F351850

General Info

Members Datasets Scaffolds Average Seq Length
239 174 478 67

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100336958|Ga0075436_1003369583
Length 70
Sequence MKAKEIRELTDAEAQAKLRDLRQELFNLRLQQQTARLERPSRIREVRRDMARIETVLTERQHQAAPAAAK

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
171 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
172 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
173 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
174 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 4.6
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 1.26
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 1.26
Rhizosphere 95.82
Stem 0
Stem Tuber 0
Unclassified 15.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100336958 3300006914 Bacteria 1085
2 Ga0058861_11777567 3300004800 Bacteria 999
3 Ga0058862_10020528 3300004803 Bacteria 3351
4 Ga0070658_10263995 3300005327 Bacteria 1463
5 Ga0070658_10496657 3300005327 Bacteria 1054
6 Ga0070683_100257554 3300005329 Bacteria 1660
7 Ga0070683_100394527 3300005329 Bacteria 1319
8 Ga0070670_100290990 3300005331 Bacteria 1427
9 Ga0070670_101040506 3300005331 Bacteria 745
10 Ga0070680_100232594 3300005336 Bacteria 1557
11 Ga0070680_101044801 3300005336 Bacteria 706
12 Ga0070660_100497824 3300005339 Bacteria 1014
13 Ga0070660_101288522 3300005339 Bacteria 620
14 Ga0070689_100370548 3300005340 Bacteria 1205
15 Ga0070692_10391016 3300005345 Bacteria 875
16 Ga0070692_10588897 3300005345 Bacteria 734
17 Ga0070675_100595618 3300005354 Bacteria 1002
18 Ga0070673_101107819 3300005364 Bacteria 740
19 Ga0070659_100805752 3300005366 Bacteria 817
20 Ga0070659_101346211 3300005366 Bacteria 634
21 Ga0070703_10497972 3300005406 Bacteria 548
22 Ga0070714_100004475 3300005435 Bacteria 10531
23 Ga0070713_102107990 3300005436 Unclassified 547
24 Ga0070701_10744901 3300005438 Bacteria 663
25 Ga0070681_10097706 3300005458 Bacteria 2884
26 Ga0070681_10132522 3300005458 Bacteria 2424
27 Ga0068867_101023545 3300005459 Bacteria 750
28 Ga0068867_101375655 3300005459 Bacteria 654
29 Ga0070698_101218330 3300005471 Bacteria 702
30 Ga0070679_100436926 3300005530 Bacteria 1254
31 Ga0070679_101280678 3300005530 Bacteria 679
32 Ga0068853_100203413 3300005539 Bacteria 1803
33 Ga0070695_100451249 3300005545 Bacteria 985
34 Ga0070695_100828808 3300005545 Bacteria 743
35 Ga0070693_101035877 3300005547 Bacteria 623
36 Ga0070704_100211644 3300005549 Bacteria 1571
37 Ga0068855_100287228 3300005563 Bacteria 1824
38 Ga0068855_100941328 3300005563 Bacteria 910
39 Ga0068857_100217040 3300005577 Bacteria 1746
40 Ga0068854_100922953 3300005578 Bacteria 768
41 Ga0068856_100008777 3300005614 Bacteria 9832
42 Ga0070702_100053747 3300005615 Bacteria 2315
43 Ga0068852_101361295 3300005616 Bacteria 732
44 Ga0068864_101552473 3300005618 Bacteria 665
45 Ga0068866_11024245 3300005718 Bacteria 588
46 Ga0068861_101194545 3300005719 Bacteria 735
47 Ga0068863_101489089 3300005841 Bacteria 685
48 Ga0068858_100908843 3300005842 Bacteria 861
49 Ga0068858_102385186 3300005842 Unclassified 523
50 Ga0097621_101812359 3300006237 Bacteria 582
51 Ga0068871_100621577 3300006358 Bacteria 984
52 Ga0075430_100210915 3300006846 Bacteria 1612
53 Ga0075433_10884853 3300006852 Unclassified 779
54 Ga0075429_100236358 3300006880 Bacteria 1600
55 Ga0068865_101221772 3300006881 Archaea 666
56 Ga0099795_10513064 3300007788 Bacteria 560
57 Ga0105240_10113248 3300009093 Bacteria 3278
58 Ga0105240_10842215 3300009093 Bacteria 990
59 Ga0105240_10949603 3300009093 Bacteria 922
60 Ga0105240_11017123 3300009093 Bacteria 885
61 Ga0105240_12599469 3300009093 Archaea 523
62 Ga0111539_10164826 3300009094 Bacteria 2592
63 Ga0105245_10447999 3300009098 Bacteria 1299
64 Ga0114129_11566786 3300009147 Unclassified 808
65 Ga0105241_10674621 3300009174 Bacteria 941
66 Ga0105237_10748034 3300009545 Bacteria 984
67 Ga0105237_11070435 3300009545 Bacteria 813
68 Ga0105238_10096066 3300009551 Bacteria 2950
69 Ga0105238_12316175 3300009551 Bacteria 572
70 Ga0099796_10241689 3300010159 Bacteria 747
71 Ga0099796_10288628 3300010159 Bacteria 692
72 Ga0105239_10781086 3300010375 Bacteria 1094
73 Ga0157373_11496018 3300013100 Bacteria 515
74 Ga0157371_11142406 3300013102 Bacteria 599
75 Ga0157370_10039020 3300013104 Bacteria 4592
76 Ga0157370_11272113 3300013104 Bacteria 663
77 Ga0157369_12676215 3300013105 Unclassified 503
78 Ga0157378_10871919 3300013297 Unclassified 929
79 Ga0157378_11072259 3300013297 Bacteria 842
80 Ga0157378_12463260 3300013297 Bacteria 572
81 Ga0163162_11185879 3300013306 Bacteria 866
82 Ga0157372_10790425 3300013307 Bacteria 1103
83 Ga0157372_12032260 3300013307 Bacteria 660
84 Ga0157372_12297114 3300013307 Bacteria 619
85 Ga0157375_12072351 3300013308 Unclassified 677
86 Ga0157375_13337500 3300013308 Bacteria 535
87 Ga0163163_11987324 3300014325 Unclassified 641
88 Ga0163163_12210349 3300014325 Bacteria 609
89 Ga0157380_11530456 3300014326 Unclassified 721
90 Ga0157380_11597385 3300014326 Unclassified 707
91 Ga0157376_10416295 3300014969 Bacteria 1303
92 Ga0157376_12029532 3300014969 Bacteria 613
93 Ga0163161_11691418 3300017792 Bacteria 560
94 Ga0197907_10650989 3300020069 Bacteria 771
95 Ga0207692_10506801 3300025898 Bacteria 766
96 Ga0207705_10187084 3300025909 Bacteria 1565
97 Ga0207707_10355208 3300025912 Bacteria 1262
98 Ga0207695_10012898 3300025913 Bacteria 10002
99 Ga0207695_10316540 3300025913 Bacteria 1450
100 Ga0207695_11115268 3300025913 Bacteria 669
101 Ga0207695_11222097 3300025913 Bacteria 632
102 Ga0207671_10654233 3300025914 Bacteria 837
103 Ga0207693_10286164 3300025915 Bacteria 1291
104 Ga0207663_11310895 3300025916 Bacteria 583
105 Ga0207660_10848854 3300025917 Bacteria 745
106 Ga0207657_10094299 3300025919 Bacteria 2492
107 Ga0207649_10444236 3300025920 Bacteria 978
108 Ga0207652_10450308 3300025921 Bacteria 1160
109 Ga0207652_10704023 3300025921 Bacteria 901
110 Ga0207694_10053583 3300025924 Bacteria 3128
111 Ga0207694_11139842 3300025924 Bacteria 660
112 Ga0207650_10245851 3300025925 Bacteria 1447
113 Ga0207659_10628693 3300025926 Bacteria 916
114 Ga0207700_10883361 3300025928 Unclassified 800
115 Ga0207664_10001982 3300025929 Bacteria 13482
116 Ga0207690_11568091 3300025932 Bacteria 550
117 Ga0207686_10182417 3300025934 Bacteria 1489
118 Ga0207670_10291069 3300025936 Bacteria 1276
119 Ga0207661_11112104 3300025944 Bacteria 727
120 Ga0207667_10306897 3300025949 Bacteria 1621
121 Ga0207667_11660396 3300025949 Bacteria 606
122 Ga0207667_11819780 3300025949 Bacteria 573
123 Ga0207651_12095869 3300025960 Unclassified 508
124 Ga0207640_10786163 3300025981 Bacteria 823
125 Ga0207677_10697516 3300026023 Unclassified 900
126 Ga0207703_12131546 3300026035 Unclassified 537
127 Ga0207639_10202219 3300026041 Bacteria 1704
128 Ga0207708_10330940 3300026075 Bacteria 1245
129 Ga0207702_10010201 3300026078 Bacteria 7863
130 Ga0207641_10401595 3300026088 Unclassified 1316
131 Ga0207648_10654908 3300026089 Bacteria 971
132 Ga0207676_11045026 3300026095 Bacteria 806
133 Ga0207676_11676841 3300026095 Bacteria 634
134 Ga0207674_10336313 3300026116 Bacteria 1460
135 Ga0207698_11604147 3300026142 Bacteria 666
136 Ga0265326_10001638 3300028558 Bacteria 7751
137 Ga0265319_1057577 3300028563 Bacteria 1267
138 Ga0265334_10022786 3300028573 Bacteria 2549
139 Ga0265334_10136654 3300028573 Bacteria 870
140 Ga0265322_10191434 3300028654 Bacteria 585
141 Ga0265336_10047275 3300028666 Bacteria 1306
142 Ga0265338_10000105 3300028800 Bacteria 156108
143 Ga0265338_10001469 3300028800 Bacteria 38157
144 Ga0265338_10007414 3300028800 Bacteria 13622
145 Ga0265338_10069897 3300028800 Bacteria 3014
146 Ga0265338_10186729 3300028800 Bacteria 1575
147 Ga0265338_10267581 3300028800 Bacteria 1254
148 Ga0265338_10466172 3300028800 Bacteria 893
149 Ga0265324_10169900 3300029957 Bacteria 740
150 Ga0307511_10132397 3300030521 Bacteria 1497
151 Ga0265332_10134894 3300031238 Bacteria 1035
152 Ga0265328_10362660 3300031239 Bacteria 565
153 Ga0265320_10303830 3300031240 Bacteria 705
154 Ga0265340_10317077 3300031247 Bacteria 690
155 Ga0265339_10029749 3300031249 Bacteria 3097
156 Ga0265339_10355636 3300031249 Bacteria 690
157 Ga0265327_10241914 3300031251 Bacteria 806
158 Ga0265316_10603920 3300031344 Bacteria 778
159 Ga0307408_100245231 3300031548 Bacteria 1475
160 Ga0265313_10177506 3300031595 Bacteria 896
161 Ga0316579_10007304 3300031691 Bacteria 4558
162 Ga0316579_10295087 3300031691 Unclassified 784
163 Ga0265342_10150504 3300031712 Bacteria 1292
164 Ga0265342_10297401 3300031712 Bacteria 851
165 Ga0307405_10246691 3300031731 Bacteria 1326
166 Ga0307405_11317969 3300031731 Unclassified 629
167 Ga0307413_11600983 3300031824 Unclassified 578
168 Ga0307410_11063566 3300031852 Bacteria 700
169 Ga0307406_10459640 3300031901 Bacteria 1023
170 Ga0307412_10051189 3300031911 Bacteria 2728
171 Ga0307409_101483224 3300031995 Bacteria 705
172 Ga0307416_100042212 3300032002 Bacteria 3559
173 Ga0307416_103097473 3300032002 Unclassified 556
174 Ga0307414_10490995 3300032004 Bacteria 1085
175 Ga0307415_100113129 3300032126 Bacteria 2018
176 Ga0316593_10205690 3300032168 Bacteria 729
177 Ga0316593_10221252 3300032168 Bacteria 703
178 Ga0316593_10323354 3300032168 Unclassified 587
179 Ga0373954_0233750 3300035118 Bacteria 905
180 Ga0316582_0011844 3300036647 Bacteria 4840
181 Ga0316582_0068020 3300036647 Bacteria 2299
182 Ga0316582_0099082 3300036647 Bacteria 1928
183 Ga0451849_1286541 3300041505 Unclassified 561
184 Ga0439435_0088253 3300042436 Bacteria 939
185 Ga0453684_0093879 3300044712 Bacteria 3694
186 Ga0453684_0633240 3300044712 Unclassified 1169
187 Ga0453684_0957952 3300044712 Bacteria 913
188 Ga0453684_1160356 3300044712 Unclassified 813
189 Ga0453684_1558507 3300044712 Bacteria 679
190 Ga0453684_2300607 3300044712 Bacteria 536
191 Ga0451576_0023870 3300045051 Bacteria 6614
192 Ga0451576_0128383 3300045051 Bacteria 2642
193 Ga0451576_0695280 3300045051 Bacteria 1068
194 Ga0466958_0538182 3300045836 Bacteria 759
195 Ga0495596_0382824 3300046500 Bacteria 548
196 Ga0495632_0188703 3300046519 Bacteria 942
197 Ga0495586_0118117 3300046535 Bacteria 1480
198 Ga0495657_0076896 3300046675 Bacteria 2167
199 Ga0495657_0629451 3300046675 Unclassified 620
200 Ga0495683_0472937 3300047323 Unclassified 512
201 Ga0495686_0256006 3300047472 Bacteria 982
202 Ga0496105_0384705 3300048908 Bacteria 1116
203 Ga0496115_0002169 3300048918 Bacteria 14046
204 Ga0496115_0564455 3300048918 Bacteria 908
205 Ga0501031_0000292 3300049568 Bacteria 28530
206 Ga0501032_0017943 3300049569 Bacteria 4964
207 Ga0501033_0008437 3300049570 Bacteria 7980
208 Ga0501033_0009054 3300049570 Bacteria 7681
209 Ga0501034_0150861 3300049571 Bacteria 2300
210 Ga0501034_0426948 3300049571 Bacteria 1246
211 Ga0501034_0896965 3300049571 Bacteria 775
212 Ga0501036_0552508 3300049572 Unclassified 957
213 Ga0501037_0419855 3300049573 Unclassified 915
214 Ga0501039_0130275 3300049575 Bacteria 1974
215 Ga0501046_0216789 3300049580 Unclassified 1419
216 Ga0501047_0275748 3300049581 Bacteria 1527
217 Ga0501199_051972 3300049650 Unclassified 556
218 Ga0501257_106172 3300049686 Bacteria 741
219 Ga0501263_063060 3300049760 Bacteria 585
220 Ga0501035_0054937 3300049822 Bacteria 3556
221 Ga0501044_0000427 3300049823 Bacteria 52004
222 nmdc:mga09592_698709_c1 3300050508 Bacteria 863
223 nmdc:mga0qj67_374336_c1 3300050509 Unclassified 1150
224 nmdc:mga0rr50_566751_c1 3300050513 Bacteria 967
225 nmdc:mga0a205_938535_c1 3300050515 Unclassified 712
226 Ga0495595_0577604 3300053084 Bacteria 574
227 Ga0500643_190844 3300053087 Bacteria 549
228 Ga0590074_032252 3300059423 Bacteria 928
229 Ga0590075_164697 3300059424 Bacteria 585
230 Ga0587085_085093 3300059506 Unclassified 643
231 Ga0587091_178702 3300059511 Unclassified 557
232 Ga0587106_095562 3300059605 Unclassified 600
233 Ga0587076_168942 3300059645 Unclassified 543
234 Ga0587079_104974 3300059647 Unclassified 679
235 2830079053 2830075706 Bacteria 3855215
236 2928028511 2928027323 Bacteria 4382488
237 2984555912 2984555340 Bacteria 4247089
238 2984565981 2984564862 Bacteria 4339992
239 2993356990 2993356040 Bacteria 4247105
240 Ga0075436_100336958
241 Ga0058861_11777567
242 Ga0058862_10020528
243 Ga0070658_10263995
244 Ga0070658_10496657
245 Ga0070683_100257554
246 Ga0070683_100394527
247 Ga0070670_100290990
248 Ga0070670_101040506
249 Ga0070680_100232594
250 Ga0070680_101044801
251 Ga0070660_100497824
252 Ga0070660_101288522
253 Ga0070689_100370548
254 Ga0070692_10391016
255 Ga0070692_10588897
256 Ga0070675_100595618
257 Ga0070673_101107819
258 Ga0070659_100805752
259 Ga0070659_101346211
260 Ga0070703_10497972
261 Ga0070714_100004475
262 Ga0070713_102107990
263 Ga0070701_10744901
264 Ga0070681_10097706
265 Ga0070681_10132522
266 Ga0068867_101023545
267 Ga0068867_101375655
268 Ga0070698_101218330
269 Ga0070679_100436926
270 Ga0070679_101280678
271 Ga0068853_100203413
272 Ga0070695_100451249
273 Ga0070695_100828808
274 Ga0070693_101035877
275 Ga0070704_100211644
276 Ga0068855_100287228
277 Ga0068855_100941328
278 Ga0068857_100217040
279 Ga0068854_100922953
280 Ga0068856_100008777
281 Ga0070702_100053747
282 Ga0068852_101361295
283 Ga0068864_101552473
284 Ga0068866_11024245
285 Ga0068861_101194545
286 Ga0068863_101489089
287 Ga0068858_100908843
288 Ga0068858_102385186
289 Ga0097621_101812359
290 Ga0068871_100621577
291 Ga0075430_100210915
292 Ga0075433_10884853
293 Ga0075429_100236358
294 Ga0068865_101221772
295 Ga0099795_10513064
296 Ga0105240_10113248
297 Ga0105240_10842215
298 Ga0105240_10949603
299 Ga0105240_11017123
300 Ga0105240_12599469
301 Ga0111539_10164826
302 Ga0105245_10447999
303 Ga0114129_11566786
304 Ga0105241_10674621
305 Ga0105237_10748034
306 Ga0105237_11070435
307 Ga0105238_10096066
308 Ga0105238_12316175
309 Ga0099796_10241689
310 Ga0099796_10288628
311 Ga0105239_10781086
312 Ga0157373_11496018
313 Ga0157371_11142406
314 Ga0157370_10039020
315 Ga0157370_11272113
316 Ga0157369_12676215
317 Ga0157378_10871919
318 Ga0157378_11072259
319 Ga0157378_12463260
320 Ga0163162_11185879
321 Ga0157372_10790425
322 Ga0157372_12032260
323 Ga0157372_12297114
324 Ga0157375_12072351
325 Ga0157375_13337500
326 Ga0163163_11987324
327 Ga0163163_12210349
328 Ga0157380_11530456
329 Ga0157380_11597385
330 Ga0157376_10416295
331 Ga0157376_12029532
332 Ga0163161_11691418
333 Ga0197907_10650989
334 Ga0207692_10506801
335 Ga0207705_10187084
336 Ga0207707_10355208
337 Ga0207695_10012898
338 Ga0207695_10316540
339 Ga0207695_11115268
340 Ga0207695_11222097
341 Ga0207671_10654233
342 Ga0207693_10286164
343 Ga0207663_11310895
344 Ga0207660_10848854
345 Ga0207657_10094299
346 Ga0207649_10444236
347 Ga0207652_10450308
348 Ga0207652_10704023
349 Ga0207694_10053583
350 Ga0207694_11139842
351 Ga0207650_10245851
352 Ga0207659_10628693
353 Ga0207700_10883361
354 Ga0207664_10001982
355 Ga0207690_11568091
356 Ga0207686_10182417
357 Ga0207670_10291069
358 Ga0207661_11112104
359 Ga0207667_10306897
360 Ga0207667_11660396
361 Ga0207667_11819780
362 Ga0207651_12095869
363 Ga0207640_10786163
364 Ga0207677_10697516
365 Ga0207703_12131546
366 Ga0207639_10202219
367 Ga0207708_10330940
368 Ga0207702_10010201
369 Ga0207641_10401595
370 Ga0207648_10654908
371 Ga0207676_11045026
372 Ga0207676_11676841
373 Ga0207674_10336313
374 Ga0207698_11604147
375 Ga0265326_10001638
376 Ga0265319_1057577
377 Ga0265334_10022786
378 Ga0265334_10136654
379 Ga0265322_10191434
380 Ga0265336_10047275
381 Ga0265338_10000105
382 Ga0265338_10001469
383 Ga0265338_10007414
384 Ga0265338_10069897
385 Ga0265338_10186729
386 Ga0265338_10267581
387 Ga0265338_10466172
388 Ga0265324_10169900
389 Ga0307511_10132397
390 Ga0265332_10134894
391 Ga0265328_10362660
392 Ga0265320_10303830
393 Ga0265340_10317077
394 Ga0265339_10029749
395 Ga0265339_10355636
396 Ga0265327_10241914
397 Ga0265316_10603920
398 Ga0307408_100245231
399 Ga0265313_10177506
400 Ga0316579_10007304
401 Ga0316579_10295087
402 Ga0265342_10150504
403 Ga0265342_10297401
404 Ga0307405_10246691
405 Ga0307405_11317969
406 Ga0307413_11600983
407 Ga0307410_11063566
408 Ga0307406_10459640
409 Ga0307412_10051189
410 Ga0307409_101483224
411 Ga0307416_100042212
412 Ga0307416_103097473
413 Ga0307414_10490995
414 Ga0307415_100113129
415 Ga0316593_10205690
416 Ga0316593_10221252
417 Ga0316593_10323354
418 Ga0373954_0233750
419 Ga0316582_0011844
420 Ga0316582_0068020
421 Ga0316582_0099082
422 Ga0451849_1286541
423 Ga0439435_0088253
424 Ga0453684_0093879
425 Ga0453684_0633240
426 Ga0453684_0957952
427 Ga0453684_1160356
428 Ga0453684_1558507
429 Ga0453684_2300607
430 Ga0451576_0023870
431 Ga0451576_0128383
432 Ga0451576_0695280
433 Ga0466958_0538182
434 Ga0495596_0382824
435 Ga0495632_0188703
436 Ga0495586_0118117
437 Ga0495657_0076896
438 Ga0495657_0629451
439 Ga0495683_0472937
440 Ga0495686_0256006
441 Ga0496105_0384705
442 Ga0496115_0002169
443 Ga0496115_0564455
444 Ga0501031_0000292
445 Ga0501032_0017943
446 Ga0501033_0008437
447 Ga0501033_0009054
448 Ga0501034_0150861
449 Ga0501034_0426948
450 Ga0501034_0896965
451 Ga0501036_0552508
452 Ga0501037_0419855
453 Ga0501039_0130275
454 Ga0501046_0216789
455 Ga0501047_0275748
456 Ga0501199_051972
457 Ga0501257_106172
458 Ga0501263_063060
459 Ga0501035_0054937
460 Ga0501044_0000427
461 nmdc:mga09592_698709_c1
462 nmdc:mga0qj67_374336_c1
463 nmdc:mga0rr50_566751_c1
464 nmdc:mga0a205_938535_c1
465 Ga0495595_0577604
466 Ga0500643_190844
467 Ga0590074_032252
468 Ga0590075_164697
469 Ga0587085_085093
470 Ga0587091_178702
471 Ga0587106_095562
472 Ga0587076_168942
473 Ga0587079_104974
474 2830079053
475 2928028511
476 2984555912
477 2984565981
478 2993356990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00831

Ribosomal_L29

Ribosomal L29 protein

4

60

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4i-assembly1.cif.gz_Z structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9832 7 61
8a57-assembly1.cif.gz_2 cryo-em structure of hflxr bound to the listeria monocytogenes 50s ribosomal subunit. 0.9812 7 61
8a63-assembly1.cif.gz_2 cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9782 7 61
7nhn-assembly1.cif.gz_2 vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.977 7 61
7ac7-assembly1.cif.gz_Y structure of accomodated trans-translation complex on e. coli stalled ribosome. 0.9722 7 61
ID Description Score Start End Superfamily
4wf9V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9647 10 66 1.10.287.310
3ccjV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9644 7 57 1.10.287.310
4wceV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9501 6 66 1.10.287.310
1q81W00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9474 5 57 1.10.287.310
1vx7301 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9444 7 66 1.10.287.310
ID Description Score Start End GO Terms
AF-A0A0C1RJI7-F1-model_v4 Large ribosomal subunit protein uL29 0.9924 7 66 GO:0003735
GO:0006412
GO:0022625
AF-A0A358PH50-F1-model_v4 Large ribosomal subunit protein uL29 0.9924 7 61 GO:0003735
GO:0006412
GO:0022625
AF-A0A7X8XLV5-F1-model_v4 Large ribosomal subunit protein uL29 0.9915 8 66 GO:0003735
GO:0006412
GO:0022625
AF-A0A812IND5-F1-model_v4 deleted 0.9907 8 66
AF-A0A1M7SE50-F1-model_v4 Large ribosomal subunit protein uL29 0.9882 7 61 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map