F347733

General Info

Members Datasets Scaffolds Average Seq Length
235 163 470 270

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10117047|Ga0065707_101170471
Length 274
Sequence MKVGRGELLAGQAFLLSLMAITILPFISIFTTALHPSGTVPSGLEWPADPQWGNFVEAFNVANMTALLASSTFIVIAVVPVSLIISTMAAFAIGLLRIPGSRVLLFLFVFGLTLPFGGIIVPLYYLERAMGIYNTRLAIVLPLIALYMPFAVFWMRAHFVNMQAEISEAARVDGATTWDLFWRIHLPLARAPIASLGILMSVWTWNQFLLALVLVEDPTQRTMAGALGAFQGHYATDVPLLSAGTILILVPTLVVFVLFQRQIITALLQGSVKG

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
81 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.43
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 10.21
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 4.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10117047 3300005295 Bacteria 2221
2 Ga0068869_100224368 3300005334 Bacteria 1491
3 Ga0070687_100227787 3300005343 Unclassified 1145
4 Ga0070692_10010254 3300005345 Bacteria 4258
5 Ga0070674_100012762 3300005356 Bacteria 5169
6 Ga0070673_100168703 3300005364 Bacteria 1867
7 Ga0070667_100449707 3300005367 Bacteria 1177
8 Ga0070714_100004966 3300005435 Bacteria 10110
9 Ga0070705_100074893 3300005440 Bacteria 2059
10 Ga0070694_100021069 3300005444 Bacteria 4161
11 Ga0070708_100000714 3300005445 Bacteria 25242
12 Ga0070708_100003197 3300005445 Bacteria 12776
13 Ga0070681_10070201 3300005458 Bacteria 3469
14 Ga0070706_100000306 3300005467 Bacteria 59517
15 Ga0070706_100000826 3300005467 Bacteria 34231
16 Ga0070706_100004085 3300005467 Bacteria 14193
17 Ga0070707_100001691 3300005468 Bacteria 21282
18 Ga0070707_100136444 3300005468 Bacteria 2387
19 Ga0070698_100000210 3300005471 Bacteria 56590
20 Ga0070699_100004400 3300005518 Bacteria 12454
21 Ga0070679_100052643 3300005530 Bacteria 4053
22 Ga0070697_100012745 3300005536 Bacteria 6584
23 Ga0070697_100216102 3300005536 Bacteria 1633
24 Ga0070695_100173722 3300005545 Bacteria 1522
25 Ga0070696_100039026 3300005546 Bacteria 3279
26 Ga0070696_100108559 3300005546 Bacteria 1996
27 Ga0070693_100050124 3300005547 Bacteria 2385
28 Ga0070704_100160592 3300005549 Bacteria 1777
29 Ga0070664_100036656 3300005564 Bacteria 4120
30 Ga0070664_100168030 3300005564 Bacteria 1944
31 Ga0068857_100212898 3300005577 Bacteria 1764
32 Ga0068854_100508890 3300005578 Bacteria 1015
33 Ga0068859_100431551 3300005617 Bacteria 1414
34 Ga0068859_100772520 3300005617 Bacteria 1049
35 Ga0068864_100110779 3300005618 Bacteria 2445
36 Ga0068864_100126172 3300005618 Bacteria 2294
37 Ga0068866_10094570 3300005718 Bacteria 1635
38 Ga0068863_100699659 3300005841 Unclassified 1007
39 Ga0068860_100003718 3300005843 Bacteria 15687
40 Ga0068860_100261189 3300005843 Bacteria 1688
41 Ga0068862_100018962 3300005844 Bacteria 5734
42 Ga0081539_10001993 3300005985 Bacteria 31016
43 Ga0075365_10053975 3300006038 Bacteria 2663
44 Ga0075363_100108389 3300006048 Bacteria 1542
45 Ga0070716_100012266 3300006173 Bacteria 4340
46 Ga0068871_100058767 3300006358 Bacteria 3131
47 Ga0075428_100338286 3300006844 Bacteria 1616
48 Ga0075428_100615920 3300006844 Bacteria 1159
49 Ga0075433_10158642 3300006852 Bacteria 2013
50 Ga0075433_10309205 3300006852 Bacteria 1399
51 Ga0075433_10315750 3300006852 Bacteria 1383
52 Ga0075434_100365905 3300006871 Bacteria 1463
53 Ga0075429_100137679 3300006880 Bacteria 2137
54 Ga0068865_100251871 3300006881 Bacteria 1394
55 Ga0075436_100159277 3300006914 Bacteria 1591
56 Ga0097620_100431535 3300006931 Bacteria 1414
57 Ga0097620_100772640 3300006931 Bacteria 1049
58 Ga0111539_10014867 3300009094 Bacteria 9705
59 Ga0105245_10140428 3300009098 Bacteria 2274
60 Ga0114129_10058294 3300009147 Bacteria 5402
61 Ga0114129_10065613 3300009147 Bacteria 5066
62 Ga0114129_10115028 3300009147 Bacteria 3709
63 Ga0114129_10194430 3300009147 Bacteria 2752
64 Ga0105243_10067951 3300009148 Bacteria 2871
65 Ga0105243_10147799 3300009148 Unclassified 2013
66 Ga0105243_10786577 3300009148 Bacteria 936
67 Ga0105242_10036252 3300009176 Bacteria 3956
68 Ga0105248_10297757 3300009177 Bacteria 1816
69 Ga0105248_10308156 3300009177 Bacteria 1783
70 Ga0105249_10029590 3300009553 Bacteria 4948
71 Ga0105249_10066741 3300009553 Bacteria 3313
72 Ga0105249_10168316 3300009553 Bacteria 2123
73 Ga0105249_10289726 3300009553 Bacteria 1638
74 Ga0105246_10024579 3300011119 Unclassified 3916
75 Ga0157378_10366300 3300013297 Bacteria 1412
76 Ga0163163_10144708 3300014325 Bacteria 2420
77 Ga0157380_10080644 3300014326 Bacteria 2660
78 Ga0157379_10416826 3300014968 Bacteria 1236
79 Ga0157376_10762165 3300014969 Bacteria 978
80 Ga0163161_10518532 3300017792 Bacteria 973
81 Ga0207684_10000074 3300025910 Bacteria 183469
82 Ga0207684_10000418 3300025910 Bacteria 56722
83 Ga0207684_10005712 3300025910 Bacteria 11427
84 Ga0207707_10117774 3300025912 Bacteria 2322
85 Ga0207695_10380520 3300025913 Bacteria 1297
86 Ga0207660_10032317 3300025917 Bacteria 3612
87 Ga0207660_10293150 3300025917 Bacteria 1294
88 Ga0207646_10001633 3300025922 Bacteria 27378
89 Ga0207646_10044408 3300025922 Bacteria 3989
90 Ga0207646_10130487 3300025922 Bacteria 2262
91 Ga0207706_10112263 3300025933 Bacteria 2398
92 Ga0207709_10319944 3300025935 Bacteria 1161
93 Ga0207709_10447171 3300025935 Bacteria 998
94 Ga0207669_10085533 3300025937 Bacteria 2036
95 Ga0207665_10020142 3300025939 Bacteria 4381
96 Ga0207689_10170115 3300025942 Bacteria 1796
97 Ga0207679_10112400 3300025945 Bacteria 2153
98 Ga0207712_10023872 3300025961 Bacteria 4042
99 Ga0207712_10035106 3300025961 Bacteria 3403
100 Ga0207639_10093061 3300026041 Bacteria 2416
101 Ga0207708_10176832 3300026075 Bacteria 1693
102 Ga0207641_10602203 3300026088 Unclassified 1076
103 Ga0207674_10494248 3300026116 Bacteria 1182
104 Ga0207683_10017923 3300026121 Bacteria 6038
105 Ga0209974_10008533 3300027876 Bacteria 3502
106 Ga0268265_10025311 3300028380 Bacteria 4210
107 Ga0268265_10056763 3300028380 Bacteria 2981
108 Ga0268265_10408463 3300028380 Bacteria 1257
109 Ga0268264_10029672 3300028381 Bacteria 4482
110 Ga0265334_10020691 3300028573 Bacteria 2694
111 Ga0265318_10002641 3300028577 Bacteria 9457
112 Ga0265323_10021303 3300028653 Bacteria 2485
113 Ga0265322_10000751 3300028654 Bacteria 11797
114 Ga0265338_10053563 3300028800 Bacteria 3607
115 Ga0265328_10069001 3300031239 Bacteria 1299
116 Ga0265320_10030035 3300031240 Bacteria 2807
117 Ga0265329_10003908 3300031242 Bacteria 6380
118 Ga0265340_10010638 3300031247 Bacteria 4918
119 Ga0265331_10012835 3300031250 Bacteria 4522
120 Ga0265316_10000459 3300031344 Bacteria 46276
121 Ga0265313_10063682 3300031595 Bacteria 1718
122 Ga0316579_10002730 3300031691 Bacteria 6730
123 Ga0316579_10034319 3300031691 Bacteria 2334
124 Ga0265342_10000243 3300031712 Bacteria 61174
125 Ga0316576_10021542 3300031727 Bacteria 4460
126 Ga0316578_10091836 3300031728 Bacteria 1814
127 Ga0307405_10000814 3300031731 Bacteria 12259
128 Ga0316577_10002635 3300031733 Bacteria 8909
129 Ga0316577_10093909 3300031733 Bacteria 1679
130 Ga0307413_10068364 3300031824 Bacteria 2225
131 Ga0307410_10170440 3300031852 Bacteria 1640
132 Ga0307416_100001364 3300032002 Bacteria 13178
133 Ga0307416_100519600 3300032002 Bacteria 1258
134 Ga0307415_100000038 3300032126 Bacteria 57023
135 Ga0307415_100012826 3300032126 Bacteria 4864
136 Ga0316585_10017554 3300032137 Bacteria 2164
137 Ga0316593_10013582 3300032168 Bacteria 2414
138 Ga0316574_0003027 3300035398 Bacteria 8567
139 Ga0373933_0191623 3300035724 Bacteria 1306
140 Ga0316582_0014599 3300036647 Bacteria 4464
141 Ga0316582_0025881 3300036647 Unclassified 3528
142 Ga0316582_0262631 3300036647 Unclassified 1184
143 Ga0316584_0031885 3300036712 Bacteria 3897
144 Ga0316584_0150879 3300036712 Bacteria 1730
145 Ga0395900_0148370 3300037418 Bacteria 2397
146 Ga0395898_0094619 3300037466 Bacteria 2871
147 Ga0316581_0044003 3300037588 Bacteria 1363
148 Ga0395901_0035545 3300038443 Bacteria 5148
149 Ga0451802_0609212 3300041460 Bacteria 932
150 Ga0451853_0310043 3300041512 Bacteria 1132
151 Ga0451853_2706726 3300041512 Bacteria 980
152 Ga0451577_0032233 3300042876 Bacteria 4721
153 Ga0451577_0087656 3300042876 Bacteria 2776
154 Ga0451577_0261881 3300042876 Bacteria 1566
155 Ga0453683_0005587 3300044673 Bacteria 8743
156 Ga0453683_0083171 3300044673 Bacteria 2006
157 Ga0453683_0122560 3300044673 Unclassified 1637
158 Ga0453683_0125303 3300044673 Unclassified 1617
159 Ga0453684_0000055 3300044712 Bacteria 532014
160 Ga0453684_0066795 3300044712 Bacteria 4577
161 Ga0453684_0197036 3300044712 Bacteria 2351
162 Ga0453684_0222771 3300044712 Bacteria 2184
163 Ga0453684_0297892 3300044712 Bacteria 1834
164 Ga0453684_0713476 3300044712 Bacteria 1089
165 Ga0453684_0872810 3300044712 Bacteria 965
166 Ga0451576_0053848 3300045051 Bacteria 4213
167 Ga0451576_0060786 3300045051 Unclassified 3941
168 Ga0451576_0123252 3300045051 Bacteria 2699
169 Ga0451576_0214998 3300045051 Bacteria 2008
170 Ga0451576_0669670 3300045051 Bacteria 1090
171 Ga0495629_0199477 3300046459 Bacteria 1384
172 Ga0495652_0443020 3300046529 Bacteria 911
173 Ga0495646_0293862 3300046680 Bacteria 861
174 Ga0495675_0294203 3300047444 Bacteria 966
175 Ga0495593_0198428 3300047673 Bacteria 1009
176 Ga0496100_0139336 3300048903 Bacteria 1717
177 Ga0496101_0095264 3300048904 Bacteria 2220
178 Ga0496102_0037860 3300048905 Bacteria 4351
179 Ga0496104_0004862 3300048907 Bacteria 11707
180 Ga0496104_0072628 3300048907 Bacteria 3272
181 Ga0496105_0022389 3300048908 Bacteria 5117
182 Ga0496105_0037070 3300048908 Bacteria 4017
183 Ga0496106_0025495 3300048909 Bacteria 4401
184 Ga0496106_0132828 3300048909 Bacteria 1953
185 Ga0496107_0135279 3300048910 Bacteria 1821
186 Ga0496108_0097327 3300048911 Bacteria 2507
187 Ga0496108_0105276 3300048911 Bacteria 2408
188 Ga0496109_0018122 3300048912 Bacteria 6183
189 Ga0496109_0088217 3300048912 Bacteria 2866
190 Ga0496109_0105942 3300048912 Bacteria 2611
191 Ga0496109_0469973 3300048912 Bacteria 1188
192 Ga0496110_0004758 3300048913 Bacteria 10571
193 Ga0496110_0064787 3300048913 Bacteria 3230
194 Ga0496111_0315287 3300048914 Bacteria 1158
195 Ga0496112_0025997 3300048915 Bacteria 5626
196 Ga0496113_0062581 3300048916 Bacteria 2810
197 Ga0496114_0010723 3300048917 Bacteria 7293
198 Ga0496114_0056497 3300048917 Bacteria 3276
199 Ga0496125_0001812 3300048928 Bacteria 29494
200 Ga0501034_0033571 3300049571 Bacteria 5205
201 Ga0501036_0116453 3300049572 Bacteria 2257
202 Ga0501037_0070820 3300049573 Bacteria 2537
203 Ga0501038_0070149 3300049574 Bacteria 2976
204 Ga0501039_0073700 3300049575 Bacteria 2652
205 Ga0501039_0269153 3300049575 Bacteria 1339
206 Ga0501040_0014508 3300049576 Bacteria 5193
207 Ga0501042_0037560 3300049578 Bacteria 3437
208 Ga0501067_0019789 3300049583 Bacteria 3726
209 Ga0501069_0013912 3300049585 Bacteria 4297
210 Ga0501069_0039317 3300049585 Bacteria 2613
211 Ga0501074_0098821 3300049590 Bacteria 2089
212 Ga0501075_0122379 3300049591 Bacteria 1980
213 Ga0501076_0270126 3300049592 Bacteria 1392
214 Ga0501261_012260 3300049690 Bacteria 1152
215 Ga0501080_0255854 3300049742 Bacteria 1596
216 Ga0501081_0101553 3300049743 Bacteria 2034
217 Ga0501035_0072234 3300049822 Bacteria 3055
218 Ga0501044_0386525 3300049823 Bacteria 1314
219 Ga0501045_0227928 3300049824 Bacteria 1387
220 nmdc:mga0yw44_246075_c1 3300050492 Bacteria 1189
221 nmdc:mga05p37_266342_c1 3300050507 Bacteria 2049
222 nmdc:mga05p37_404839_c1 3300050507 Bacteria 1592
223 nmdc:mga05p37_447926_c1 3300050507 Bacteria 1495
224 nmdc:mga05p37_82708_c2 3300050507 Bacteria 3047
225 nmdc:mga09592_77260_c1 3300050508 Bacteria 2832
226 nmdc:mga06r32_126463_c1 3300050510 Bacteria 2525
227 nmdc:mga0a205_139628_c1 3300050515 Bacteria 2323
228 nmdc:mga0a205_160745_c1 3300050515 Bacteria 2143
229 nmdc:mga0a205_214970_c1 3300050515 Bacteria 1810
230 nmdc:mga0a205_301501_c1 3300050515 Unclassified 1475
231 Ga0495612_0023942 3300053078 Bacteria 2451
232 Ga0495619_0011291 3300053085 Bacteria 5620
233 Ga0501084_0026995 3300054114 Bacteria 4797
234 Ga0530510_0182866 3300061734 Bacteria 1555
235 2808884227 2808606368 Bacteria 3174172
236 Ga0065707_10117047
237 Ga0068869_100224368
238 Ga0070687_100227787
239 Ga0070692_10010254
240 Ga0070674_100012762
241 Ga0070673_100168703
242 Ga0070667_100449707
243 Ga0070714_100004966
244 Ga0070705_100074893
245 Ga0070694_100021069
246 Ga0070708_100000714
247 Ga0070708_100003197
248 Ga0070681_10070201
249 Ga0070706_100000306
250 Ga0070706_100000826
251 Ga0070706_100004085
252 Ga0070707_100001691
253 Ga0070707_100136444
254 Ga0070698_100000210
255 Ga0070699_100004400
256 Ga0070679_100052643
257 Ga0070697_100012745
258 Ga0070697_100216102
259 Ga0070695_100173722
260 Ga0070696_100039026
261 Ga0070696_100108559
262 Ga0070693_100050124
263 Ga0070704_100160592
264 Ga0070664_100036656
265 Ga0070664_100168030
266 Ga0068857_100212898
267 Ga0068854_100508890
268 Ga0068859_100431551
269 Ga0068859_100772520
270 Ga0068864_100110779
271 Ga0068864_100126172
272 Ga0068866_10094570
273 Ga0068863_100699659
274 Ga0068860_100003718
275 Ga0068860_100261189
276 Ga0068862_100018962
277 Ga0081539_10001993
278 Ga0075365_10053975
279 Ga0075363_100108389
280 Ga0070716_100012266
281 Ga0068871_100058767
282 Ga0075428_100338286
283 Ga0075428_100615920
284 Ga0075433_10158642
285 Ga0075433_10309205
286 Ga0075433_10315750
287 Ga0075434_100365905
288 Ga0075429_100137679
289 Ga0068865_100251871
290 Ga0075436_100159277
291 Ga0097620_100431535
292 Ga0097620_100772640
293 Ga0111539_10014867
294 Ga0105245_10140428
295 Ga0114129_10058294
296 Ga0114129_10065613
297 Ga0114129_10115028
298 Ga0114129_10194430
299 Ga0105243_10067951
300 Ga0105243_10147799
301 Ga0105243_10786577
302 Ga0105242_10036252
303 Ga0105248_10297757
304 Ga0105248_10308156
305 Ga0105249_10029590
306 Ga0105249_10066741
307 Ga0105249_10168316
308 Ga0105249_10289726
309 Ga0105246_10024579
310 Ga0157378_10366300
311 Ga0163163_10144708
312 Ga0157380_10080644
313 Ga0157379_10416826
314 Ga0157376_10762165
315 Ga0163161_10518532
316 Ga0207684_10000074
317 Ga0207684_10000418
318 Ga0207684_10005712
319 Ga0207707_10117774
320 Ga0207695_10380520
321 Ga0207660_10032317
322 Ga0207660_10293150
323 Ga0207646_10001633
324 Ga0207646_10044408
325 Ga0207646_10130487
326 Ga0207706_10112263
327 Ga0207709_10319944
328 Ga0207709_10447171
329 Ga0207669_10085533
330 Ga0207665_10020142
331 Ga0207689_10170115
332 Ga0207679_10112400
333 Ga0207712_10023872
334 Ga0207712_10035106
335 Ga0207639_10093061
336 Ga0207708_10176832
337 Ga0207641_10602203
338 Ga0207674_10494248
339 Ga0207683_10017923
340 Ga0209974_10008533
341 Ga0268265_10025311
342 Ga0268265_10056763
343 Ga0268265_10408463
344 Ga0268264_10029672
345 Ga0265334_10020691
346 Ga0265318_10002641
347 Ga0265323_10021303
348 Ga0265322_10000751
349 Ga0265338_10053563
350 Ga0265328_10069001
351 Ga0265320_10030035
352 Ga0265329_10003908
353 Ga0265340_10010638
354 Ga0265331_10012835
355 Ga0265316_10000459
356 Ga0265313_10063682
357 Ga0316579_10002730
358 Ga0316579_10034319
359 Ga0265342_10000243
360 Ga0316576_10021542
361 Ga0316578_10091836
362 Ga0307405_10000814
363 Ga0316577_10002635
364 Ga0316577_10093909
365 Ga0307413_10068364
366 Ga0307410_10170440
367 Ga0307416_100001364
368 Ga0307416_100519600
369 Ga0307415_100000038
370 Ga0307415_100012826
371 Ga0316585_10017554
372 Ga0316593_10013582
373 Ga0316574_0003027
374 Ga0373933_0191623
375 Ga0316582_0014599
376 Ga0316582_0025881
377 Ga0316582_0262631
378 Ga0316584_0031885
379 Ga0316584_0150879
380 Ga0395900_0148370
381 Ga0395898_0094619
382 Ga0316581_0044003
383 Ga0395901_0035545
384 Ga0451802_0609212
385 Ga0451853_0310043
386 Ga0451853_2706726
387 Ga0451577_0032233
388 Ga0451577_0087656
389 Ga0451577_0261881
390 Ga0453683_0005587
391 Ga0453683_0083171
392 Ga0453683_0122560
393 Ga0453683_0125303
394 Ga0453684_0000055
395 Ga0453684_0066795
396 Ga0453684_0197036
397 Ga0453684_0222771
398 Ga0453684_0297892
399 Ga0453684_0713476
400 Ga0453684_0872810
401 Ga0451576_0053848
402 Ga0451576_0060786
403 Ga0451576_0123252
404 Ga0451576_0214998
405 Ga0451576_0669670
406 Ga0495629_0199477
407 Ga0495652_0443020
408 Ga0495646_0293862
409 Ga0495675_0294203
410 Ga0495593_0198428
411 Ga0496100_0139336
412 Ga0496101_0095264
413 Ga0496102_0037860
414 Ga0496104_0004862
415 Ga0496104_0072628
416 Ga0496105_0022389
417 Ga0496105_0037070
418 Ga0496106_0025495
419 Ga0496106_0132828
420 Ga0496107_0135279
421 Ga0496108_0097327
422 Ga0496108_0105276
423 Ga0496109_0018122
424 Ga0496109_0088217
425 Ga0496109_0105942
426 Ga0496109_0469973
427 Ga0496110_0004758
428 Ga0496110_0064787
429 Ga0496111_0315287
430 Ga0496112_0025997
431 Ga0496113_0062581
432 Ga0496114_0010723
433 Ga0496114_0056497
434 Ga0496125_0001812
435 Ga0501034_0033571
436 Ga0501036_0116453
437 Ga0501037_0070820
438 Ga0501038_0070149
439 Ga0501039_0073700
440 Ga0501039_0269153
441 Ga0501040_0014508
442 Ga0501042_0037560
443 Ga0501067_0019789
444 Ga0501069_0013912
445 Ga0501069_0039317
446 Ga0501074_0098821
447 Ga0501075_0122379
448 Ga0501076_0270126
449 Ga0501261_012260
450 Ga0501080_0255854
451 Ga0501081_0101553
452 Ga0501035_0072234
453 Ga0501044_0386525
454 Ga0501045_0227928
455 nmdc:mga0yw44_246075_c1
456 nmdc:mga05p37_266342_c1
457 nmdc:mga05p37_404839_c1
458 nmdc:mga05p37_447926_c1
459 nmdc:mga05p37_82708_c2
460 nmdc:mga09592_77260_c1
461 nmdc:mga06r32_126463_c1
462 nmdc:mga0a205_139628_c1
463 nmdc:mga0a205_160745_c1
464 nmdc:mga0a205_214970_c1
465 nmdc:mga0a205_301501_c1
466 Ga0495612_0023942
467 Ga0495619_0011291
468 Ga0501084_0026995
469 Ga0530510_0182866
470 2808884227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

86

265

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.7839 4 264
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.7836 8 263
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7835 2 261
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7806 4 270
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.7804 2 263
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8229 9 264 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8207 9 261 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8179 5 264 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8061 5 264 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8014 5 264 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A087CQU2-F1-model_v4 ABC-type sugar transport system, permease component 0.894 1 273 GO:0005886
GO:0055085
AF-A0A850DDP7-F1-model_v4 deleted 0.8932 1 256
AF-A0A850DDP7-F1-model_v4 deleted 0.8899 1 256
AF-A0A5N8XGB2-F1-model_v4 Carbohydrate ABC transporter permease 0.889 15 274 GO:0005886
GO:0055085
AF-A0A087CQU2-F1-model_v4 ABC-type sugar transport system, permease component 0.8879 1 273 GO:0005886
GO:0055085

Map