F354144

General Info

Members Datasets Scaffolds Average Seq Length
241 181 482 127

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0119317|Ga0501071_0119317_1383_1904
Length 142
Sequence VDADAVEHLVMMQRVADFFRAFLLLELLRGMWLTGRHAFARKITVQYPEEKTPQSPRFRGLHALRRYPNGEERCIACKLCEAVCPALAIHIESESRAVETRILEFHGEKRGDLYYTKPMLLAVGDRYEEQIAKDRAADAAFR

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 0
Rhizosphere 98.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0119317 3300049587 Bacteria 1954
2 JGI24738J21930_10006379 3300002075 Bacteria 2772
3 Ga0070658_10295499 3300005327 Bacteria 1381
4 Ga0070670_100010038 3300005331 Bacteria 8081
5 Ga0070670_100013475 3300005331 Bacteria 7004
6 Ga0070670_100498332 3300005331 Bacteria 1083
7 Ga0070680_100111888 3300005336 Bacteria 2273
8 Ga0070680_100454635 3300005336 Bacteria 1094
9 Ga0070680_101184771 3300005336 Bacteria 661
10 Ga0070660_100092475 3300005339 Bacteria 2387
11 Ga0070689_100766518 3300005340 Bacteria 846
12 Ga0070675_100205172 3300005354 Bacteria 1712
13 Ga0070674_100127966 3300005356 Bacteria 1889
14 Ga0070709_10607205 3300005434 Bacteria 843
15 Ga0070714_100863643 3300005435 Bacteria 878
16 Ga0070705_100057574 3300005440 Bacteria 2293
17 Ga0070694_100060390 3300005444 Bacteria 2585
18 Ga0070694_100272464 3300005444 Bacteria 1288
19 Ga0070694_101331882 3300005444 Bacteria 605
20 Ga0070681_10179520 3300005458 Bacteria 2039
21 Ga0070681_11005220 3300005458 Bacteria 754
22 Ga0070706_100024838 3300005467 Bacteria 5517
23 Ga0070698_100003836 3300005471 Bacteria 16525
24 Ga0070679_100143373 3300005530 Bacteria 2367
25 Ga0070679_100584230 3300005530 Bacteria 1060
26 Ga0070697_100002415 3300005536 Bacteria 14379
27 Ga0068853_100074249 3300005539 Bacteria 2967
28 Ga0070695_100242074 3300005545 Bacteria 1309
29 Ga0070695_100644891 3300005545 Bacteria 836
30 Ga0070696_100919676 3300005546 Bacteria 727
31 Ga0070693_100460224 3300005547 Bacteria 895
32 Ga0070693_100572475 3300005547 Bacteria 811
33 Ga0070704_100017269 3300005549 Bacteria 4584
34 Ga0070704_100054427 3300005549 Bacteria 2831
35 Ga0070704_100149593 3300005549 Bacteria 1834
36 Ga0068856_100240997 3300005614 Bacteria 1824
37 Ga0068859_101192372 3300005617 Bacteria 838
38 Ga0068864_100000871 3300005618 Bacteria 25420
39 Ga0068864_100054311 3300005618 Bacteria 3457
40 Ga0068870_10205110 3300005840 Bacteria 1197
41 Ga0068858_100939053 3300005842 Bacteria 846
42 Ga0068860_100792902 3300005843 Bacteria 960
43 Ga0068862_100821304 3300005844 Bacteria 909
44 Ga0070715_10382216 3300006163 Bacteria 778
45 Ga0070712_100898198 3300006175 Bacteria 764
46 Ga0097621_101278185 3300006237 Bacteria 693
47 Ga0097621_101646730 3300006237 Bacteria 611
48 Ga0075370_10716308 3300006353 Bacteria 609
49 Ga0068871_101332285 3300006358 Bacteria 676
50 Ga0075428_100276796 3300006844 Bacteria 1805
51 Ga0075430_100250774 3300006846 Bacteria 1467
52 Ga0075433_10005869 3300006852 Bacteria 9673
53 Ga0075433_10152071 3300006852 Bacteria 2058
54 Ga0075434_100000484 3300006871 Bacteria 29868
55 Ga0075434_100001032 3300006871 Bacteria 22671
56 Ga0075434_100125022 3300006871 Bacteria 2589
57 Ga0075429_100190988 3300006880 Bacteria 1794
58 Ga0075436_100004032 3300006914 Bacteria 10071
59 Ga0097620_101192387 3300006931 Bacteria 838
60 Ga0075435_100001154 3300007076 Bacteria 16862
61 Ga0099794_10139223 3300007265 Bacteria 1228
62 Ga0099795_10009723 3300007788 Bacteria 2802
63 Ga0105240_10181860 3300009093 Bacteria 2480
64 Ga0111539_10712372 3300009094 Bacteria 1168
65 Ga0105245_12382907 3300009098 Bacteria 583
66 Ga0105243_11176773 3300009148 Bacteria 779
67 Ga0105248_10785455 3300009177 Bacteria 1075
68 Ga0105248_12412396 3300009177 Bacteria 599
69 Ga0099796_10086274 3300010159 Bacteria 1160
70 Ga0157369_11908208 3300013105 Bacteria 603
71 Ga0157374_10005858 3300013296 Bacteria 10379
72 Ga0157374_10395022 3300013296 Bacteria 1379
73 Ga0157375_11393589 3300013308 Bacteria 826
74 Ga0157379_10443673 3300014968 Bacteria 1197
75 Ga0157376_10316104 3300014969 Bacteria 1483
76 Ga0213872_10000109 3300021361 Bacteria 76712
77 Ga0213872_10006100 3300021361 Bacteria 6099
78 Ga0207684_10194745 3300025910 Bacteria 1748
79 Ga0207707_10043258 3300025912 Bacteria 3929
80 Ga0207707_10053572 3300025912 Bacteria 3512
81 Ga0207707_10108661 3300025912 Bacteria 2425
82 Ga0207695_10093449 3300025913 Bacteria 3017
83 Ga0207693_10769826 3300025915 Bacteria 743
84 Ga0207663_10119667 3300025916 Bacteria 1801
85 Ga0207660_10488341 3300025917 Bacteria 998
86 Ga0207652_10254298 3300025921 Bacteria 1584
87 Ga0207646_10325209 3300025922 Bacteria 1389
88 Ga0207681_10002320 3300025923 Bacteria 12099
89 Ga0207650_10004346 3300025925 Bacteria 9680
90 Ga0207650_10179329 3300025925 Bacteria 1687
91 Ga0207664_10672938 3300025929 Bacteria 930
92 Ga0207706_10473344 3300025933 Bacteria 1082
93 Ga0207709_10336700 3300025935 Bacteria 1134
94 Ga0207665_10079659 3300025939 Bacteria 2252
95 Ga0207703_10648857 3300026035 Bacteria 1001
96 Ga0207639_10089413 3300026041 Bacteria 2461
97 Ga0207639_10559461 3300026041 Bacteria 1051
98 Ga0207702_10306426 3300026078 Bacteria 1509
99 Ga0207641_10041604 3300026088 Bacteria 3851
100 Ga0207676_10000548 3300026095 Bacteria 31359
101 Ga0207676_10168572 3300026095 Bacteria 1905
102 Ga0209969_1019998 3300027360 Bacteria 995
103 Ga0209967_1000346 3300027364 Bacteria 6174
104 Ga0210000_1001989 3300027462 Bacteria 2884
105 Ga0268265_10484930 3300028380 Bacteria 1162
106 Ga0268264_11582662 3300028381 Bacteria 666
107 Ga0265336_10002118 3300028666 Bacteria 8411
108 Ga0265331_10009391 3300031250 Bacteria 5491
109 Ga0307408_100506132 3300031548 Bacteria 1058
110 Ga0316575_10020201 3300031665 Bacteria 2554
111 Ga0316579_10003486 3300031691 Bacteria 6145
112 Ga0316579_10494271 3300031691 Bacteria 592
113 Ga0316577_10259082 3300031733 Bacteria 984
114 Ga0307410_10192198 3300031852 Bacteria 1553
115 Ga0307411_11559529 3300032005 Bacteria 608
116 Ga0316583_10012848 3300032133 Bacteria 3021
117 Ga0316593_10010765 3300032168 Bacteria 2637
118 Ga0373926_0078730 3300035083 Bacteria 1217
119 Ga0373934_0001684 3300035086 Bacteria 8120
120 Ga0373934_0014707 3300035086 Bacteria 2965
121 Ga0373945_0048419 3300035116 Bacteria 1557
122 Ga0373953_0022608 3300035117 Bacteria 2372
123 Ga0373953_0110618 3300035117 Bacteria 1161
124 Ga0373954_0003412 3300035118 Bacteria 6730
125 Ga0373954_0103247 3300035118 Bacteria 1376
126 Ga0373956_0000615 3300035119 Bacteria 14591
127 Ga0373956_0008519 3300035119 Bacteria 4150
128 Ga0373956_0025551 3300035119 Bacteria 2554
129 Ga0373957_0002663 3300035120 Bacteria 5125
130 Ga0373957_0190853 3300035120 Bacteria 851
131 Ga0373955_0067745 3300035172 Bacteria 1988
132 Ga0373924_0095889 3300035410 Bacteria 1272
133 Ga0373931_0008358 3300035691 Bacteria 4905
134 Ga0373931_0069132 3300035691 Bacteria 1924
135 Ga0373931_0290912 3300035691 Bacteria 1006
136 Ga0373935_0184373 3300035692 Bacteria 1434
137 Ga0373933_0001188 3300035724 Bacteria 15438
138 Ga0373933_0060834 3300035724 Bacteria 2277
139 Ga0373937_0002676 3300036401 Bacteria 14852
140 Ga0373937_0037625 3300036401 Bacteria 4409
141 Ga0373937_0073480 3300036401 Bacteria 3154
142 Ga0373937_0112778 3300036401 Bacteria 2529
143 Ga0373937_1834442 3300036401 Bacteria 553
144 Ga0316582_0010275 3300036647 Bacteria 5119
145 Ga0316582_0314880 3300036647 Bacteria 1076
146 Ga0316584_0023403 3300036712 Bacteria 4513
147 Ga0316584_0487863 3300036712 Bacteria 867
148 Ga0373925_0505322 3300037068 Bacteria 992
149 Ga0316581_0024088 3300037588 Bacteria 1803
150 Ga0436364_1267766 3300037853 Bacteria 1848
151 Ga0436361_0753989 3300039447 Bacteria 4018
152 Ga0436361_1063284 3300039447 Bacteria 25768
153 Ga0466961_0069553 3300044693 Bacteria 2235
154 Ga0453684_0100219 3300044712 Bacteria 3546
155 Ga0453684_0519279 3300044712 Bacteria 1316
156 Ga0453684_0773743 3300044712 Bacteria 1037
157 Ga0451576_1662948 3300045051 Bacteria 662
158 Ga0466967_0151158 3300045976 Bacteria 2170
159 Ga0495592_0005285 3300046454 Bacteria 9518
160 Ga0495592_0022096 3300046454 Bacteria 4839
161 Ga0495592_0075221 3300046454 Bacteria 2452
162 Ga0495603_0033568 3300046455 Bacteria 3088
163 Ga0495641_0112186 3300046461 Bacteria 1216
164 Ga0495651_0002995 3300046462 Bacteria 13035
165 Ga0495651_0026064 3300046462 Bacteria 4552
166 Ga0495653_0021439 3300046463 Bacteria 5234
167 Ga0495580_0072315 3300046472 Bacteria 2408
168 Ga0495582_0032967 3300046473 Bacteria 2846
169 Ga0495639_0001363 3300046475 Bacteria 10968
170 Ga0495662_0130946 3300046476 Bacteria 1233
171 Ga0495664_0037244 3300046477 Bacteria 2870
172 Ga0495618_0059440 3300046514 Bacteria 2422
173 Ga0495628_0004647 3300046516 Bacteria 12116
174 Ga0495628_0141174 3300046516 Bacteria 1838
175 Ga0495630_0011239 3300046517 Bacteria 6476
176 Ga0495666_0013619 3300046526 Bacteria 4055
177 Ga0495652_0025822 3300046529 Bacteria 5192
178 Ga0495665_0190787 3300046531 Bacteria 1063
179 Ga0495640_0040721 3300046533 Bacteria 3251
180 Ga0495586_0068827 3300046535 Bacteria 1931
181 Ga0495587_0135270 3300046536 Bacteria 1408
182 Ga0495645_0005439 3300046543 Bacteria 8741
183 Ga0495667_0025952 3300046559 Bacteria 3946
184 Ga0495667_0063521 3300046559 Bacteria 2416
185 Ga0495656_0009663 3300046615 Bacteria 3478
186 Ga0495634_0045625 3300046642 Bacteria 2961
187 Ga0495635_0013701 3300046663 Bacteria 5673
188 Ga0495599_0077919 3300046678 Bacteria 2069
189 Ga0495646_0183828 3300046680 Bacteria 1146
190 Ga0495647_0005955 3300046681 Bacteria 4016
191 Ga0495658_0804891 3300046683 Bacteria 601
192 Ga0495613_0035189 3300046689 Bacteria 3717
193 Ga0495624_0525623 3300046690 Bacteria 707
194 Ga0495600_0003020 3300046809 Bacteria 9822
195 Ga0495604_0120349 3300047317 Bacteria 1901
196 Ga0495636_0012830 3300047318 Bacteria 3320
197 Ga0495674_0085356 3300047319 Bacteria 2704
198 Ga0495680_0021668 3300047322 Bacteria 5374
199 Ga0495680_0360091 3300047322 Bacteria 1011
200 Ga0495675_0190628 3300047444 Bacteria 1251
201 Ga0495684_0035788 3300047471 Bacteria 3806
202 Ga0501032_0040636 3300049569 Bacteria 3161
203 Ga0501033_0326222 3300049570 Bacteria 1078
204 Ga0501039_0250032 3300049575 Bacteria 1394
205 Ga0501039_0599884 3300049575 Bacteria 863
206 Ga0501041_0235125 3300049577 Bacteria 1151
207 Ga0501042_0331877 3300049578 Bacteria 1099
208 Ga0501043_0263475 3300049579 Bacteria 1325
209 Ga0501046_0082974 3300049580 Bacteria 2475
210 Ga0501069_0150731 3300049585 Bacteria 1336
211 Ga0501070_0371540 3300049586 Bacteria 1159
212 Ga0501072_0081165 3300049588 Bacteria 2570
213 Ga0501074_0060188 3300049590 Bacteria 2736
214 Ga0501075_0918627 3300049591 Bacteria 665
215 Ga0501076_0748656 3300049592 Bacteria 806
216 Ga0501077_0094914 3300049593 Bacteria 1891
217 Ga0501077_0163067 3300049593 Bacteria 1415
218 Ga0501216_030614 3300049660 Bacteria 992
219 Ga0501079_0231065 3300049741 Bacteria 1445
220 Ga0501080_0008652 3300049742 Bacteria 9241
221 Ga0501080_0305589 3300049742 Bacteria 1442
222 Ga0501080_1267852 3300049742 Bacteria 632
223 Ga0501083_0386549 3300049744 Bacteria 910
224 nmdc:mga09592_7141_c1 3300050508 Bacteria 9078
225 nmdc:mga06r32_30630_c1 3300050510 Bacteria 5049
226 nmdc:mga0n895_1008057_c1 3300050512 Bacteria 813
227 nmdc:mga0n895_1501548_c1 3300050512 Bacteria 640
228 nmdc:mga0n895_367_c1 3300050512 Bacteria 30485
229 nmdc:mga0n895_9031_c1 3300050512 Bacteria 8694
230 nmdc:mga0rr50_2846_c1 3300050513 Bacteria 9838
231 nmdc:mga08x19_187742_c1 3300050514 Bacteria 1413
232 nmdc:mga08x19_2760_c1 3300050514 Bacteria 10597
233 nmdc:mga0a205_5446_c3 3300050515 Bacteria 4904
234 Ga0495601_0050646 3300053077 Bacteria 2619
235 Ga0495601_0474964 3300053077 Bacteria 808
236 Ga0495595_0005218 3300053084 Bacteria 5247
237 Ga0495619_0010461 3300053085 Bacteria 5834
238 Ga0495619_0137321 3300053085 Bacteria 1682
239 Ga0500634_0239425 3300053161 Bacteria 763
240 Ga0501084_0206426 3300054114 Bacteria 1658
241 Ga0590071_056860 3300059421 Bacteria 952
242 Ga0501071_0119317
243 JGI24738J21930_10006379
244 Ga0070658_10295499
245 Ga0070670_100010038
246 Ga0070670_100013475
247 Ga0070670_100498332
248 Ga0070680_100111888
249 Ga0070680_100454635
250 Ga0070680_101184771
251 Ga0070660_100092475
252 Ga0070689_100766518
253 Ga0070675_100205172
254 Ga0070674_100127966
255 Ga0070709_10607205
256 Ga0070714_100863643
257 Ga0070705_100057574
258 Ga0070694_100060390
259 Ga0070694_100272464
260 Ga0070694_101331882
261 Ga0070681_10179520
262 Ga0070681_11005220
263 Ga0070706_100024838
264 Ga0070698_100003836
265 Ga0070679_100143373
266 Ga0070679_100584230
267 Ga0070697_100002415
268 Ga0068853_100074249
269 Ga0070695_100242074
270 Ga0070695_100644891
271 Ga0070696_100919676
272 Ga0070693_100460224
273 Ga0070693_100572475
274 Ga0070704_100017269
275 Ga0070704_100054427
276 Ga0070704_100149593
277 Ga0068856_100240997
278 Ga0068859_101192372
279 Ga0068864_100000871
280 Ga0068864_100054311
281 Ga0068870_10205110
282 Ga0068858_100939053
283 Ga0068860_100792902
284 Ga0068862_100821304
285 Ga0070715_10382216
286 Ga0070712_100898198
287 Ga0097621_101278185
288 Ga0097621_101646730
289 Ga0075370_10716308
290 Ga0068871_101332285
291 Ga0075428_100276796
292 Ga0075430_100250774
293 Ga0075433_10005869
294 Ga0075433_10152071
295 Ga0075434_100000484
296 Ga0075434_100001032
297 Ga0075434_100125022
298 Ga0075429_100190988
299 Ga0075436_100004032
300 Ga0097620_101192387
301 Ga0075435_100001154
302 Ga0099794_10139223
303 Ga0099795_10009723
304 Ga0105240_10181860
305 Ga0111539_10712372
306 Ga0105245_12382907
307 Ga0105243_11176773
308 Ga0105248_10785455
309 Ga0105248_12412396
310 Ga0099796_10086274
311 Ga0157369_11908208
312 Ga0157374_10005858
313 Ga0157374_10395022
314 Ga0157375_11393589
315 Ga0157379_10443673
316 Ga0157376_10316104
317 Ga0213872_10000109
318 Ga0213872_10006100
319 Ga0207684_10194745
320 Ga0207707_10043258
321 Ga0207707_10053572
322 Ga0207707_10108661
323 Ga0207695_10093449
324 Ga0207693_10769826
325 Ga0207663_10119667
326 Ga0207660_10488341
327 Ga0207652_10254298
328 Ga0207646_10325209
329 Ga0207681_10002320
330 Ga0207650_10004346
331 Ga0207650_10179329
332 Ga0207664_10672938
333 Ga0207706_10473344
334 Ga0207709_10336700
335 Ga0207665_10079659
336 Ga0207703_10648857
337 Ga0207639_10089413
338 Ga0207639_10559461
339 Ga0207702_10306426
340 Ga0207641_10041604
341 Ga0207676_10000548
342 Ga0207676_10168572
343 Ga0209969_1019998
344 Ga0209967_1000346
345 Ga0210000_1001989
346 Ga0268265_10484930
347 Ga0268264_11582662
348 Ga0265336_10002118
349 Ga0265331_10009391
350 Ga0307408_100506132
351 Ga0316575_10020201
352 Ga0316579_10003486
353 Ga0316579_10494271
354 Ga0316577_10259082
355 Ga0307410_10192198
356 Ga0307411_11559529
357 Ga0316583_10012848
358 Ga0316593_10010765
359 Ga0373926_0078730
360 Ga0373934_0001684
361 Ga0373934_0014707
362 Ga0373945_0048419
363 Ga0373953_0022608
364 Ga0373953_0110618
365 Ga0373954_0003412
366 Ga0373954_0103247
367 Ga0373956_0000615
368 Ga0373956_0008519
369 Ga0373956_0025551
370 Ga0373957_0002663
371 Ga0373957_0190853
372 Ga0373955_0067745
373 Ga0373924_0095889
374 Ga0373931_0008358
375 Ga0373931_0069132
376 Ga0373931_0290912
377 Ga0373935_0184373
378 Ga0373933_0001188
379 Ga0373933_0060834
380 Ga0373937_0002676
381 Ga0373937_0037625
382 Ga0373937_0073480
383 Ga0373937_0112778
384 Ga0373937_1834442
385 Ga0316582_0010275
386 Ga0316582_0314880
387 Ga0316584_0023403
388 Ga0316584_0487863
389 Ga0373925_0505322
390 Ga0316581_0024088
391 Ga0436364_1267766
392 Ga0436361_0753989
393 Ga0436361_1063284
394 Ga0466961_0069553
395 Ga0453684_0100219
396 Ga0453684_0519279
397 Ga0453684_0773743
398 Ga0451576_1662948
399 Ga0466967_0151158
400 Ga0495592_0005285
401 Ga0495592_0022096
402 Ga0495592_0075221
403 Ga0495603_0033568
404 Ga0495641_0112186
405 Ga0495651_0002995
406 Ga0495651_0026064
407 Ga0495653_0021439
408 Ga0495580_0072315
409 Ga0495582_0032967
410 Ga0495639_0001363
411 Ga0495662_0130946
412 Ga0495664_0037244
413 Ga0495618_0059440
414 Ga0495628_0004647
415 Ga0495628_0141174
416 Ga0495630_0011239
417 Ga0495666_0013619
418 Ga0495652_0025822
419 Ga0495665_0190787
420 Ga0495640_0040721
421 Ga0495586_0068827
422 Ga0495587_0135270
423 Ga0495645_0005439
424 Ga0495667_0025952
425 Ga0495667_0063521
426 Ga0495656_0009663
427 Ga0495634_0045625
428 Ga0495635_0013701
429 Ga0495599_0077919
430 Ga0495646_0183828
431 Ga0495647_0005955
432 Ga0495658_0804891
433 Ga0495613_0035189
434 Ga0495624_0525623
435 Ga0495600_0003020
436 Ga0495604_0120349
437 Ga0495636_0012830
438 Ga0495674_0085356
439 Ga0495680_0021668
440 Ga0495680_0360091
441 Ga0495675_0190628
442 Ga0495684_0035788
443 Ga0501032_0040636
444 Ga0501033_0326222
445 Ga0501039_0250032
446 Ga0501039_0599884
447 Ga0501041_0235125
448 Ga0501042_0331877
449 Ga0501043_0263475
450 Ga0501046_0082974
451 Ga0501069_0150731
452 Ga0501070_0371540
453 Ga0501072_0081165
454 Ga0501074_0060188
455 Ga0501075_0918627
456 Ga0501076_0748656
457 Ga0501077_0094914
458 Ga0501077_0163067
459 Ga0501216_030614
460 Ga0501079_0231065
461 Ga0501080_0008652
462 Ga0501080_0305589
463 Ga0501080_1267852
464 Ga0501083_0386549
465 nmdc:mga09592_7141_c1
466 nmdc:mga06r32_30630_c1
467 nmdc:mga0n895_1008057_c1
468 nmdc:mga0n895_1501548_c1
469 nmdc:mga0n895_367_c1
470 nmdc:mga0n895_9031_c1
471 nmdc:mga0rr50_2846_c1
472 nmdc:mga08x19_187742_c1
473 nmdc:mga08x19_2760_c1
474 nmdc:mga0a205_5446_c3
475 Ga0495601_0050646
476 Ga0495601_0474964
477 Ga0495595_0005218
478 Ga0495619_0010461
479 Ga0495619_0137321
480 Ga0500634_0239425
481 Ga0501084_0206426
482 Ga0590071_056860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

70

90

0.94

Map