F356268

General Info

Members Datasets Scaffolds Average Seq Length
244 126 488 154

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100002230|Ga0070705_1000022308
Length 160
Sequence VSYDAAMSYPQVGDPVPPFEMQADDGATVSNESLLGQRYVMYFYPKDDTPGCTTQACSLRDNFGRVIGTGVEVFGVSPDSVASHVRFREKYDLPYRLLADIGHQAADAFGTWVEKKFAGKTYKGVERTSFIIGPDGRVEHVLPRVKPVEHVDMLMERLAA

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
55 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
56 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
57 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
58 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
77 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.33
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100002230 3300005440 Bacteria 9833
2 Ga0065707_10108289 3300005295 Bacteria 2516
3 Ga0065707_10386099 3300005295 Bacteria 865
4 Ga0070658_10027775 3300005327 Bacteria 4541
5 Ga0070680_100236155 3300005336 Bacteria 1544
6 Ga0070682_101089819 3300005337 Bacteria 668
7 Ga0070660_100124563 3300005339 Bacteria 2058
8 Ga0070689_100533644 3300005340 Bacteria 1009
9 Ga0070687_100519034 3300005343 Bacteria 805
10 Ga0070668_101638475 3300005347 Bacteria 590
11 Ga0070675_101801873 3300005354 Bacteria 565
12 Ga0070659_100053056 3300005366 Bacteria 3191
13 Ga0070705_100116422 3300005440 Bacteria 1718
14 Ga0070708_100000015 3300005445 Bacteria 127672
15 Ga0070706_100047734 3300005467 Bacteria 3952
16 Ga0070706_100341536 3300005467 Bacteria 1396
17 Ga0070707_100245276 3300005468 Bacteria 1743
18 Ga0070707_100692649 3300005468 Bacteria 982
19 Ga0070707_101782605 3300005468 Bacteria 583
20 Ga0070698_100002111 3300005471 Bacteria 22092
21 Ga0070698_100567547 3300005471 Bacteria 1074
22 Ga0070698_101309759 3300005471 Bacteria 674
23 Ga0068853_100756191 3300005539 Bacteria 929
24 Ga0070695_100309255 3300005545 Bacteria 1171
25 Ga0070696_100006886 3300005546 Bacteria 7587
26 Ga0070704_100016193 3300005549 Bacteria 4706
27 Ga0070704_100274492 3300005549 Bacteria 1394
28 Ga0068859_100289879 3300005617 Bacteria 1730
29 Ga0068858_100485225 3300005842 Bacteria 1193
30 Ga0068871_100475147 3300006358 Bacteria 1124
31 Ga0075434_100150727 3300006871 Bacteria 2346
32 Ga0097620_100289888 3300006931 Bacteria 1730
33 Ga0111539_10140129 3300009094 Bacteria 2831
34 Ga0114129_10208628 3300009147 Bacteria 2642
35 Ga0105243_11834686 3300009148 Bacteria 638
36 Ga0105237_10182925 3300009545 Bacteria 2096
37 Ga0105238_10035597 3300009551 Bacteria 5061
38 Ga0157369_10134028 3300013105 Bacteria 2623
39 Ga0157374_10404075 3300013296 Bacteria 1363
40 Ga0157372_11757092 3300013307 Bacteria 713
41 Ga0157375_11505953 3300013308 Bacteria 794
42 Ga0163163_11708258 3300014325 Bacteria 690
43 Ga0206356_11323987 3300020070 Bacteria 1459
44 Ga0207684_10405642 3300025910 Bacteria 1172
45 Ga0207684_10421069 3300025910 Bacteria 1147
46 Ga0207671_10190911 3300025914 Bacteria 1597
47 Ga0207657_10002359 3300025919 Bacteria 20451
48 Ga0207646_10096602 3300025922 Bacteria 2647
49 Ga0207646_10140005 3300025922 Bacteria 2179
50 Ga0207646_10209887 3300025922 Bacteria 1759
51 Ga0207646_10478841 3300025922 Bacteria 1122
52 Ga0207659_11118587 3300025926 Bacteria 678
53 Ga0207690_10104316 3300025932 Bacteria 2031
54 Ga0207667_10437791 3300025949 Bacteria 1329
55 Ga0207703_10317813 3300026035 Bacteria 1425
56 Ga0209970_1012195 3300027614 Bacteria 1421
57 Ga0209971_1014119 3300027682 Bacteria 1892
58 Ga0209966_1054775 3300027695 Bacteria 853
59 Ga0209998_10000050 3300027717 Bacteria 47820
60 Ga0209974_10015427 3300027876 Bacteria 2537
61 Ga0268264_10084257 3300028381 Bacteria 2725
62 Ga0265338_10298115 3300028800 Bacteria 1173
63 Ga0373962_0137680 3300035242 Bacteria 791
64 Ga0395900_0557776 3300037418 Bacteria 1089
65 Ga0395901_1016196 3300038443 Bacteria 804
66 Ga0439453_0045218 3300041408 Bacteria 875
67 Ga0439441_002461 3300042001 Bacteria 2613
68 Ga0450923_000456 3300042125 Bacteria 4463
69 Ga0450910_005281 3300042147 Bacteria 1759
70 Ga0439460_0119156 3300042461 Bacteria 862
71 Ga0466965_0045866 3300044683 Bacteria 2163
72 Ga0466961_0149578 3300044693 Bacteria 1458
73 Ga0466963_0002229 3300044694 Bacteria 10740
74 Ga0466963_0009704 3300044694 Bacteria 5805
75 Ga0466963_1004214 3300044694 Bacteria 587
76 Ga0466964_0045848 3300044706 Bacteria 1780
77 Ga0466957_0691494 3300044842 Bacteria 719
78 Ga0466959_0103799 3300045049 Bacteria 2033
79 Ga0451576_0123072 3300045051 Bacteria 2701
80 Ga0451576_1428244 3300045051 Bacteria 720
81 Ga0466958_0111724 3300045836 Bacteria 1706
82 Ga0466967_0001152 3300045976 Bacteria 14777
83 Ga0466967_0219350 3300045976 Bacteria 1806
84 Ga0466967_0273181 3300045976 Bacteria 1620
85 Ga0466967_2252831 3300045976 Bacteria 540
86 Ga0495629_0081194 3300046459 Bacteria 2263
87 Ga0495641_0196913 3300046461 Bacteria 903
88 Ga0495653_0078115 3300046463 Bacteria 2456
89 Ga0495608_0038205 3300046511 Bacteria 3225
90 Ga0495587_0109362 3300046536 Bacteria 1589
91 Ga0495667_0042221 3300046559 Unclassified 3024
92 Ga0495657_0010185 3300046675 Bacteria 7083
93 Ga0495613_0290424 3300046689 Bacteria 1134
94 Ga0495670_0118201 3300046691 Bacteria 1376
95 Ga0495589_0242893 3300046794 Bacteria 843
96 Ga0495589_0282613 3300046794 Bacteria 771
97 Ga0495680_0138752 3300047322 Bacteria 1780
98 Ga0495684_0594150 3300047471 Bacteria 748
99 Ga0496100_0305343 3300048903 Bacteria 1192
100 Ga0496104_0031455 3300048907 Bacteria 4935
101 Ga0496104_0313843 3300048907 Bacteria 1481
102 Ga0496104_0617231 3300048907 Bacteria 994
103 Ga0496105_0008290 3300048908 Bacteria 8077
104 Ga0496108_0045293 3300048911 Bacteria 3674
105 Ga0496109_0033565 3300048912 Bacteria 4617
106 Ga0496109_1090615 3300048912 Bacteria 735
107 Ga0496110_0138794 3300048913 Bacteria 2198
108 Ga0496110_0363684 3300048913 Bacteria 1318
109 Ga0496114_0438959 3300048917 Bacteria 1156
110 Ga0496114_1132312 3300048917 Bacteria 668
111 Ga0496115_0078425 3300048918 Bacteria 2687
112 Ga0501031_0029328 3300049568 Bacteria 3589
113 Ga0501031_0030927 3300049568 Bacteria 3493
114 Ga0501031_0109150 3300049568 Bacteria 1807
115 Ga0501031_0169420 3300049568 Bacteria 1427
116 Ga0501036_0037270 3300049572 Bacteria 4114
117 Ga0501036_0178741 3300049572 Bacteria 1787
118 Ga0501036_0221182 3300049572 Bacteria 1590
119 Ga0501037_0716202 3300049573 Bacteria 665
120 Ga0501038_0281877 3300049574 Bacteria 1308
121 Ga0501039_0002863 3300049575 Bacteria 12906
122 Ga0501039_0059399 3300049575 Bacteria 2962
123 Ga0501039_0156792 3300049575 Bacteria 1789
124 Ga0501039_0217622 3300049575 Bacteria 1502
125 Ga0501039_0334158 3300049575 Bacteria 1191
126 Ga0501039_0391483 3300049575 Bacteria 1091
127 Ga0501040_0008028 3300049576 Bacteria 6855
128 Ga0501040_0040345 3300049576 Bacteria 3177
129 Ga0501040_0167874 3300049576 Bacteria 1553
130 Ga0501040_0191238 3300049576 Bacteria 1452
131 Ga0501040_1005587 3300049576 Bacteria 604
132 Ga0501041_0001556 3300049577 Bacteria 12764
133 Ga0501041_0003423 3300049577 Bacteria 9128
134 Ga0501041_0173536 3300049577 Bacteria 1349
135 Ga0501041_0421985 3300049577 Bacteria 846
136 Ga0501041_0594774 3300049577 Bacteria 706
137 Ga0501042_0005034 3300049578 Bacteria 8473
138 Ga0501042_0081793 3300049578 Bacteria 2315
139 Ga0501042_0120233 3300049578 Bacteria 1891
140 Ga0501042_0747446 3300049578 Bacteria 711
141 Ga0501043_0097398 3300049579 Bacteria 2313
142 Ga0501043_0230979 3300049579 Bacteria 1429
143 Ga0501046_0003403 3300049580 Bacteria 14602
144 Ga0501046_0481607 3300049580 Bacteria 890
145 Ga0501048_0007152 3300049582 Bacteria 8481
146 Ga0501048_0033799 3300049582 Bacteria 3692
147 Ga0501067_0085361 3300049583 Bacteria 1752
148 Ga0501067_0098362 3300049583 Bacteria 1625
149 Ga0501068_0011234 3300049584 Bacteria 5050
150 Ga0501068_0093566 3300049584 Bacteria 1857
151 Ga0501068_0199408 3300049584 Bacteria 1269
152 Ga0501069_0006749 3300049585 Bacteria 6010
153 Ga0501069_0035985 3300049585 Bacteria 2728
154 Ga0501069_0050040 3300049585 Bacteria 2323
155 Ga0501069_0051594 3300049585 Bacteria 2289
156 Ga0501069_0083007 3300049585 Bacteria 1806
157 Ga0501069_0365839 3300049585 Bacteria 851
158 Ga0501070_0000402 3300049586 Bacteria 39380
159 Ga0501070_0017125 3300049586 Bacteria 6082
160 Ga0501070_0070080 3300049586 Bacteria 2903
161 Ga0501070_0076344 3300049586 Bacteria 2774
162 Ga0501070_0172216 3300049586 Bacteria 1783
163 Ga0501071_0004233 3300049587 Bacteria 9088
164 Ga0501071_0031352 3300049587 Bacteria 3767
165 Ga0501071_0114208 3300049587 Bacteria 1997
166 Ga0501071_0202887 3300049587 Bacteria 1490
167 Ga0501072_0009636 3300049588 Bacteria 7347
168 Ga0501072_0009699 3300049588 Bacteria 7322
169 Ga0501072_0011456 3300049588 Bacteria 6779
170 Ga0501072_0167965 3300049588 Bacteria 1750
171 Ga0501072_0354074 3300049588 Bacteria 1165
172 Ga0501072_0419263 3300049588 Bacteria 1061
173 Ga0501072_0907613 3300049588 Bacteria 688
174 Ga0501073_0205745 3300049589 Bacteria 1360
175 Ga0501074_0002666 3300049590 Bacteria 12491
176 Ga0501074_0020582 3300049590 Bacteria 4795
177 Ga0501074_0203337 3300049590 Bacteria 1411
178 Ga0501074_0445363 3300049590 Bacteria 918
179 Ga0501074_0580113 3300049590 Bacteria 793
180 Ga0501075_0029269 3300049591 Bacteria 4071
181 Ga0501075_0043711 3300049591 Bacteria 3360
182 Ga0501075_0077757 3300049591 Bacteria 2511
183 Ga0501075_0116370 3300049591 Bacteria 2032
184 Ga0501075_0993350 3300049591 Bacteria 638
185 Ga0501075_1364609 3300049591 Bacteria 537
186 Ga0501076_0000580 3300049592 Bacteria 23366
187 Ga0501076_0027930 3300049592 Bacteria 4377
188 Ga0501076_0072335 3300049592 Bacteria 2759
189 Ga0501076_0132149 3300049592 Bacteria 2024
190 Ga0501076_0185118 3300049592 Bacteria 1698
191 Ga0501076_0593685 3300049592 Bacteria 913
192 Ga0501076_0733613 3300049592 Unclassified 815
193 Ga0501077_0099894 3300049593 Bacteria 1839
194 Ga0501077_0115640 3300049593 Bacteria 1700
195 Ga0501077_0141884 3300049593 Bacteria 1524
196 Ga0501077_0143549 3300049593 Bacteria 1514
197 Ga0501077_0372433 3300049593 Bacteria 912
198 Ga0501077_0966545 3300049593 Bacteria 548
199 Ga0501079_0007151 3300049741 Bacteria 8426
200 Ga0501079_0023795 3300049741 Bacteria 4700
201 Ga0501079_0129238 3300049741 Bacteria 1966
202 Ga0501079_0249735 3300049741 Bacteria 1386
203 Ga0501079_0269371 3300049741 Bacteria 1331
204 Ga0501079_0417894 3300049741 Bacteria 1052
205 Ga0501080_0006149 3300049742 Bacteria 10772
206 Ga0501080_0015651 3300049742 Bacteria 6993
207 Ga0501080_0425765 3300049742 Bacteria 1192
208 Ga0501080_0609543 3300049742 Bacteria 969
209 Ga0501080_1396674 3300049742 Bacteria 597
210 Ga0501081_0002120 3300049743 Bacteria 12413
211 Ga0501081_0008002 3300049743 Bacteria 6861
212 Ga0501081_0013338 3300049743 Bacteria 5406
213 Ga0501081_0178434 3300049743 Bacteria 1535
214 Ga0501083_0031621 3300049744 Bacteria 3632
215 Ga0501083_0113165 3300049744 Bacteria 1783
216 Ga0501083_0157247 3300049744 Bacteria 1487
217 Ga0501083_0219759 3300049744 Bacteria 1238
218 Ga0501083_0817440 3300049744 Bacteria 606
219 Ga0501035_0025280 3300049822 Bacteria 5444
220 Ga0501044_0714328 3300049823 Bacteria 887
221 Ga0501045_0000661 3300049824 Bacteria 21897
222 Ga0501045_0040593 3300049824 Bacteria 3385
223 Ga0501045_0339331 3300049824 Bacteria 1118
224 nmdc:mga05p37_74254_c1 3300050507 Bacteria 4185
225 nmdc:mga09592_1043852_c1 3300050508 Bacteria 681
226 nmdc:mga0n895_274497_c1 3300050512 Bacteria 1710
227 nmdc:mga0rr50_200170_c1 3300050513 Bacteria 1641
228 Ga0495601_0195064 3300053077 Bacteria 1324
229 Ga0495619_0031636 3300053085 Bacteria 3429
230 Ga0501084_0001566 3300054114 Bacteria 18134
231 Ga0501084_0013890 3300054114 Bacteria 6665
232 Ga0501084_0023843 3300054114 Bacteria 5104
233 Ga0501084_0026055 3300054114 Bacteria 4877
234 Ga0501084_0087295 3300054114 Bacteria 2619
235 Ga0501084_0340313 3300054114 Bacteria 1267
236 Ga0501084_1214205 3300054114 Bacteria 632
237 Ga0590074_031681 3300059423 Bacteria 935
238 Ga0501082_0092031 3300060353 Bacteria 2619
239 Ga0501082_0131702 3300060353 Bacteria 2170
240 Ga0501082_0176587 3300060353 Bacteria 1857
241 Ga0530510_0007005 3300061734 Bacteria 7853
242 Ga0530510_0026614 3300061734 Bacteria 4141
243 Ga0530510_0109587 3300061734 Bacteria 2022
244 Ga0530510_0790282 3300061734 Bacteria 724
245 Ga0070705_100002230
246 Ga0065707_10108289
247 Ga0065707_10386099
248 Ga0070658_10027775
249 Ga0070680_100236155
250 Ga0070682_101089819
251 Ga0070660_100124563
252 Ga0070689_100533644
253 Ga0070687_100519034
254 Ga0070668_101638475
255 Ga0070675_101801873
256 Ga0070659_100053056
257 Ga0070705_100116422
258 Ga0070708_100000015
259 Ga0070706_100047734
260 Ga0070706_100341536
261 Ga0070707_100245276
262 Ga0070707_100692649
263 Ga0070707_101782605
264 Ga0070698_100002111
265 Ga0070698_100567547
266 Ga0070698_101309759
267 Ga0068853_100756191
268 Ga0070695_100309255
269 Ga0070696_100006886
270 Ga0070704_100016193
271 Ga0070704_100274492
272 Ga0068859_100289879
273 Ga0068858_100485225
274 Ga0068871_100475147
275 Ga0075434_100150727
276 Ga0097620_100289888
277 Ga0111539_10140129
278 Ga0114129_10208628
279 Ga0105243_11834686
280 Ga0105237_10182925
281 Ga0105238_10035597
282 Ga0157369_10134028
283 Ga0157374_10404075
284 Ga0157372_11757092
285 Ga0157375_11505953
286 Ga0163163_11708258
287 Ga0206356_11323987
288 Ga0207684_10405642
289 Ga0207684_10421069
290 Ga0207671_10190911
291 Ga0207657_10002359
292 Ga0207646_10096602
293 Ga0207646_10140005
294 Ga0207646_10209887
295 Ga0207646_10478841
296 Ga0207659_11118587
297 Ga0207690_10104316
298 Ga0207667_10437791
299 Ga0207703_10317813
300 Ga0209970_1012195
301 Ga0209971_1014119
302 Ga0209966_1054775
303 Ga0209998_10000050
304 Ga0209974_10015427
305 Ga0268264_10084257
306 Ga0265338_10298115
307 Ga0373962_0137680
308 Ga0395900_0557776
309 Ga0395901_1016196
310 Ga0439453_0045218
311 Ga0439441_002461
312 Ga0450923_000456
313 Ga0450910_005281
314 Ga0439460_0119156
315 Ga0466965_0045866
316 Ga0466961_0149578
317 Ga0466963_0002229
318 Ga0466963_0009704
319 Ga0466963_1004214
320 Ga0466964_0045848
321 Ga0466957_0691494
322 Ga0466959_0103799
323 Ga0451576_0123072
324 Ga0451576_1428244
325 Ga0466958_0111724
326 Ga0466967_0001152
327 Ga0466967_0219350
328 Ga0466967_0273181
329 Ga0466967_2252831
330 Ga0495629_0081194
331 Ga0495641_0196913
332 Ga0495653_0078115
333 Ga0495608_0038205
334 Ga0495587_0109362
335 Ga0495667_0042221
336 Ga0495657_0010185
337 Ga0495613_0290424
338 Ga0495670_0118201
339 Ga0495589_0242893
340 Ga0495589_0282613
341 Ga0495680_0138752
342 Ga0495684_0594150
343 Ga0496100_0305343
344 Ga0496104_0031455
345 Ga0496104_0313843
346 Ga0496104_0617231
347 Ga0496105_0008290
348 Ga0496108_0045293
349 Ga0496109_0033565
350 Ga0496109_1090615
351 Ga0496110_0138794
352 Ga0496110_0363684
353 Ga0496114_0438959
354 Ga0496114_1132312
355 Ga0496115_0078425
356 Ga0501031_0029328
357 Ga0501031_0030927
358 Ga0501031_0109150
359 Ga0501031_0169420
360 Ga0501036_0037270
361 Ga0501036_0178741
362 Ga0501036_0221182
363 Ga0501037_0716202
364 Ga0501038_0281877
365 Ga0501039_0002863
366 Ga0501039_0059399
367 Ga0501039_0156792
368 Ga0501039_0217622
369 Ga0501039_0334158
370 Ga0501039_0391483
371 Ga0501040_0008028
372 Ga0501040_0040345
373 Ga0501040_0167874
374 Ga0501040_0191238
375 Ga0501040_1005587
376 Ga0501041_0001556
377 Ga0501041_0003423
378 Ga0501041_0173536
379 Ga0501041_0421985
380 Ga0501041_0594774
381 Ga0501042_0005034
382 Ga0501042_0081793
383 Ga0501042_0120233
384 Ga0501042_0747446
385 Ga0501043_0097398
386 Ga0501043_0230979
387 Ga0501046_0003403
388 Ga0501046_0481607
389 Ga0501048_0007152
390 Ga0501048_0033799
391 Ga0501067_0085361
392 Ga0501067_0098362
393 Ga0501068_0011234
394 Ga0501068_0093566
395 Ga0501068_0199408
396 Ga0501069_0006749
397 Ga0501069_0035985
398 Ga0501069_0050040
399 Ga0501069_0051594
400 Ga0501069_0083007
401 Ga0501069_0365839
402 Ga0501070_0000402
403 Ga0501070_0017125
404 Ga0501070_0070080
405 Ga0501070_0076344
406 Ga0501070_0172216
407 Ga0501071_0004233
408 Ga0501071_0031352
409 Ga0501071_0114208
410 Ga0501071_0202887
411 Ga0501072_0009636
412 Ga0501072_0009699
413 Ga0501072_0011456
414 Ga0501072_0167965
415 Ga0501072_0354074
416 Ga0501072_0419263
417 Ga0501072_0907613
418 Ga0501073_0205745
419 Ga0501074_0002666
420 Ga0501074_0020582
421 Ga0501074_0203337
422 Ga0501074_0445363
423 Ga0501074_0580113
424 Ga0501075_0029269
425 Ga0501075_0043711
426 Ga0501075_0077757
427 Ga0501075_0116370
428 Ga0501075_0993350
429 Ga0501075_1364609
430 Ga0501076_0000580
431 Ga0501076_0027930
432 Ga0501076_0072335
433 Ga0501076_0132149
434 Ga0501076_0185118
435 Ga0501076_0593685
436 Ga0501076_0733613
437 Ga0501077_0099894
438 Ga0501077_0115640
439 Ga0501077_0141884
440 Ga0501077_0143549
441 Ga0501077_0372433
442 Ga0501077_0966545
443 Ga0501079_0007151
444 Ga0501079_0023795
445 Ga0501079_0129238
446 Ga0501079_0249735
447 Ga0501079_0269371
448 Ga0501079_0417894
449 Ga0501080_0006149
450 Ga0501080_0015651
451 Ga0501080_0425765
452 Ga0501080_0609543
453 Ga0501080_1396674
454 Ga0501081_0002120
455 Ga0501081_0008002
456 Ga0501081_0013338
457 Ga0501081_0178434
458 Ga0501083_0031621
459 Ga0501083_0113165
460 Ga0501083_0157247
461 Ga0501083_0219759
462 Ga0501083_0817440
463 Ga0501035_0025280
464 Ga0501044_0714328
465 Ga0501045_0000661
466 Ga0501045_0040593
467 Ga0501045_0339331
468 nmdc:mga05p37_74254_c1
469 nmdc:mga09592_1043852_c1
470 nmdc:mga0n895_274497_c1
471 nmdc:mga0rr50_200170_c1
472 Ga0495601_0195064
473 Ga0495619_0031636
474 Ga0501084_0001566
475 Ga0501084_0013890
476 Ga0501084_0023843
477 Ga0501084_0026055
478 Ga0501084_0087295
479 Ga0501084_0340313
480 Ga0501084_1214205
481 Ga0590074_031681
482 Ga0501082_0092031
483 Ga0501082_0131702
484 Ga0501082_0176587
485 Ga0530510_0007005
486 Ga0530510_0026614
487 Ga0530510_0109587
488 Ga0530510_0790282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

12

141

0.99

PF08534

Redoxin

Redoxin

11

153

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9468 13 153
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9459 13 153
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9446 13 153
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9431 13 153
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9238 5 153
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9729 5 152 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9652 5 153 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9602 5 152 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9467 13 153 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9458 5 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A521GT86-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9771 5 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2R6C526-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9767 31 151 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2H0S8Z9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9761 8 152 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2E3ZXI1-F1-model_v4 deleted 0.9751 6 153
AF-A0A022KUU0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9743 3 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map