523 159
171 3300013104 Ga0157370_10000567 Ga0157370_1000056713 159
172 3300013104 Ga0157370_10289353 Ga0157370_102893532 159
173 3300025728 Ga0207655_1000149 Ga0207655_100014978 159
174 3300025915 Ga0207693_10542334 Ga0207693_105423342 159
175 3300025917 Ga0207660_10182257 Ga0207660_101822572 159
176 3300025921 Ga0207652_10388329 Ga0207652_103883292 159
177 3300025939 Ga0207665_10454398 Ga0207665_104543981 159
178 3300031903 Ga0307407_10102180 Ga0307407_101021802 159
179 3300041405 Ga0439438_032469 Ga0439438_032469_667_1146 159
180 3300039438 Ga0436360_1185953 Ga0436360_1185953_192_710 160
181 3300044712 Ga0453684_0011270 Ga0453684_0011270_1098_1610 160
182 3300049581 Ga0501047_0188956 Ga0501047_0188956_106_594 160
183 3300049593 Ga0501077_0029597 Ga0501077_0029597_2963_3445 160
184 3300002773 JGI25152J39213_1000744 JGI25152J39213_100074415 161
185 3300003856 Ga0058692_1000955 Ga0058692_10009557 161
186 3300003856 Ga0058692_1002632 Ga0058692_10026323 161
187 3300005290 Ga0065712_10390296 Ga0065712_103902962 161
188 3300006946 Ga0079104_1005246 Ga0079104_10052464 161
189 3300009011 Ga0105251_10006664 Ga0105251_100066647 161
190 3300009011 Ga0105251_10108451 Ga0105251_101084512 161
191 3300009036 Ga0105244_10007370 Ga0105244_100073705 161
192 3300009036 Ga0105244_10021827 Ga0105244_100218274 161
193 3300009036 Ga0105244_10066222 Ga0105244_100662223 161
194 3300009092 Ga0105250_10019474 Ga0105250_100194744 161
195 3300013102 Ga0157371_10156977 Ga0157371_101569772 161
196 3300013105 Ga0157369_10024023 Ga0157369_100240235 161
197 3300013307 Ga0157372_10059046 Ga0157372_100590465 161
198 3300021384 Ga0213876_10000166 Ga0213876_1000016640 161
199 3300025258 Ga0209129_1000015 Ga0209129_1000015465 161
200 3300025711 Ga0207696_1001947 Ga0207696_10019475 161
201 3300025728 Ga0207655_1019463 Ga0207655_10194631 161
202 3300025728 Ga0207655_1034567 Ga0207655_10345673 161
203 3300025735 Ga0207713_1036719 Ga0207713_10367193 161
204 3300025735 Ga0207713_1086685 Ga0207713_10866853 161
205 3300027111 Ga0209281_1004537 Ga0209281_10045374 161
206 3300027312 Ga0209371_1000047 Ga0209371_1000047208 161
207 3300027312 Ga0209371_1000056 Ga0209371_100005696 161
208 3300027312 Ga0209371_1002999 Ga0209371_10029997 161
209 3300030500 Ga0268256_1000003 Ga0268256_1000003506 161
210 3300030500 Ga0268256_1000071 Ga0268256_1000071137 161
211 3300030500 Ga0268256_1030732 Ga0268256_10307322 161
212 3300030763 Ga0265763_1003723 Ga0265763_10037232 161
213 3300037466 Ga0395898_0001625 Ga0395898_0001625_9614_10105 161
214 3300038443 Ga0395901_0011778 Ga0395901_0011778_3126_3617 161
215 3300039437 Ga0436365_0105401 Ga0436365_0105401_42052_42537 161
216 3300041405 Ga0439438_048992 Ga0439438_048992_569_1054 161
217 3300042010 Ga0439452_000029 Ga0439452_000029_194781_195266 161
218 3300046458 Ga0495591_004081 Ga0495591_004081_6664_7149 161
219 3300046460 Ga0495638_0004017 Ga0495638_0004017_6636_7121 161
220 3300046513 Ga0495616_0083215 Ga0495616_0083215_469_954 161
221 3300046515 Ga0495620_0013817 Ga0495620_0013817_982_1467 161
222 3300046530 Ga0495654_0003824 Ga0495654_0003824_5096_5581 161
223 3300046530 Ga0495654_0011345 Ga0495654_0011345_4283_4774 161
224 3300046542 Ga0495597_0001596 Ga0495597_0001596_12498_12995 161
225 3300046660 Ga0495625_0011116 Ga0495625_0011116_5007_5498 161
226 3300046674 Ga0495588_0029153 Ga0495588_0029153_1413_1910 161
227 3300046694 Ga0495649_0000984 Ga0495649_0000984_4484_4969 161
228 3300047320 Ga0495672_0000070 Ga0495672_0000070_36810_37307 161
229 3300047446 Ga0495679_000021 Ga0495679_000021_167442_167933 161
230 3300047446 Ga0495679_000893 Ga0495679_000893_17662_18147 161
231 3300048920 Ga0496117_0001907 Ga0496117_0001907_778_1263 161
232 3300048920 Ga0496117_0018339 Ga0496117_0018339_4539_5024 161
233 3300048921 Ga0496118_0002095 Ga0496118_0002095_24816_25301 161
234 3300048921 Ga0496118_0302856 Ga0496118_0302856_27_512 161
235 3300048922 Ga0496119_0001020 Ga0496119_0001020_13965_14450 161
236 3300048923 Ga0496120_0014421 Ga0496120_0014421_4757_5242 161
237 3300048925 Ga0496122_0019192 Ga0496122_0019192_231_716 161
238 3300048925 Ga0496122_0076837 Ga0496122_0076837_948_1436 161
239 3300048925 Ga0496122_0293307 Ga0496122_0293307_288_773 161
240 3300048926 Ga0496123_0000808 Ga0496123_0000808_13189_13677 161
241 3300048926 Ga0496123_0012809 Ga0496123_0012809_4270_4755 161
242 3300048927 Ga0496124_0076325 Ga0496124_0076325_994_1479 161
243 3300048928 Ga0496125_0218446 Ga0496125_0218446_476_961 161
244 3300049822 Ga0501035_1331027 Ga0501035_1331027_34_537 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

36

171

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9836 13 157
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9768 13 157
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9716 12 147
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9706 11 147
4pya-assembly1.cif.gz_A moac k51a in complex with 3',8-ch2gtp 0.9691 23 146
ID Description Score Start End Superfamily
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9706 11 147 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.967 11 156 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9657 15 145 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9653 4 158 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9604 11 156 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A848P3A3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 1.002 22 156 GO:0006777
GO:0061798
GO:0061799
AF-A0A7C2SMW5-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9975 31 158 GO:0006777
GO:0061798
GO:0061799
AF-X0TEN6-F1-model_v4 Molybdopterin cofactor biosynthesis C (MoaC) domain-containing protein 0.9959 15 112 GO:0006777
AF-A0A4Q2XSH4-F1-model_v4 deleted 0.9957 27 157
AF-A0A848P3A3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9951 22 156 GO:0006777
GO:0061798
GO:0061799

Feature Viewer

pLDDT pTM Quality
91.76 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map