F349038

General Info

Members Datasets Scaffolds Average Seq Length
236 159 228 361

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10138041|Ga0114129_101380413
Length 412
Sequence VAGGALVVEGLQKAFADGRDRVHAVADVSFTVEEGAFYTLLGPSGCGKTTTLRCVAGLEHPDAGRVALGEQTLSAPRQWVPPHRRDIGMVFQSYAIWPHMTVFENVAFPLRVLGTREIAQRVEAARAELEADDSGYQQMDKKAKRMAFMLAVMRRGVAGRGLRHTEIATRVQDALVAVGLGSLASRNATQLSGGQQQRLALARALVRRPRLLLLDEPLSNLDATLRDRMRGELRNLQRQLGVTTLYVTHDQTEALSMSTRVAVMEHGRIVQEAAPRDLYLRPATRFVAEFVGSSNFMAAEVVASGGGLALRAPIGVVHACLDGASAGDQVTFFTRPENIRAHTEPADGPNFYEGTVEEVAFLGEAVHCRVRIGPEVLSIRHHPGLDLRPGSQVHLELPPDLCTVLPADDSGE

Samples

Sample ID Description Type Environment
1 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
2 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
3 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
4 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
5 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
6 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
7 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
158 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
159 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 0.85
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000066 3300000549 Bacteria 17055
2 JGI25153J46596_10002482 3300003215 Bacteria 10588
3 Ga0055542_1004675 3300003762 Bacteria 3250
4 JGI25405J52794_10004819 3300003911 Bacteria 2419
5 Ga0065707_10053455 3300005295 Bacteria 1513
6 Ga0070670_100262311 3300005331 Bacteria 1506
7 Ga0070668_100205201 3300005347 Bacteria 1619
8 Ga0070675_100203162 3300005354 Bacteria 1720
9 Ga0070674_100011340 3300005356 Bacteria 5424
10 Ga0070667_100088912 3300005367 Bacteria 2653
11 Ga0070714_100001430 3300005435 Bacteria 17351
12 Ga0070713_100067933 3300005436 Bacteria 3003
13 Ga0070713_100219846 3300005436 Bacteria 1723
14 Ga0070700_100290261 3300005441 Bacteria 1190
15 Ga0070678_100167732 3300005456 Bacteria 1785
16 Ga0070662_100025444 3300005457 Bacteria 4087
17 Ga0070681_10004711 3300005458 Bacteria 13056
18 Ga0070681_10065851 3300005458 Bacteria 3592
19 Ga0070706_100086665 3300005467 Bacteria 2901
20 Ga0070707_100011999 3300005468 Bacteria 8087
21 Ga0070699_100097103 3300005518 Bacteria 2581
22 Ga0070697_100037138 3300005536 Bacteria 3935
23 Ga0070672_100213761 3300005543 Bacteria 1616
24 Ga0070695_100138972 3300005545 Bacteria 1682
25 Ga0070696_100064157 3300005546 Bacteria 2574
26 Ga0070696_100097984 3300005546 Bacteria 2097
27 Ga0070665_100194339 3300005548 Bacteria 2030
28 Ga0070704_100154859 3300005549 Bacteria 1806
29 Ga0068856_100000651 3300005614 Bacteria 37648
30 Ga0068859_100063382 3300005617 Bacteria 3727
31 Ga0068863_100036699 3300005841 Bacteria 4668
32 Ga0068863_100162717 3300005841 Bacteria 2139
33 Ga0068860_100011748 3300005843 Bacteria 8628
34 Ga0081455_10000301 3300005937 Bacteria 65118
35 Ga0081538_10017564 3300005981 Bacteria 5422
36 Ga0081539_10000784 3300005985 Bacteria 61876
37 Ga0081539_10020604 3300005985 Bacteria 4447
38 Ga0070717_10120513 3300006028 Bacteria 2247
39 Ga0075363_100000072 3300006048 Bacteria 21002
40 Ga0097621_100209061 3300006237 Bacteria 1697
41 Ga0068871_100081937 3300006358 Bacteria 2674
42 Ga0075428_100004295 3300006844 Bacteria 15696
43 Ga0075428_100030339 3300006844 Bacteria 5980
44 Ga0075430_100000315 3300006846 Bacteria 34468
45 Ga0075430_100003866 3300006846 Bacteria 12615
46 Ga0075430_100054368 3300006846 Bacteria 3369
47 Ga0075431_100011126 3300006847 Bacteria 9058
48 Ga0075431_100284183 3300006847 Bacteria 1675
49 Ga0075433_10002258 3300006852 Bacteria 14638
50 Ga0075433_10004874 3300006852 Bacteria 10498
51 Ga0075433_10024613 3300006852 Bacteria 5084
52 Ga0075433_10066449 3300006852 Bacteria 3164
53 Ga0075433_10161090 3300006852 Bacteria 1997
54 Ga0075433_10383184 3300006852 Bacteria 1241
55 Ga0075434_100007193 3300006871 Bacteria 10294
56 Ga0075434_100037869 3300006871 Bacteria 4775
57 Ga0075436_100009802 3300006914 Bacteria 6550
58 Ga0075436_100014216 3300006914 Bacteria 5450
59 Ga0097620_100063384 3300006931 Bacteria 3727
60 Ga0097620_100582142 3300006931 Bacteria 1213
61 Ga0075435_100016384 3300007076 Bacteria 5588
62 Ga0075435_100051543 3300007076 Bacteria 3316
63 Ga0075435_100064308 3300007076 Bacteria 2980
64 Ga0075435_100072520 3300007076 Bacteria 2813
65 Ga0075435_100318537 3300007076 Bacteria 1331
66 Ga0099794_10051874 3300007265 Bacteria 1976
67 Ga0105240_10250865 3300009093 Bacteria 2047
68 Ga0111539_10001266 3300009094 Bacteria 33726
69 Ga0111539_10058461 3300009094 Bacteria 4575
70 Ga0111539_10200678 3300009094 Bacteria 2326
71 Ga0114129_10050495 3300009147 Bacteria 5842
72 Ga0114129_10056564 3300009147 Bacteria 5494
73 Ga0114129_10112306 3300009147 Bacteria 3758
74 Ga0114129_10120414 3300009147 Bacteria 3613
75 Ga0114129_10138041 3300009147 Bacteria 3344
76 Ga0114129_10501636 3300009147 Bacteria 1585
77 Ga0105248_10019501 3300009177 Bacteria 7506
78 Ga0163162_10028646 3300013306 Bacteria 5512
79 Ga0157380_10069490 3300014326 Bacteria 2842
80 Ga0157376_10009788 3300014969 Bacteria 6983
81 Ga0213875_10029569 3300021388 Bacteria 2598
82 Ga0209148_1002818 3300025254 Bacteria 5396
83 Ga0207707_10020654 3300025912 Bacteria 5752
84 Ga0207707_10047794 3300025912 Bacteria 3726
85 Ga0207649_10072396 3300025920 Bacteria 2205
86 Ga0207652_10015815 3300025921 Bacteria 6148
87 Ga0207646_10169510 3300025922 Bacteria 1971
88 Ga0207700_10300367 3300025928 Bacteria 1386
89 Ga0207664_10003605 3300025929 Bacteria 10359
90 Ga0207644_10157046 3300025931 Bacteria 1765
91 Ga0207706_10023809 3300025933 Bacteria 5493
92 Ga0207691_10066054 3300025940 Bacteria 3273
93 Ga0207711_10089313 3300025941 Bacteria 2707
94 Ga0207658_10127471 3300025986 Bacteria 2039
95 Ga0207708_10134960 3300026075 Bacteria 1932
96 Ga0207641_10057440 3300026088 Bacteria 3309
97 Ga0207641_10127089 3300026088 Bacteria 2284
98 Ga0207675_100195088 3300026118 Bacteria 1943
99 Ga0207683_10062361 3300026121 Bacteria 3283
100 Ga0209974_10001269 3300027876 Bacteria 9070
101 Ga0207428_10012473 3300027907 Bacteria 7465
102 Ga0207428_10101852 3300027907 Bacteria 2218
103 Ga0268266_10106341 3300028379 Bacteria 2480
104 Ga0265338_10229733 3300028800 Bacteria 1381
105 Ga0307508_10075587 3300031616 Bacteria 2946
106 Ga0307405_10023857 3300031731 Bacteria 3484
107 Ga0316577_10115832 3300031733 Bacteria 1505
108 Ga0307413_10047936 3300031824 Bacteria 2551
109 Ga0307410_10002163 3300031852 Bacteria 9336
110 Ga0307406_10011581 3300031901 Bacteria 5011
111 Ga0307407_10017750 3300031903 Bacteria 3580
112 Ga0307407_10140401 3300031903 Bacteria 1558
113 Ga0307412_10246076 3300031911 Bacteria 1386
114 Ga0307416_100001736 3300032002 Bacteria 12068
115 Ga0307414_10187023 3300032004 Bacteria 1672
116 Ga0307411_10029653 3300032005 Bacteria 3344
117 Ga0307415_100038761 3300032126 Bacteria 3143
118 Ga0307415_100280746 3300032126 Bacteria 1369
119 Ga0373953_0027218 3300035117 Bacteria 2196
120 Ga0373931_0002589 3300035691 Bacteria 8056
121 Ga0373931_0030378 3300035691 Bacteria 2781
122 Ga0373935_0086731 3300035692 Bacteria 2043
123 Ga0373937_0012613 3300036401 Bacteria 7437
124 Ga0373925_0337930 3300037068 Bacteria 1221
125 Ga0395899_0006270 3300037312 Bacteria 9204
126 Ga0395899_0026398 3300037312 Bacteria 4383
127 Ga0395900_0002058 3300037418 Bacteria 22562
128 Ga0395900_0021299 3300037418 Bacteria 6627
129 Ga0395900_0208361 3300037418 Bacteria 1975
130 Ga0395898_0070934 3300037466 Bacteria 3367
131 Ga0395898_0516954 3300037466 Bacteria 1135
132 Ga0395905_0017219 3300037471 Bacteria 6864
133 Ga0436364_1139457 3300037853 Bacteria 3884
134 Ga0395901_0024790 3300038443 Bacteria 6157
135 Ga0436361_0442432 3300039447 Bacteria 4499
136 Ga0436362_0853400 3300039453 Bacteria 1422
137 Ga0439442_000049 3300042002 Bacteria 27387
138 Ga0439442_000764 3300042002 Bacteria 6731
139 Ga0451577_0060709 3300042876 Bacteria 3371
140 Ga0466972_0004335 3300044658 Bacteria 7088
141 Ga0453683_0059856 3300044673 Bacteria 2381
142 Ga0453684_0103933 3300044712 Bacteria 3469
143 Ga0466960_0000566 3300044901 Bacteria 12783
144 Ga0466960_0066315 3300044901 Bacteria 1785
145 Ga0495638_0069118 3300046460 Bacteria 2165
146 Ga0495650_0015263 3300046471 Bacteria 3947
147 Ga0495580_0002039 3300046472 Bacteria 17774
148 Ga0495580_0003562 3300046472 Bacteria 13226
149 Ga0496102_0077009 3300048905 Bacteria 3069
150 Ga0496110_0381751 3300048913 Bacteria 1284
151 Ga0501031_0001408 3300049568 Bacteria 14874
152 Ga0501031_0154350 3300049568 Bacteria 1500
153 Ga0501032_0048873 3300049569 Bacteria 2855
154 Ga0501033_0002500 3300049570 Bacteria 15578
155 Ga0501033_0025972 3300049570 Bacteria 4409
156 Ga0501033_0071623 3300049570 Bacteria 2546
157 Ga0501034_0188819 3300049571 Bacteria 2023
158 Ga0501036_0062370 3300049572 Bacteria 3157
159 Ga0501036_0066090 3300049572 Bacteria 3059
160 Ga0501036_0208434 3300049572 Bacteria 1643
161 Ga0501036_0255697 3300049572 Bacteria 1467
162 Ga0501037_0007892 3300049573 Bacteria 7798
163 Ga0501038_0012481 3300049574 Bacteria 7763
164 Ga0501038_0036943 3300049574 Bacteria 4285
165 Ga0501039_0006485 3300049575 Bacteria 8896
166 Ga0501039_0023428 3300049575 Bacteria 4739
167 Ga0501040_0013581 3300049576 Bacteria 5356
168 Ga0501040_0185656 3300049576 Bacteria 1475
169 Ga0501041_0006414 3300049577 Bacteria 6885
170 Ga0501041_0022414 3300049577 Bacteria 3781
171 Ga0501042_0016114 3300049578 Bacteria 5129
172 Ga0501043_0019172 3300049579 Bacteria 5370
173 Ga0501043_0137083 3300049579 Bacteria 1917
174 Ga0501043_0170581 3300049579 Bacteria 1697
175 Ga0501046_0007610 3300049580 Bacteria 9504
176 Ga0501046_0048304 3300049580 Bacteria 3371
177 Ga0501047_0049074 3300049581 Bacteria 4075
178 Ga0501068_0070114 3300049584 Bacteria 2138
179 Ga0501070_0290472 3300049586 Bacteria 1333
180 Ga0501071_0035070 3300049587 Bacteria 3573
181 Ga0501072_0033473 3300049588 Bacteria 4027
182 Ga0501072_0055719 3300049588 Bacteria 3115
183 Ga0501073_0087635 3300049589 Bacteria 2165
184 Ga0501075_0020279 3300049591 Bacteria 4832
185 Ga0501076_0039054 3300049592 Bacteria 3726
186 Ga0501076_0156345 3300049592 Bacteria 1856
187 Ga0501076_0205977 3300049592 Bacteria 1607
188 Ga0501077_0060489 3300049593 Bacteria 2404
189 Ga0501079_0123160 3300049741 Bacteria 2017
190 Ga0501079_0130681 3300049741 Bacteria 1954
191 Ga0501080_0007837 3300049742 Bacteria 9661
192 Ga0501081_0006047 3300049743 Bacteria 7838
193 Ga0501083_0079273 3300049744 Bacteria 2178
194 Ga0501035_0009092 3300049822 Bacteria 9238
195 Ga0501035_0039839 3300049822 Bacteria 4250
196 Ga0501035_0092136 3300049822 Bacteria 2667
197 Ga0501035_0250989 3300049822 Bacteria 1502
198 Ga0501044_0002983 3300049823 Bacteria 19183
199 Ga0501044_0050414 3300049823 Bacteria 4295
200 Ga0501045_0029212 3300049824 Bacteria 3983
201 nmdc:mga05p37_121758_c1 3300050507 Bacteria 3204
202 nmdc:mga05p37_20300_c1 3300050507 Bacteria 8040
203 nmdc:mga05p37_50980_c1 3300050507 Bacteria 5090
204 nmdc:mga05p37_58747_c1 3300050507 Bacteria 4737
205 nmdc:mga09592_19457_c1 3300050508 Bacteria 5575
206 nmdc:mga09592_267536_c1 3300050508 Bacteria 1482
207 nmdc:mga0qj67_1022_c1 3300050509 Bacteria 19340
208 nmdc:mga0qj67_157638_c1 3300050509 Bacteria 1843
209 nmdc:mga0qj67_188_c1 3300050509 Bacteria 41876
210 nmdc:mga0qj67_2341_c1 3300050509 Bacteria 13482
211 nmdc:mga06r32_6864_c1 3300050510 Bacteria 10233
212 nmdc:mga06r32_7943_c1 3300050510 Bacteria 9535
213 nmdc:mga08y16_10188_c1 3300050511 Bacteria 9871
214 nmdc:mga08y16_103038_c1 3300050511 Bacteria 2971
215 nmdc:mga0n895_13116_c1 3300050512 Bacteria 7459
216 nmdc:mga0n895_160062_c1 3300050512 Bacteria 2283
217 nmdc:mga0rr50_65831_c1 3300050513 Bacteria 2746
218 nmdc:mga0rr50_71268_c1 3300050513 Bacteria 2651
219 nmdc:mga08x19_12601_c1 3300050514 Bacteria 5098
220 nmdc:mga0a205_170_c1 3300050515 Bacteria 18646
221 nmdc:mga0a205_17820_c1 3300050515 Bacteria 6665
222 nmdc:mga0a205_55797_c1 3300050515 Bacteria 3621
223 nmdc:mga0a205_73327_c1 3300050515 Bacteria 3307
224 nmdc:mga0a205_97735_c2 3300050515 Bacteria 1943
225 Ga0500645_008867 3300053730 Bacteria 3405
226 Ga0501084_0059627 3300054114 Bacteria 3194
227 Ga0501082_0023287 3300060353 Bacteria 5342
228 Ga0530510_0040369 3300061734 Bacteria 3368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0130681 Ga0501079_0130681_127_1011 288
2 3300005441 Ga0070700_100290261 Ga0070700_1002902611 300
3 3300026075 Ga0207708_10134960 Ga0207708_101349603 300
4 3300048913 Ga0496110_0381751 Ga0496110_0381751_306_1235 300
5 3300037466 Ga0395898_0516954 Ga0395898_0516954_78_1007 307
6 3300005458 Ga0070681_10004711 Ga0070681_100047111 327
7 3300005468 Ga0070707_100011999 Ga0070707_1000119991 327
8 3300025912 Ga0207707_10020654 Ga0207707_100206541 327
9 3300025922 Ga0207646_10169510 Ga0207646_101695102 327
10 3300028800 Ga0265338_10229733 Ga0265338_102297332 329
11 3300003762 Ga0055542_1004675 Ga0055542_10046752 332
12 3300025254 Ga0209148_1002818 Ga0209148_10028185 332
13 3300042002 Ga0439442_000049 Ga0439442_000049_6625_7722 332
14 3300005458 Ga0070681_10065851 Ga0070681_100658513 334
15 3300046471 Ga0495650_0015263 Ga0495650_0015263_1731_2798 335
16 3300044712 Ga0453684_0103933 Ga0453684_0103933_2399_3454 337
17 iso_pu_bacteria 2852103415 2852104653 338
18 3300035691 Ga0373931_0030378 Ga0373931_0030378_1071_2198 340
19 3300005549 Ga0070704_100154859 Ga0070704_1001548591 341
20 3300005617 Ga0068859_100063382 Ga0068859_1000633824 341
21 3300006846 Ga0075430_100003866 Ga0075430_1000038669 341
22 3300006847 Ga0075431_100011126 Ga0075431_1000111265 341
23 3300006931 Ga0097620_100063384 Ga0097620_1000633844 341
24 3300009147 Ga0114129_10112306 Ga0114129_101123063 341
25 3300009147 Ga0114129_10120414 Ga0114129_101204141 341
26 3300025912 Ga0207707_10047794 Ga0207707_100477942 341
27 3300025921 Ga0207652_10015815 Ga0207652_100158153 341
28 3300035691 Ga0373931_0002589 Ga0373931_0002589_2319_3404 341
29 3300042876 Ga0451577_0060709 Ga0451577_0060709_233_1318 341
30 3300048905 Ga0496102_0077009 Ga0496102_0077009_670_1755 341
31 3300049576 Ga0501040_0185656 Ga0501040_0185656_19_1104 341
32 3300050507 nmdc:mga05p37_58747_c1 nmdc:mga05p37_58747_c1_3517_4602 341
33 3300050508 nmdc:mga09592_267536_c1 nmdc:mga09592_267536_c1_101_1186 341
34 3300050509 nmdc:mga0qj67_2341_c1 nmdc:mga0qj67_2341_c1_7530_8615 341
35 3300050510 nmdc:mga06r32_6864_c1 nmdc:mga06r32_6864_c1_8581_9666 341
36 3300061734 Ga0530510_0040369 Ga0530510_0040369_2242_3327 341
37 3300006931 Ga0097620_100582142 Ga0097620_1005821421 342
38 3300005457 Ga0070662_100025444 Ga0070662_1000254442 344
39 3300005841 Ga0068863_100162717 Ga0068863_1001627172 344
40 3300005843 Ga0068860_100011748 Ga0068860_1000117486 344
41 3300006844 Ga0075428_100004295 Ga0075428_1000042953 344
42 3300009094 Ga0111539_10001266 Ga0111539_100012669 344
43 3300013306 Ga0163162_10028646 Ga0163162_100286463 344
44 3300025933 Ga0207706_10023809 Ga0207706_100238092 344
45 3300025940 Ga0207691_10066054 Ga0207691_100660542 344
46 3300026088 Ga0207641_10127089 Ga0207641_101270892 344
47 3300027907 Ga0207428_10012473 Ga0207428_100124739 344
48 3300044673 Ga0453683_0059856 Ga0453683_0059856_67_1137 344
49 3300050511 nmdc:mga08y16_10188_c1 nmdc:mga08y16_10188_c1_1116_2210 344
50 3300026118 Ga0207675_100195088 Ga0207675_1001950881 345
51 3300049592 Ga0501076_0205977 Ga0501076_0205977_309_1403 345
52 3300049741 Ga0501079_0123160 Ga0501079_0123160_912_2006 345
53 iso_pu_bacteria 2775506735 2775657307 345
54 iso_pu_bacteria 2808606371 2808898732 345
55 iso_pu_bacteria 2811994871 2812319322 345
56 iso_pu_bacteria 2945941187 2945942195 345
57 iso_pu_bacteria 8004021418 8004025248 345
58 3300005545 Ga0070695_100138972 Ga0070695_1001389722 346
59 3300005546 Ga0070696_100097984 Ga0070696_1000979842 346
60 3300039453 Ga0436362_0853400 Ga0436362_0853400_340_1398 346
61 3300006844 Ga0075428_100030339 Ga0075428_1000303396 348
62 3300006846 Ga0075430_100054368 Ga0075430_1000543682 348
63 3300009094 Ga0111539_10200678 Ga0111539_102006783 348
64 3300009147 Ga0114129_10056564 Ga0114129_100565645 348
65 3300021388 Ga0213875_10029569 Ga0213875_100295692 348
66 3300037853 Ga0436364_1139457 Ga0436364_1139457_951_2015 348
67 3300042002 Ga0439442_000764 Ga0439442_000764_5081_6178 348
68 3300050507 nmdc:mga05p37_20300_c1 nmdc:mga05p37_20300_c1_4913_6001 348
69 3300050507 nmdc:mga05p37_50980_c1 nmdc:mga05p37_50980_c1_3883_4956 348
70 3300050508 nmdc:mga09592_19457_c1 nmdc:mga09592_19457_c1_2957_4030 348
71 3300050509 nmdc:mga0qj67_157638_c1 nmdc:mga0qj67_157638_c1_176_1249 348
72 3300050510 nmdc:mga06r32_7943_c1 nmdc:mga06r32_7943_c1_2755_3828 348
73 3300003215 JGI25153J46596_10002482 JGI25153J46596_100024828 349
74 3300005347 Ga0070668_100205201 Ga0070668_1002052012 349
75 3300005536 Ga0070697_100037138 Ga0070697_1000371384 349
76 3300046460 Ga0495638_0069118 Ga0495638_0069118_73_1164 349
77 3300003911 JGI25405J52794_10004819 JGI25405J52794_100048191 350
78 3300005354 Ga0070675_100203162 Ga0070675_1002031621 350
79 3300005367 Ga0070667_100088912 Ga0070667_1000889122 350
80 3300005456 Ga0070678_100167732 Ga0070678_1001677322 350
81 3300005467 Ga0070706_100086665 Ga0070706_1000866652 350
82 3300005518 Ga0070699_100097103 Ga0070699_1000971033 350
83 3300005543 Ga0070672_100213761 Ga0070672_1002137612 350
84 3300005548 Ga0070665_100194339 Ga0070665_1001943393 350
85 3300005841 Ga0068863_100036699 Ga0068863_1000366994 350
86 3300005937 Ga0081455_10000301 Ga0081455_1000030147 350
87 3300006237 Ga0097621_100209061 Ga0097621_1002090612 350
88 3300006358 Ga0068871_100081937 Ga0068871_1000819372 350
89 3300006852 Ga0075433_10383184 Ga0075433_103831841 350
90 3300007076 Ga0075435_100318537 Ga0075435_1003185371 350
91 3300009177 Ga0105248_10019501 Ga0105248_100195016 350
92 3300014969 Ga0157376_10009788 Ga0157376_100097882 350
93 3300025920 Ga0207649_10072396 Ga0207649_100723962 350
94 3300025931 Ga0207644_10157046 Ga0207644_101570462 350
95 3300025941 Ga0207711_10089313 Ga0207711_100893133 350
96 3300025986 Ga0207658_10127471 Ga0207658_101274712 350
97 3300026088 Ga0207641_10057440 Ga0207641_100574402 350
98 3300027876 Ga0209974_10001269 Ga0209974_100012692 350
99 3300028379 Ga0268266_10106341 Ga0268266_101063413 350
100 3300031731 Ga0307405_10023857 Ga0307405_100238572 350
101 3300031824 Ga0307413_10047936 Ga0307413_100479362 350
102 3300031852 Ga0307410_10002163 Ga0307410_100021637 350
103 3300031901 Ga0307406_10011581 Ga0307406_100115812 350
104 3300031903 Ga0307407_10017750 Ga0307407_100177503 350
105 3300032002 Ga0307416_100001736 Ga0307416_1000017369 350
106 3300032004 Ga0307414_10187023 Ga0307414_101870231 350
107 3300032005 Ga0307411_10029653 Ga0307411_100296532 350
108 3300032126 Ga0307415_100038761 Ga0307415_1000387612 350
109 3300050515 nmdc:mga0a205_73327_c1 nmdc:mga0a205_73327_c1_227_1318 350
110 3300053730 Ga0500645_008867 Ga0500645_008867_1328_2422 350
111 3300005614 Ga0068856_100000651 Ga0068856_10000065125 351
112 3300006852 Ga0075433_10002258 Ga0075433_100022587 351
113 3300006852 Ga0075433_10161090 Ga0075433_101610902 351
114 3300006871 Ga0075434_100007193 Ga0075434_1000071937 351
115 3300006914 Ga0075436_100009802 Ga0075436_1000098023 351
116 3300006914 Ga0075436_100014216 Ga0075436_1000142164 351
117 3300007076 Ga0075435_100016384 Ga0075435_1000163843 351
118 3300007076 Ga0075435_100051543 Ga0075435_1000515433 351
119 3300007076 Ga0075435_100064308 Ga0075435_1000643082 351
120 3300007265 Ga0099794_10051874 Ga0099794_100518742 351
121 3300031616 Ga0307508_10075587 Ga0307508_100755872 351
122 3300037312 Ga0395899_0026398 Ga0395899_0026398_1200_2273 351
123 3300037418 Ga0395900_0002058 Ga0395900_0002058_7573_8646 351
124 3300037466 Ga0395898_0070934 Ga0395898_0070934_567_1640 351
125 3300037471 Ga0395905_0017219 Ga0395905_0017219_5427_6500 351
126 3300038443 Ga0395901_0024790 Ga0395901_0024790_1865_2938 351
127 3300039447 Ga0436361_0442432 Ga0436361_0442432_1841_2932 351
128 3300046472 Ga0495580_0003562 Ga0495580_0003562_6134_7228 351
129 3300050512 nmdc:mga0n895_160062_c1 nmdc:mga0n895_160062_c1_19_1092 351
130 3300050514 nmdc:mga08x19_12601_c1 nmdc:mga08x19_12601_c1_3042_4136 351
131 3300050515 nmdc:mga0a205_55797_c1 nmdc:mga0a205_55797_c1_423_1517 351
132 3300050515 nmdc:mga0a205_97735_c2 nmdc:mga0a205_97735_c2_504_1598 351
133 3300031911 Ga0307412_10246076 Ga0307412_102460761 352
134 3300037418 Ga0395900_0208361 Ga0395900_0208361_778_1854 352
135 3300005295 Ga0065707_10053455 Ga0065707_100534552 353
136 3300005981 Ga0081538_10017564 Ga0081538_100175642 353
137 3300006852 Ga0075433_10024613 Ga0075433_100246135 353
138 3300006852 Ga0075433_10066449 Ga0075433_100664493 353
139 3300006871 Ga0075434_100037869 Ga0075434_1000378693 353
140 3300007076 Ga0075435_100072520 Ga0075435_1000725202 353
141 3300009147 Ga0114129_10501636 Ga0114129_105016362 353
142 3300046472 Ga0495580_0002039 Ga0495580_0002039_4889_5968 353
143 3300050512 nmdc:mga0n895_13116_c1 nmdc:mga0n895_13116_c1_54_1160 353
144 3300050513 nmdc:mga0rr50_65831_c1 nmdc:mga0rr50_65831_c1_161_1228 353
145 3300050513 nmdc:mga0rr50_71268_c1 nmdc:mga0rr50_71268_c1_1221_2327 353
146 3300050515 nmdc:mga0a205_170_c1 nmdc:mga0a205_170_c1_1995_3101 353
147 3300050515 nmdc:mga0a205_17820_c1 nmdc:mga0a205_17820_c1_4248_5315 353
148 3300005435 Ga0070714_100001430 Ga0070714_1000014307 354
149 3300005546 Ga0070696_100064157 Ga0070696_1000641572 354
150 3300009094 Ga0111539_10058461 Ga0111539_100584613 354
151 3300025929 Ga0207664_10003605 Ga0207664_100036057 354
152 3300027907 Ga0207428_10101852 Ga0207428_101018522 354
153 3300050511 nmdc:mga08y16_103038_c1 nmdc:mga08y16_103038_c1_1544_2629 354
154 3300049570 Ga0501033_0071623 Ga0501033_0071623_733_1815 355
155 3300049572 Ga0501036_0255697 Ga0501036_0255697_367_1449 355
156 3300049575 Ga0501039_0006485 Ga0501039_0006485_7129_8211 355
157 3300049577 Ga0501041_0006414 Ga0501041_0006414_4379_5461 355
158 3300049579 Ga0501043_0019172 Ga0501043_0019172_3177_4259 355
159 3300049584 Ga0501068_0070114 Ga0501068_0070114_716_1798 355
160 3300049587 Ga0501071_0035070 Ga0501071_0035070_2063_3145 355
161 3300049588 Ga0501072_0033473 Ga0501072_0033473_358_1440 355
162 3300049592 Ga0501076_0156345 Ga0501076_0156345_549_1631 355
163 3300049593 Ga0501077_0060489 Ga0501077_0060489_848_1930 355
164 3300049742 Ga0501080_0007837 Ga0501080_0007837_7544_8626 355
165 3300049743 Ga0501081_0006047 Ga0501081_0006047_3401_4483 355
166 3300049822 Ga0501035_0039839 Ga0501035_0039839_348_1430 355
167 3300060353 Ga0501082_0023287 Ga0501082_0023287_338_1420 355
168 iso_pu_bacteria 8002392321 8002395347 355
169 3300006847 Ga0075431_100284183 Ga0075431_1002841832 356
170 3300009147 Ga0114129_10138041 Ga0114129_101380413 356
171 3300050507 nmdc:mga05p37_121758_c1 nmdc:mga05p37_121758_c1_1844_3082 356
172 3300050509 nmdc:mga0qj67_1022_c1 nmdc:mga0qj67_1022_c1_15648_16808 356
173 3300031733 Ga0316577_10115832 Ga0316577_101158322 358
174 3300037418 Ga0395900_0021299 Ga0395900_0021299_326_1411 358
175 3300049568 Ga0501031_0001408 Ga0501031_0001408_7086_8171 358
176 3300049568 Ga0501031_0154350 Ga0501031_0154350_227_1312 358
177 3300049569 Ga0501032_0048873 Ga0501032_0048873_1719_2804 358
178 3300049570 Ga0501033_0002500 Ga0501033_0002500_1071_2156 358
179 3300049571 Ga0501034_0188819 Ga0501034_0188819_474_1559 358
180 3300049572 Ga0501036_0062370 Ga0501036_0062370_1002_2087 358
181 3300049572 Ga0501036_0208434 Ga0501036_0208434_141_1226 358
182 3300049573 Ga0501037_0007892 Ga0501037_0007892_6443_7528 358
183 3300049574 Ga0501038_0012481 Ga0501038_0012481_6526_7611 358
184 3300049579 Ga0501043_0137083 Ga0501043_0137083_646_1731 358
185 3300049579 Ga0501043_0170581 Ga0501043_0170581_559_1644 358
186 3300049580 Ga0501046_0007610 Ga0501046_0007610_3075_4160 358
187 3300049581 Ga0501047_0049074 Ga0501047_0049074_2117_3202 358
188 3300049822 Ga0501035_0009092 Ga0501035_0009092_7595_8680 358
189 3300049823 Ga0501044_0002983 Ga0501044_0002983_13789_14874 358
190 3300005331 Ga0070670_100262311 Ga0070670_1002623111 360
191 3300005356 Ga0070674_100011340 Ga0070674_1000113404 360
192 3300005985 Ga0081539_10000784 Ga0081539_1000078426 360
193 3300006846 Ga0075430_100000315 Ga0075430_10000031531 360
194 3300006852 Ga0075433_10004874 Ga0075433_100048742 360
195 3300009147 Ga0114129_10050495 Ga0114129_100504952 360
196 3300014326 Ga0157380_10069490 Ga0157380_100694902 360
197 3300026121 Ga0207683_10062361 Ga0207683_100623613 360
198 3300049572 Ga0501036_0066090 Ga0501036_0066090_1127_2227 360
199 3300049574 Ga0501038_0036943 Ga0501038_0036943_1346_2446 360
200 3300049575 Ga0501039_0023428 Ga0501039_0023428_2391_3491 360
201 3300049576 Ga0501040_0013581 Ga0501040_0013581_2374_3474 360
202 3300049577 Ga0501041_0022414 Ga0501041_0022414_2518_3618 360
203 3300049578 Ga0501042_0016114 Ga0501042_0016114_1014_2114 360
204 3300049580 Ga0501046_0048304 Ga0501046_0048304_2140_3240 360
205 3300049586 Ga0501070_0290472 Ga0501070_0290472_132_1232 360
206 3300049588 Ga0501072_0055719 Ga0501072_0055719_266_1366 360
207 3300049589 Ga0501073_0087635 Ga0501073_0087635_640_1740 360
208 3300049591 Ga0501075_0020279 Ga0501075_0020279_855_1955 360
209 3300049592 Ga0501076_0039054 Ga0501076_0039054_1667_2767 360
210 3300049744 Ga0501083_0079273 Ga0501083_0079273_22_1122 360
211 3300049822 Ga0501035_0092136 Ga0501035_0092136_833_1933 360
212 3300049824 Ga0501045_0029212 Ga0501045_0029212_1325_2425 360
213 3300050509 nmdc:mga0qj67_188_c1 nmdc:mga0qj67_188_c1_4825_5922 360
214 3300054114 Ga0501084_0059627 Ga0501084_0059627_213_1313 360
215 3300005985 Ga0081539_10020604 Ga0081539_100206042 361
216 3300037312 Ga0395899_0006270 Ga0395899_0006270_131_1240 361
217 3300005436 Ga0070713_100067933 Ga0070713_1000679331 362
218 3300005436 Ga0070713_100219846 Ga0070713_1002198461 362
219 3300006028 Ga0070717_10120513 Ga0070717_101205132 362
220 3300025928 Ga0207700_10300367 Ga0207700_103003672 362
221 3300035117 Ga0373953_0027218 Ga0373953_0027218_834_1952 362
222 3300035692 Ga0373935_0086731 Ga0373935_0086731_281_1399 362
223 3300036401 Ga0373937_0012613 Ga0373937_0012613_1610_2728 362
224 3300037068 Ga0373925_0337930 Ga0373925_0337930_86_1195 362
225 3300009093 Ga0105240_10250865 Ga0105240_102508652 363
226 3300049570 Ga0501033_0025972 Ga0501033_0025972_2559_3677 364
227 3300049822 Ga0501035_0250989 Ga0501035_0250989_71_1189 364
228 3300049823 Ga0501044_0050414 Ga0501044_0050414_919_2034 364
229 iso_pu_bacteria 2929212328 2929214628 372
230 3300031903 Ga0307407_10140401 Ga0307407_101404011 375
231 3300032126 Ga0307415_100280746 Ga0307415_1002807462 375
232 3300000549 LJQas_1000066 LJQas_10000666 376
233 3300006048 Ga0075363_100000072 Ga0075363_10000007211 376
234 3300044658 Ga0466972_0004335 Ga0466972_0004335_5426_6586 376
235 3300044901 Ga0466960_0000566 Ga0466960_0000566_3817_4977 376
236 3300044901 Ga0466960_0066315 Ga0466960_0066315_404_1549 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

25

219

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

103

256

0.83

PF08402

TOBE_2

TOBE domain

334

405

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9275 2 256
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9215 2 376
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9173 2 376
1ebd-assembly1.cif.gz_B dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase 0.9158 322 350
6bz0-assembly2.cif.gz_C 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. 0.9158 322 350
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9544 2 240 3.40.50.300
3d31A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9452 1 258 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9438 1 258 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9414 1 259 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9395 2 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.96 59 214 GO:0005524
GO:0016887
GO:0055052
AF-A0A257XML9-F1-model_v4 Iron ABC transporter ATP-binding protein 0.9487 2 214 GO:0005524
GO:0016887
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9469 59 214 GO:0005524
GO:0016887
GO:0055052
AF-A0A382FBJ4-F1-model_v4 ABC transporter domain-containing protein 0.9425 94 238 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A357JJL3-F1-model_v4 ABC transporter domain-containing protein 0.9399 1 215 GO:0005524
GO:0005886
GO:0015408
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.92 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map