F352265

General Info

Members Datasets Scaffolds Average Seq Length
239 166 478 185

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0449033|Ga0496107_0449033_56_676
Length 206
Sequence MNASTVEGKGKLHRSRREVNMVPLTALLLPIFLSSVLVFIASSVIHMALPFHKNDYLRVPNEEGMRTALQPLAIPPGDYLVPCPGGPQEMRSPEFQAKVNQGPNIVMTVLPNGPWTMGRNLVLWFIYLLVISLFAGYVTGRALPSGSPYLQVFRFVGTTAFLGYAGALWQMSIWYRRSWATTTKSTIDGLVYAMLTAGVFGWLWPH

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.09
Rhizosphere 97.07
Stem 0
Stem Tuber 0
Unclassified 22.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0449033 3300048910 Unclassified 958
2 Ga0065707_10357056 3300005295 Unclassified 910
3 Ga0070683_100005787 3300005329 Bacteria 10337
4 Ga0070683_100014775 3300005329 Bacteria 6840
5 Ga0068869_100663790 3300005334 Bacteria 886
6 Ga0070680_100074521 3300005336 Unclassified 2793
7 Ga0070674_100013523 3300005356 Bacteria 5049
8 Ga0070674_100243405 3300005356 Bacteria 1409
9 Ga0070673_100268957 3300005364 Bacteria 1491
10 Ga0070709_10353352 3300005434 Unclassified 1087
11 Ga0070714_100003812 3300005435 Bacteria 11327
12 Ga0070714_100039856 3300005435 Bacteria 3957
13 Ga0070714_100308244 3300005435 Bacteria 1477
14 Ga0070714_100360274 3300005435 Bacteria 1367
15 Ga0070713_100010497 3300005436 Bacteria 6691
16 Ga0070713_100036416 3300005436 Bacteria 3970
17 Ga0070713_100894663 3300005436 Bacteria 854
18 Ga0070694_100264576 3300005444 Bacteria 1305
19 Ga0070708_100163120 3300005445 Bacteria 2077
20 Ga0070708_100211740 3300005445 Bacteria 1816
21 Ga0070708_100325703 3300005445 Bacteria 1447
22 Ga0070678_100019007 3300005456 Bacteria 4466
23 Ga0070681_10053726 3300005458 Bacteria 4014
24 Ga0068867_100009008 3300005459 Bacteria 7042
25 Ga0068867_100016119 3300005459 Bacteria 5307
26 Ga0068867_100182955 3300005459 Unclassified 1667
27 Ga0070706_100006506 3300005467 Bacteria 11029
28 Ga0070706_100189682 3300005467 Bacteria 1921
29 Ga0070706_100940538 3300005467 Bacteria 798
30 Ga0070707_100415962 3300005468 Bacteria 1305
31 Ga0070707_100745331 3300005468 Bacteria 943
32 Ga0070707_100814940 3300005468 Bacteria 897
33 Ga0070698_100000360 3300005471 Bacteria 47129
34 Ga0070698_100075965 3300005471 Bacteria 3363
35 Ga0070698_100133385 3300005471 Bacteria 2438
36 Ga0070698_100306638 3300005471 Bacteria 1518
37 Ga0070699_100000079 3300005518 Bacteria 92794
38 Ga0070699_100059569 3300005518 Bacteria 3307
39 Ga0070699_100257513 3300005518 Bacteria 1560
40 Ga0070699_100447456 3300005518 Bacteria 1171
41 Ga0070699_100512352 3300005518 Unclassified 1090
42 Ga0070699_100592770 3300005518 Bacteria 1010
43 Ga0070684_100003038 3300005535 Bacteria 12517
44 Ga0070684_100004392 3300005535 Bacteria 10724
45 Ga0070697_100126169 3300005536 Bacteria 2144
46 Ga0070697_100533095 3300005536 Bacteria 1029
47 Ga0068853_100525963 3300005539 Bacteria 1118
48 Ga0070686_100316705 3300005544 Bacteria 1162
49 Ga0070695_100131213 3300005545 Unclassified 1727
50 Ga0070696_100007466 3300005546 Bacteria 7313
51 Ga0070693_100783499 3300005547 Unclassified 705
52 Ga0070704_100375035 3300005549 Bacteria 1207
53 Ga0068855_100101031 3300005563 Bacteria 3320
54 Ga0068856_100006245 3300005614 Bacteria 11694
55 Ga0068852_100270842 3300005616 Bacteria 1634
56 Ga0068859_100100231 3300005617 Bacteria 2952
57 Ga0068859_100219004 3300005617 Bacteria 1991
58 Ga0068866_10292458 3300005718 Unclassified 1014
59 Ga0068861_100365976 3300005719 Bacteria 1269
60 Ga0068851_10749840 3300005834 Unclassified 604
61 Ga0068870_10422550 3300005840 Bacteria 872
62 Ga0068863_100147000 3300005841 Bacteria 2255
63 Ga0068863_100783225 3300005841 Bacteria 950
64 Ga0068860_100092349 3300005843 Bacteria 2884
65 Ga0070717_10093148 3300006028 Bacteria 2546
66 Ga0070717_10436509 3300006028 Unclassified 1179
67 Ga0070716_100193062 3300006173 Bacteria 1347
68 Ga0075428_100003553 3300006844 Bacteria 17077
69 Ga0075429_100009881 3300006880 Bacteria 8273
70 Ga0075429_100306465 3300006880 Bacteria 1390
71 Ga0097620_100100231 3300006931 Bacteria 2952
72 Ga0097620_100218998 3300006931 Bacteria 1991
73 Ga0105240_10028998 3300009093 Bacteria 7218
74 Ga0105240_10159155 3300009093 Bacteria 2684
75 Ga0111539_10233304 3300009094 Bacteria 2142
76 Ga0111539_10321627 3300009094 Unclassified 1800
77 Ga0105245_10347999 3300009098 Unclassified 1467
78 Ga0114129_10006505 3300009147 Bacteria 16577
79 Ga0105242_10008095 3300009176 Bacteria 8088
80 Ga0105242_10016572 3300009176 Bacteria 5730
81 Ga0105242_10671663 3300009176 Bacteria 1010
82 Ga0105248_10012257 3300009177 Bacteria 9455
83 Ga0105248_10345145 3300009177 Unclassified 1676
84 Ga0105237_10125227 3300009545 Unclassified 2564
85 Ga0105237_10382349 3300009545 Bacteria 1413
86 Ga0105238_10005475 3300009551 Bacteria 12556
87 Ga0105238_10194994 3300009551 Unclassified 2001
88 Ga0105238_10790950 3300009551 Bacteria 964
89 Ga0105238_11629220 3300009551 Bacteria 676
90 Ga0105249_10997840 3300009553 Bacteria 906
91 Ga0157370_10042393 3300013104 Bacteria 4387
92 Ga0157369_10017896 3300013105 Bacteria 7954
93 Ga0157374_10232244 3300013296 Unclassified 1812
94 Ga0157374_11096864 3300013296 Bacteria 816
95 Ga0163162_10011723 3300013306 Bacteria 8548
96 Ga0157372_10000416 3300013307 Bacteria 46749
97 Ga0157372_10037754 3300013307 Bacteria 5328
98 Ga0157372_10289990 3300013307 Bacteria 1903
99 Ga0157372_10623286 3300013307 Unclassified 1257
100 Ga0157372_12108301 3300013307 Bacteria 648
101 Ga0157375_10106510 3300013308 Bacteria 2895
102 Ga0163163_10095398 3300014325 Bacteria 2994
103 Ga0157379_10036075 3300014968 Bacteria 4409
104 Ga0206352_11027291 3300020078 Bacteria 1707
105 Ga0207692_10543547 3300025898 Bacteria 741
106 Ga0207699_10143653 3300025906 Unclassified 1571
107 Ga0207684_10010463 3300025910 Bacteria 8166
108 Ga0207684_10082434 3300025910 Bacteria 2739
109 Ga0207707_10036680 3300025912 Bacteria 4285
110 Ga0207695_10002089 3300025913 Bacteria 30401
111 Ga0207695_10085717 3300025913 Bacteria 3178
112 Ga0207671_10038647 3300025914 Unclassified 3537
113 Ga0207671_10306426 3300025914 Bacteria 1255
114 Ga0207646_10023496 3300025922 Bacteria 5662
115 Ga0207646_10032895 3300025922 Bacteria 4690
116 Ga0207646_10597608 3300025922 Bacteria 991
117 Ga0207694_10021365 3300025924 Bacteria 4905
118 Ga0207694_10144747 3300025924 Unclassified 1913
119 Ga0207659_10000031 3300025926 Bacteria 121432
120 Ga0207700_10064589 3300025928 Bacteria 2789
121 Ga0207686_10864356 3300025934 Unclassified 728
122 Ga0207665_10111487 3300025939 Bacteria 1923
123 Ga0207665_10211001 3300025939 Unclassified 1418
124 Ga0207711_10336242 3300025941 Bacteria 1397
125 Ga0207661_10019568 3300025944 Bacteria 5050
126 Ga0207661_10054427 3300025944 Bacteria 3205
127 Ga0207667_10054378 3300025949 Bacteria 4211
128 Ga0207651_10249762 3300025960 Unclassified 1451
129 Ga0207639_10468626 3300026041 Bacteria 1146
130 Ga0207702_10001161 3300026078 Bacteria 26841
131 Ga0207702_10359083 3300026078 Unclassified 1396
132 Ga0207641_10022421 3300026088 Bacteria 5199
133 Ga0207641_10031530 3300026088 Bacteria 4397
134 Ga0207641_10135304 3300026088 Bacteria 2218
135 Ga0207648_10029514 3300026089 Bacteria 4863
136 Ga0207648_10211589 3300026089 Unclassified 1721
137 Ga0207675_100309704 3300026118 Bacteria 1540
138 Ga0207683_10008722 3300026121 Bacteria 8660
139 Ga0207683_10111239 3300026121 Bacteria 2452
140 Ga0207683_10590209 3300026121 Bacteria 1028
141 Ga0207428_10366267 3300027907 Unclassified 1059
142 Ga0268264_10135538 3300028381 Bacteria 2189
143 Ga0268264_10938338 3300028381 Unclassified 870
144 Ga0265326_10000606 3300028558 Bacteria 13443
145 Ga0265319_1000112 3300028563 Bacteria 62336
146 Ga0265319_1058197 3300028563 Bacteria 1259
147 Ga0265334_10042888 3300028573 Bacteria 1762
148 Ga0265323_10000107 3300028653 Bacteria 48675
149 Ga0265322_10000164 3300028654 Bacteria 30408
150 Ga0265322_10062993 3300028654 Bacteria 1052
151 Ga0265338_10005505 3300028800 Bacteria 16503
152 Ga0265324_10002337 3300029957 Bacteria 9815
153 Ga0265762_1030740 3300030760 Bacteria 1019
154 Ga0265330_10000478 3300031235 Bacteria 26883
155 Ga0265332_10000871 3300031238 Bacteria 18288
156 Ga0265328_10003768 3300031239 Bacteria 6668
157 Ga0265320_10000487 3300031240 Bacteria 31093
158 Ga0265325_10300799 3300031241 Bacteria 716
159 Ga0265329_10001700 3300031242 Bacteria 10530
160 Ga0265329_10235093 3300031242 Bacteria 609
161 Ga0265340_10013358 3300031247 Unclassified 4314
162 Ga0265339_10000527 3300031249 Bacteria 29911
163 Ga0265331_10017565 3300031250 Bacteria 3726
164 Ga0265327_10124161 3300031251 Bacteria 1220
165 Ga0265316_10000869 3300031344 Bacteria 33204
166 Ga0265316_10246268 3300031344 Bacteria 1313
167 Ga0307408_100005452 3300031548 Bacteria 8515
168 Ga0265313_10000959 3300031595 Bacteria 28638
169 Ga0265314_10000357 3300031711 Bacteria 63729
170 Ga0265342_10000570 3300031712 Bacteria 38944
171 Ga0265342_10005959 3300031712 Bacteria 9172
172 Ga0307405_10046088 3300031731 Bacteria 2676
173 Ga0316577_10129904 3300031733 Bacteria 1418
174 Ga0307410_10263505 3300031852 Bacteria 1345
175 Ga0307406_10017988 3300031901 Bacteria 4123
176 Ga0307406_10957234 3300031901 Bacteria 732
177 Ga0307416_100436825 3300032002 Unclassified 1358
178 Ga0307414_10089094 3300032004 Bacteria 2286
179 Ga0307411_10391817 3300032005 Bacteria 1146
180 Ga0373939_0017359 3300035114 Bacteria 1911
181 Ga0373943_0081313 3300035170 Bacteria 1662
182 Ga0373933_1037001 3300035724 Unclassified 540
183 Ga0373937_0104913 3300036401 Bacteria 2626
184 Ga0373937_1438199 3300036401 Bacteria 637
185 Ga0395905_0750663 3300037471 Bacteria 878
186 Ga0436365_1069222 3300039437 Unclassified 2156
187 Ga0436361_0626546 3300039447 Bacteria 1072
188 Ga0451853_1441500 3300041512 Unclassified 540
189 Ga0439433_0067213 3300041999 Unclassified 860
190 Ga0451577_0558899 3300042876 Bacteria 1039
191 Ga0453684_1101443 3300044712 Unclassified 839
192 Ga0495651_0035776 3300046462 Bacteria 3866
193 Ga0495580_0018072 3300046472 Bacteria 5255
194 Ga0495580_0289236 3300046472 Unclassified 1117
195 Ga0495584_0058977 3300046491 Bacteria 1931
196 Ga0495630_0371022 3300046517 Unclassified 1096
197 Ga0495644_0342521 3300046523 Bacteria 588
198 Ga0495663_0021115 3300046525 Unclassified 1874
199 Ga0495642_0121682 3300046528 Unclassified 1120
200 Ga0495598_0158960 3300046537 Unclassified 794
201 Ga0495621_0126389 3300046539 Bacteria 992
202 Ga0495659_0015024 3300046664 Bacteria 2542
203 Ga0495657_0792834 3300046675 Unclassified 542
204 Ga0495647_0008546 3300046681 Bacteria 3445
205 Ga0495658_0208397 3300046683 Bacteria 1221
206 Ga0496106_0977693 3300048909 Unclassified 666
207 Ga0496109_1201098 3300048912 Bacteria 695
208 Ga0496112_0340911 3300048915 Bacteria 1442
209 Ga0496115_0009521 3300048918 Bacteria 7216
210 Ga0501034_0307089 3300049571 Bacteria 1522
211 Ga0501039_0933298 3300049575 Unclassified 675
212 Ga0501040_0044209 3300049576 Bacteria 3037
213 Ga0501041_0070778 3300049577 Unclassified 2141
214 Ga0501042_0785681 3300049578 Bacteria 693
215 Ga0501042_0785994 3300049578 Unclassified 693
216 Ga0501046_0099060 3300049580 Unclassified 2238
217 Ga0501048_0139520 3300049582 Bacteria 1714
218 Ga0501069_0227365 3300049585 Bacteria 1086
219 Ga0501071_0037787 3300049587 Unclassified 3449
220 Ga0501071_0373843 3300049587 Unclassified 1086
221 Ga0501073_0552437 3300049589 Bacteria 796
222 Ga0501076_0162421 3300049592 Bacteria 1820
223 Ga0501077_0269545 3300049593 Bacteria 1083
224 Ga0501080_0694144 3300049742 Unclassified 898
225 Ga0501081_0117223 3300049743 Bacteria 1894
226 Ga0501044_0897538 3300049823 Unclassified 761
227 nmdc:mga05p37_45925_c1 3300050507 Bacteria 5371
228 nmdc:mga05p37_51947_c1 3300050507 Bacteria 5040
229 nmdc:mga05p37_737898_c1 3300050507 Bacteria 1088
230 nmdc:mga09592_13632_c1 3300050508 Bacteria 6642
231 nmdc:mga09592_9559_c1 3300050508 Bacteria 7879
232 nmdc:mga08y16_295812_c1 3300050511 Unclassified 1669
233 nmdc:mga08y16_801486_c1 3300050511 Bacteria 935
234 Ga0501084_0097989 3300054114 Bacteria 2462
235 Ga0590071_000017 3300059421 Bacteria 43985
236 Ga0590074_003830 3300059423 Unclassified 2492
237 Ga0590075_001055 3300059424 Bacteria 7120
238 Ga0590077_000494 3300059426 Bacteria 11023
239 Ga0530510_0643870 3300061734 Unclassified 807
240 Ga0496107_0449033
241 Ga0065707_10357056
242 Ga0070683_100005787
243 Ga0070683_100014775
244 Ga0068869_100663790
245 Ga0070680_100074521
246 Ga0070674_100013523
247 Ga0070674_100243405
248 Ga0070673_100268957
249 Ga0070709_10353352
250 Ga0070714_100003812
251 Ga0070714_100039856
252 Ga0070714_100308244
253 Ga0070714_100360274
254 Ga0070713_100010497
255 Ga0070713_100036416
256 Ga0070713_100894663
257 Ga0070694_100264576
258 Ga0070708_100163120
259 Ga0070708_100211740
260 Ga0070708_100325703
261 Ga0070678_100019007
262 Ga0070681_10053726
263 Ga0068867_100009008
264 Ga0068867_100016119
265 Ga0068867_100182955
266 Ga0070706_100006506
267 Ga0070706_100189682
268 Ga0070706_100940538
269 Ga0070707_100415962
270 Ga0070707_100745331
271 Ga0070707_100814940
272 Ga0070698_100000360
273 Ga0070698_100075965
274 Ga0070698_100133385
275 Ga0070698_100306638
276 Ga0070699_100000079
277 Ga0070699_100059569
278 Ga0070699_100257513
279 Ga0070699_100447456
280 Ga0070699_100512352
281 Ga0070699_100592770
282 Ga0070684_100003038
283 Ga0070684_100004392
284 Ga0070697_100126169
285 Ga0070697_100533095
286 Ga0068853_100525963
287 Ga0070686_100316705
288 Ga0070695_100131213
289 Ga0070696_100007466
290 Ga0070693_100783499
291 Ga0070704_100375035
292 Ga0068855_100101031
293 Ga0068856_100006245
294 Ga0068852_100270842
295 Ga0068859_100100231
296 Ga0068859_100219004
297 Ga0068866_10292458
298 Ga0068861_100365976
299 Ga0068851_10749840
300 Ga0068870_10422550
301 Ga0068863_100147000
302 Ga0068863_100783225
303 Ga0068860_100092349
304 Ga0070717_10093148
305 Ga0070717_10436509
306 Ga0070716_100193062
307 Ga0075428_100003553
308 Ga0075429_100009881
309 Ga0075429_100306465
310 Ga0097620_100100231
311 Ga0097620_100218998
312 Ga0105240_10028998
313 Ga0105240_10159155
314 Ga0111539_10233304
315 Ga0111539_10321627
316 Ga0105245_10347999
317 Ga0114129_10006505
318 Ga0105242_10008095
319 Ga0105242_10016572
320 Ga0105242_10671663
321 Ga0105248_10012257
322 Ga0105248_10345145
323 Ga0105237_10125227
324 Ga0105237_10382349
325 Ga0105238_10005475
326 Ga0105238_10194994
327 Ga0105238_10790950
328 Ga0105238_11629220
329 Ga0105249_10997840
330 Ga0157370_10042393
331 Ga0157369_10017896
332 Ga0157374_10232244
333 Ga0157374_11096864
334 Ga0163162_10011723
335 Ga0157372_10000416
336 Ga0157372_10037754
337 Ga0157372_10289990
338 Ga0157372_10623286
339 Ga0157372_12108301
340 Ga0157375_10106510
341 Ga0163163_10095398
342 Ga0157379_10036075
343 Ga0206352_11027291
344 Ga0207692_10543547
345 Ga0207699_10143653
346 Ga0207684_10010463
347 Ga0207684_10082434
348 Ga0207707_10036680
349 Ga0207695_10002089
350 Ga0207695_10085717
351 Ga0207671_10038647
352 Ga0207671_10306426
353 Ga0207646_10023496
354 Ga0207646_10032895
355 Ga0207646_10597608
356 Ga0207694_10021365
357 Ga0207694_10144747
358 Ga0207659_10000031
359 Ga0207700_10064589
360 Ga0207686_10864356
361 Ga0207665_10111487
362 Ga0207665_10211001
363 Ga0207711_10336242
364 Ga0207661_10019568
365 Ga0207661_10054427
366 Ga0207667_10054378
367 Ga0207651_10249762
368 Ga0207639_10468626
369 Ga0207702_10001161
370 Ga0207702_10359083
371 Ga0207641_10022421
372 Ga0207641_10031530
373 Ga0207641_10135304
374 Ga0207648_10029514
375 Ga0207648_10211589
376 Ga0207675_100309704
377 Ga0207683_10008722
378 Ga0207683_10111239
379 Ga0207683_10590209
380 Ga0207428_10366267
381 Ga0268264_10135538
382 Ga0268264_10938338
383 Ga0265326_10000606
384 Ga0265319_1000112
385 Ga0265319_1058197
386 Ga0265334_10042888
387 Ga0265323_10000107
388 Ga0265322_10000164
389 Ga0265322_10062993
390 Ga0265338_10005505
391 Ga0265324_10002337
392 Ga0265762_1030740
393 Ga0265330_10000478
394 Ga0265332_10000871
395 Ga0265328_10003768
396 Ga0265320_10000487
397 Ga0265325_10300799
398 Ga0265329_10001700
399 Ga0265329_10235093
400 Ga0265340_10013358
401 Ga0265339_10000527
402 Ga0265331_10017565
403 Ga0265327_10124161
404 Ga0265316_10000869
405 Ga0265316_10246268
406 Ga0307408_100005452
407 Ga0265313_10000959
408 Ga0265314_10000357
409 Ga0265342_10000570
410 Ga0265342_10005959
411 Ga0307405_10046088
412 Ga0316577_10129904
413 Ga0307410_10263505
414 Ga0307406_10017988
415 Ga0307406_10957234
416 Ga0307416_100436825
417 Ga0307414_10089094
418 Ga0307411_10391817
419 Ga0373939_0017359
420 Ga0373943_0081313
421 Ga0373933_1037001
422 Ga0373937_0104913
423 Ga0373937_1438199
424 Ga0395905_0750663
425 Ga0436365_1069222
426 Ga0436361_0626546
427 Ga0451853_1441500
428 Ga0439433_0067213
429 Ga0451577_0558899
430 Ga0453684_1101443
431 Ga0495651_0035776
432 Ga0495580_0018072
433 Ga0495580_0289236
434 Ga0495584_0058977
435 Ga0495630_0371022
436 Ga0495644_0342521
437 Ga0495663_0021115
438 Ga0495642_0121682
439 Ga0495598_0158960
440 Ga0495621_0126389
441 Ga0495659_0015024
442 Ga0495657_0792834
443 Ga0495647_0008546
444 Ga0495658_0208397
445 Ga0496106_0977693
446 Ga0496109_1201098
447 Ga0496112_0340911
448 Ga0496115_0009521
449 Ga0501034_0307089
450 Ga0501039_0933298
451 Ga0501040_0044209
452 Ga0501041_0070778
453 Ga0501042_0785681
454 Ga0501042_0785994
455 Ga0501046_0099060
456 Ga0501048_0139520
457 Ga0501069_0227365
458 Ga0501071_0037787
459 Ga0501071_0373843
460 Ga0501073_0552437
461 Ga0501076_0162421
462 Ga0501077_0269545
463 Ga0501080_0694144
464 Ga0501081_0117223
465 Ga0501044_0897538
466 nmdc:mga05p37_45925_c1
467 nmdc:mga05p37_51947_c1
468 nmdc:mga05p37_737898_c1
469 nmdc:mga09592_13632_c1
470 nmdc:mga09592_9559_c1
471 nmdc:mga08y16_295812_c1
472 nmdc:mga08y16_801486_c1
473 Ga0501084_0097989
474 Ga0590071_000017
475 Ga0590074_003830
476 Ga0590075_001055
477 Ga0590077_000494
478 Ga0530510_0643870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z5s-assembly1.cif.gz_W rc-lh1(14)-w complex from rhodopseudomonas palustris 0.6129 102 182
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.593 103 182
6z5s-assembly1.cif.gz_W rc-lh1(14)-w complex from rhodopseudomonas palustris 0.5444 102 182
6e6t-assembly1.cif.gz_A dieckmann cyclase, ncmc, bound to cerulenin 0.5 102 179
3fmr-assembly1.cif.gz_A crystal structure of an encephalitozoon cuniculi methionine aminopeptidase type 2 with angiogenesis inhibitor tnp470 bound 0.4927 85 140
ID Description Score Start End Superfamily
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6111 11 182 1.20.120.550
4hzuS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.593 103 182 1.10.1760.20
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5763 106 182 1.10.1760.20
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5436 11 182 1.20.120.550
af_Q7TP85_20_212_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.521 83 143 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A3M1ADN1-F1-model_v4 DUF1761 domain-containing protein 0.9915 1 185 GO:0016020
AF-A0A7Y2G1J1-F1-model_v4 DUF1761 domain-containing protein 0.9914 1 185 GO:0016020
AF-A0A536ZDH9-F1-model_v4 Uncharacterized protein 0.9897 39 185 GO:0016020
AF-A0A534H8G4-F1-model_v4 DUF1761 domain-containing protein 0.9885 1 185 GO:0016020
AF-A0A2V6AUG6-F1-model_v4 DUF1761 domain-containing protein 0.9877 102 185 GO:0016020

Map