F347223

General Info

Members Datasets Scaffolds Average Seq Length
234 173 468 295

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10000047|Ga0307515_10000047190
Length 313
Sequence MDGKIVGAALVSHHPGLMQCEEFRVLQGAGEDSDLIAGYARLRQKIAEAAPQAVMIFDSHWFTTGYHLVDGGERYSGTYISDEMPWYLHGVPYDYRGHPGLAALVEAVSRERGGYDRAIAHPDLGRHYATINLVKQLRLEQAGLPVVTVSSCQNCDWRHFLTSGEAIGEAIRRSGLRVLLLASGALSHKFNNIDWKPNHPRIFHESNVSRPENIESDKGAIELFLQGRHDQVIERWDGEYRKLPWEAFGAHYLQMIGAMGGKDCTAPGEPLSAYENARGTGNIHIWFDTQPHLREDMSGAPSEFGLTMQKVAA

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
105 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
106 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
158 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 2547132374 Acidovorax radicis N35 Isolate Unclassified
162 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
163 2643221596 Acidovorax sp. Root70 Isolate Unclassified
164 2643221609 Acidovorax sp. Root217 Isolate Unclassified
165 2643221611 Acidovorax sp. Root219 Isolate Unclassified
166 2643221717 Acidovorax sp. Root267 Isolate Unclassified
167 2738543012 Acidovorax sp. CF301 Isolate Unclassified
168 2816332133 Acidovorax radicis 2721A Isolate Unclassified
169 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
170 2842733646 Variovorax sp. R-72446 Isolate Unclassified
171 2842747753 Variovorax sp. R-72060 Isolate Unclassified
172 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
173 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.59
Metatranscriptomes 0.43
Isolates 5.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.81
Nodule 0
Rhizoplane 0.85
Rhizosphere 58.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10000047 3300028794 Bacteria 291475
2 JGI24739J22299_10001680 3300001989 Bacteria 8404
3 JGI25152J39213_1001325 3300002773 Bacteria 10968
4 JGI25159J45721_1008393 3300002987 Bacteria 2839
5 JGI25151J46595_10002013 3300003187 Bacteria 12719
6 JGI25153J46596_10001798 3300003215 Bacteria 12719
7 rootH1_10015038 3300003316 Bacteria 4584
8 rootH1_10033302 3300003316 Bacteria 27746
9 rootL2_10144749 3300003322 Bacteria 1479
10 JGI25160J50197_1027269 3300003354 Bacteria 1558
11 Ga0006562J51391_1061767 3300003578 Bacteria 9500
12 Ga0055539_1000015 3300003752 Bacteria 376599
13 Ga0055533_1000018 3300003756 Bacteria 376599
14 Ga0055525_1000020 3300003759 Bacteria 376599
15 Ga0055526_1002677 3300003771 Bacteria 11897
16 Ga0055536_1001094 3300003781 Bacteria 17041
17 Ga0055530_10002212 3300003791 Bacteria 12851
18 Ga0055540_1000833 3300003792 Bacteria 20742
19 Ga0055531_10001120 3300003794 Bacteria 20754
20 Ga0055541_1000011 3300003841 Bacteria 376599
21 Ga0065165_1003222 3300005262 Bacteria 11881
22 Ga0070670_100016037 3300005331 Bacteria 6430
23 Ga0068869_100014577 3300005334 Bacteria 5255
24 Ga0070669_100025215 3300005353 Bacteria 4270
25 Ga0070662_100000952 3300005457 Bacteria 17734
26 Ga0070706_100202223 3300005467 Bacteria 1855
27 Ga0068853_100083361 3300005539 Bacteria 2801
28 Ga0068853_100166299 3300005539 Bacteria 1993
29 Ga0068855_100086222 3300005563 Bacteria 3631
30 Ga0070664_100007556 3300005564 Bacteria 8776
31 Ga0068852_100009833 3300005616 Bacteria 7115
32 Ga0068859_100026333 3300005617 Bacteria 5831
33 Ga0068863_100001319 3300005841 Bacteria 24710
34 Ga0068860_100001126 3300005843 Bacteria 29403
35 Ga0068860_100209559 3300005843 Bacteria 1890
36 Ga0068862_100002005 3300005844 Bacteria 18468
37 Ga0097620_100026332 3300006931 Bacteria 5831
38 Ga0105244_10000510 3300009036 Bacteria 34754
39 Ga0105240_10050951 3300009093 Bacteria 5213
40 Ga0105247_10033340 3300009101 Bacteria 3132
41 Ga0105243_10025713 3300009148 Bacteria 4502
42 Ga0105241_10024125 3300009174 Bacteria 4516
43 Ga0105237_10104620 3300009545 Bacteria 2822
44 Ga0105249_10000543 3300009553 Bacteria 34906
45 Ga0105239_10037390 3300010375 Bacteria 5322
46 Ga0105246_10197205 3300011119 Bacteria 1562
47 Ga0157380_10005342 3300014326 Bacteria 8976
48 Ga0182008_10001106 3300014497 Bacteria 18562
49 Ga0157376_10000620 3300014969 Bacteria 22978
50 Ga0213872_10006916 3300021361 Bacteria 5644
51 Ga0209784_100025 3300025224 Bacteria 376681
52 Ga0209566_100025 3300025225 Bacteria 376681
53 Ga0209674_100042 3300025226 Bacteria 376681
54 Ga0209563_100046 3300025230 Bacteria 376681
55 Ga0207425_1000910 3300025245 Bacteria 14190
56 Ga0209677_100027 3300025253 Bacteria 376681
57 Ga0209129_1001408 3300025258 Bacteria 13464
58 Ga0209130_1001777 3300025284 Bacteria 12694
59 Ga0209676_1000004 3300025292 Bacteria 1138360
60 Ga0209025_1000291 3300025294 Bacteria 112755
61 Ga0209025_1004413 3300025294 Bacteria 12242
62 Ga0209564_1000621 3300025295 Bacteria 54266
63 Ga0209758_1003534 3300025297 Bacteria 14084
64 Ga0209050_1000002 3300025298 Bacteria 1792849
65 Ga0207426_1002303 3300025302 Bacteria 12560
66 Ga0209051_1000002 3300025303 Bacteria 1631846
67 Ga0209257_1000002 3300025304 Bacteria 1767052
68 Ga0207655_1004190 3300025728 Bacteria 10347
69 Ga0207710_10002770 3300025900 Bacteria 8011
70 Ga0207647_10007684 3300025904 Bacteria 7767
71 Ga0207684_10138401 3300025910 Bacteria 2092
72 Ga0207654_10105444 3300025911 Bacteria 1744
73 Ga0207695_10085778 3300025913 Bacteria 3177
74 Ga0207681_10003007 3300025923 Bacteria 10599
75 Ga0207706_10020791 3300025933 Bacteria 5895
76 Ga0207709_10011663 3300025935 Bacteria 4844
77 Ga0207679_10004047 3300025945 Bacteria 9107
78 Ga0207712_10000388 3300025961 Bacteria 38208
79 Ga0207677_10122061 3300026023 Bacteria 1962
80 Ga0207639_10049758 3300026041 Bacteria 3179
81 Ga0207641_10002050 3300026088 Bacteria 19167
82 Ga0207698_10006706 3300026142 Bacteria 7194
83 Ga0268265_10000121 3300028380 Bacteria 97688
84 Ga0307515_10000178 3300028794 Bacteria 157107
85 Ga0307515_10000672 3300028794 Bacteria 78835
86 Ga0307515_10001013 3300028794 Bacteria 64205
87 Ga0307515_10001836 3300028794 Bacteria 47333
88 Ga0307515_10003361 3300028794 Bacteria 33757
89 Ga0307515_10065808 3300028794 Bacteria 5034
90 Ga0307515_10127061 3300028794 Bacteria 2838
91 Ga0307512_10076027 3300030522 Bacteria 2452
92 Ga0307512_10089763 3300030522 Bacteria 2148
93 Ga0307513_10041072 3300031456 Bacteria 5109
94 Ga0307513_10084654 3300031456 Bacteria 3256
95 Ga0307509_10002620 3300031507 Bacteria 28791
96 Ga0307509_10003530 3300031507 Bacteria 23571
97 Ga0307509_10175613 3300031507 Bacteria 2015
98 Ga0307408_100018968 3300031548 Bacteria 4625
99 Ga0307408_100033162 3300031548 Bacteria 3605
100 Ga0307408_100223389 3300031548 Bacteria 1538
101 Ga0307408_100318666 3300031548 Bacteria 1309
102 Ga0307508_10000130 3300031616 Bacteria 89085
103 Ga0307508_10000155 3300031616 Bacteria 82771
104 Ga0307508_10169123 3300031616 Bacteria 1789
105 Ga0307514_10002433 3300031649 Bacteria 19409
106 Ga0307514_10002450 3300031649 Bacteria 19295
107 Ga0307516_10000286 3300031730 Bacteria 65447
108 Ga0307516_10031704 3300031730 Bacteria 5327
109 Ga0307516_10216317 3300031730 Bacteria 1628
110 Ga0307516_10281988 3300031730 Bacteria 1343
111 Ga0307405_10059437 3300031731 Bacteria 2409
112 Ga0307405_10191698 3300031731 Bacteria 1477
113 Ga0307412_10150164 3300031911 Bacteria 1718
114 Ga0307416_100221190 3300032002 Bacteria 1816
115 Ga0307414_10201173 3300032004 Bacteria 1620
116 Ga0307411_10048493 3300032005 Bacteria 2753
117 Ga0307411_10162117 3300032005 Bacteria 1676
118 Ga0307510_10029604 3300033180 Bacteria 6227
119 Ga0307510_10051601 3300033180 Bacteria 4347
120 Ga0395899_0001645 3300037312 Bacteria 18655
121 Ga0395899_0061064 3300037312 Bacteria 2776
122 Ga0395900_0024753 3300037418 Bacteria 6144
123 Ga0395900_0037320 3300037418 Bacteria 5011
124 Ga0395900_0051953 3300037418 Bacteria 4221
125 Ga0395900_0072945 3300037418 Bacteria 3528
126 Ga0395898_0005387 3300037466 Bacteria 13829
127 Ga0395898_0042171 3300037466 Bacteria 4504
128 Ga0395898_0067627 3300037466 Bacteria 3458
129 Ga0395905_0079917 3300037471 Bacteria 3064
130 Ga0395905_0101962 3300037471 Bacteria 2694
131 Ga0395905_0146965 3300037471 Bacteria 2218
132 Ga0395905_0452168 3300037471 Bacteria 1182
133 Ga0395901_0000034 3300038443 Bacteria 230365
134 Ga0395901_0000432 3300038443 Bacteria 49091
135 Ga0395901_0577999 3300038443 Bacteria 1135
136 Ga0436361_0348172 3300039447 Bacteria 5455
137 Ga0436361_0883190 3300039447 Bacteria 11458
138 Ga0451793_0352073 3300041452 Bacteria 1206
139 Ga0451797_1401566 3300041453 Bacteria 1758
140 Ga0439433_0012036 3300041999 Bacteria 1896
141 Ga0439445_0003780 3300042004 Bacteria 3402
142 Ga0439449_0000956 3300042007 Bacteria 11326
143 Ga0450911_000097 3300042115 Bacteria 35730
144 Ga0450894_015946 3300042131 Bacteria 997
145 Ga0450898_014338 3300042134 Bacteria 1331
146 Ga0439434_0016821 3300042435 Bacteria 2186
147 Ga0451577_0007642 3300042876 Bacteria 10601
148 Ga0466969_0022670 3300044656 Bacteria 3241
149 Ga0466969_0088865 3300044656 Bacteria 1466
150 Ga0466969_0095581 3300044656 Bacteria 1403
151 Ga0466972_0014591 3300044658 Bacteria 3934
152 Ga0466977_0001549 3300044666 Bacteria 9615
153 Ga0466965_0013056 3300044683 Bacteria 3914
154 Ga0466965_0023569 3300044683 Bacteria 2972
155 Ga0466965_0059775 3300044683 Bacteria 1903
156 Ga0466965_0062946 3300044683 Bacteria 1856
157 Ga0466966_0103511 3300044684 Bacteria 1759
158 Ga0466961_0001031 3300044693 Bacteria 17198
159 Ga0466961_0071371 3300044693 Bacteria 2203
160 Ga0466963_0001017 3300044694 Bacteria 14520
161 Ga0466964_0014540 3300044706 Bacteria 2993
162 Ga0453684_0136147 3300044712 Bacteria 2941
163 Ga0466971_0000224 3300044719 Bacteria 21717
164 Ga0466971_0015314 3300044719 Bacteria 3374
165 Ga0466968_0014983 3300044735 Bacteria 3070
166 Ga0466968_0184134 3300044735 Bacteria 972
167 Ga0466970_0008629 3300044765 Bacteria 5134
168 Ga0466970_0030416 3300044765 Bacteria 2847
169 Ga0466970_0034983 3300044765 Bacteria 2661
170 Ga0466970_0153697 3300044765 Bacteria 1271
171 Ga0466957_0061527 3300044842 Bacteria 2305
172 Ga0466960_0026489 3300044901 Bacteria 2634
173 Ga0466959_0000620 3300045049 Bacteria 20592
174 Ga0466959_0073867 3300045049 Bacteria 2466
175 Ga0466958_0001219 3300045836 Bacteria 12015
176 Ga0495650_0003261 3300046471 Bacteria 12028
177 Ga0495585_0023316 3300046492 Bacteria 3552
178 Ga0495607_0001256 3300046501 Bacteria 22699
179 Ga0495610_0013444 3300046512 Bacteria 4864
180 Ga0495616_0034022 3300046513 Bacteria 2649
181 Ga0495632_0003077 3300046519 Bacteria 12111
182 Ga0495643_0091451 3300046522 Bacteria 1569
183 Ga0495648_0048442 3300046524 Bacteria 2616
184 Ga0495654_0000307 3300046530 Bacteria 43179
185 Ga0495654_0098115 3300046530 Bacteria 1352
186 Ga0495625_0001839 3300046660 Bacteria 24238
187 Ga0495661_0001271 3300046665 Bacteria 21687
188 Ga0495669_0080040 3300046684 Bacteria 1499
189 Ga0495671_0118741 3300046692 Bacteria 1290
190 Ga0495649_0009921 3300046694 Bacteria 5631
191 Ga0495589_0059085 3300046794 Bacteria 1885
192 Ga0495686_0093349 3300047472 Bacteria 1825
193 Ga0495626_0001074 3300048091 Bacteria 23269
194 Ga0496116_0011975 3300048919 Bacteria 7125
195 Ga0496117_0002257 3300048920 Bacteria 24885
196 Ga0496118_0002464 3300048921 Bacteria 24866
197 Ga0496118_0184319 3300048921 Bacteria 1257
198 Ga0496121_0000257 3300048924 Bacteria 112257
199 Ga0496121_0014575 3300048924 Bacteria 8327
200 Ga0496122_0000199 3300048925 Bacteria 133898
201 Ga0496123_0000102 3300048926 Bacteria 169327
202 Ga0496124_0075212 3300048927 Bacteria 2790
203 Ga0496124_0129818 3300048927 Bacteria 2003
204 Ga0496125_0005965 3300048928 Bacteria 13335
205 Ga0496125_0009217 3300048928 Bacteria 10197
206 Ga0496125_0009870 3300048928 Bacteria 9712
207 Ga0496125_0072960 3300048928 Bacteria 2672
208 Ga0496126_0028163 3300048929 Bacteria 5357
209 Ga0496126_0061836 3300048929 Bacteria 3362
210 Ga0501300_025588 3300049523 Bacteria 866
211 Ga0501047_0135204 3300049581 Bacteria 2346
212 Ga0501206_000803 3300049653 Bacteria 3841
213 Ga0501223_006747 3300049663 Bacteria 2364
214 Ga0501241_011397 3300049758 Bacteria 1615
215 Ga0500646_0037674 3300053090 Bacteria 1351
216 Ga0500594_0008864 3300053118 Bacteria 2303
217 Ga0500658_0011694 3300053134 Bacteria 3234
218 Ga0500559_0002982 3300053136 Bacteria 8490
219 Ga0500559_0016612 3300053136 Bacteria 3108
220 Ga0466962_0001465 3300061719 Bacteria 11008
221 2548498997 2547132374 Bacteria 5530232
222 2587754716 2585428062 Bacteria 6842168
223 2643992010 2643221596 Bacteria 5006805
224 2644062168 2643221609 Bacteria 6756331
225 2644071356 2643221611 Bacteria 6820941
226 2644648454 2643221717 Bacteria 5676132
227 2739245779 2738543012 Bacteria 7115078
228 2816470473 2816332133 Bacteria 7249298
229 2831267547 2831265667 Bacteria 7184833
230 2842739008 2842733646 Bacteria 5716726
231 2842748700 2842747753 Bacteria 5578255
232 2842751778 2842747753 Bacteria 5578255
233 2900643277 2900634093 Bacteria 10263517
234 2928117524 2928115317 Bacteria 6477646
235 Ga0307515_10000047
236 JGI24739J22299_10001680
237 JGI25152J39213_1001325
238 JGI25159J45721_1008393
239 JGI25151J46595_10002013
240 JGI25153J46596_10001798
241 rootH1_10015038
242 rootH1_10033302
243 rootL2_10144749
244 JGI25160J50197_1027269
245 Ga0006562J51391_1061767
246 Ga0055539_1000015
247 Ga0055533_1000018
248 Ga0055525_1000020
249 Ga0055526_1002677
250 Ga0055536_1001094
251 Ga0055530_10002212
252 Ga0055540_1000833
253 Ga0055531_10001120
254 Ga0055541_1000011
255 Ga0065165_1003222
256 Ga0070670_100016037
257 Ga0068869_100014577
258 Ga0070669_100025215
259 Ga0070662_100000952
260 Ga0070706_100202223
261 Ga0068853_100083361
262 Ga0068853_100166299
263 Ga0068855_100086222
264 Ga0070664_100007556
265 Ga0068852_100009833
266 Ga0068859_100026333
267 Ga0068863_100001319
268 Ga0068860_100001126
269 Ga0068860_100209559
270 Ga0068862_100002005
271 Ga0097620_100026332
272 Ga0105244_10000510
273 Ga0105240_10050951
274 Ga0105247_10033340
275 Ga0105243_10025713
276 Ga0105241_10024125
277 Ga0105237_10104620
278 Ga0105249_10000543
279 Ga0105239_10037390
280 Ga0105246_10197205
281 Ga0157380_10005342
282 Ga0182008_10001106
283 Ga0157376_10000620
284 Ga0213872_10006916
285 Ga0209784_100025
286 Ga0209566_100025
287 Ga0209674_100042
288 Ga0209563_100046
289 Ga0207425_1000910
290 Ga0209677_100027
291 Ga0209129_1001408
292 Ga0209130_1001777
293 Ga0209676_1000004
294 Ga0209025_1000291
295 Ga0209025_1004413
296 Ga0209564_1000621
297 Ga0209758_1003534
298 Ga0209050_1000002
299 Ga0207426_1002303
300 Ga0209051_1000002
301 Ga0209257_1000002
302 Ga0207655_1004190
303 Ga0207710_10002770
304 Ga0207647_10007684
305 Ga0207684_10138401
306 Ga0207654_10105444
307 Ga0207695_10085778
308 Ga0207681_10003007
309 Ga0207706_10020791
310 Ga0207709_10011663
311 Ga0207679_10004047
312 Ga0207712_10000388
313 Ga0207677_10122061
314 Ga0207639_10049758
315 Ga0207641_10002050
316 Ga0207698_10006706
317 Ga0268265_10000121
318 Ga0307515_10000178
319 Ga0307515_10000672
320 Ga0307515_10001013
321 Ga0307515_10001836
322 Ga0307515_10003361
323 Ga0307515_10065808
324 Ga0307515_10127061
325 Ga0307512_10076027
326 Ga0307512_10089763
327 Ga0307513_10041072
328 Ga0307513_10084654
329 Ga0307509_10002620
330 Ga0307509_10003530
331 Ga0307509_10175613
332 Ga0307408_100018968
333 Ga0307408_100033162
334 Ga0307408_100223389
335 Ga0307408_100318666
336 Ga0307508_10000130
337 Ga0307508_10000155
338 Ga0307508_10169123
339 Ga0307514_10002433
340 Ga0307514_10002450
341 Ga0307516_10000286
342 Ga0307516_10031704
343 Ga0307516_10216317
344 Ga0307516_10281988
345 Ga0307405_10059437
346 Ga0307405_10191698
347 Ga0307412_10150164
348 Ga0307416_100221190
349 Ga0307414_10201173
350 Ga0307411_10048493
351 Ga0307411_10162117
352 Ga0307510_10029604
353 Ga0307510_10051601
354 Ga0395899_0001645
355 Ga0395899_0061064
356 Ga0395900_0024753
357 Ga0395900_0037320
358 Ga0395900_0051953
359 Ga0395900_0072945
360 Ga0395898_0005387
361 Ga0395898_0042171
362 Ga0395898_0067627
363 Ga0395905_0079917
364 Ga0395905_0101962
365 Ga0395905_0146965
366 Ga0395905_0452168
367 Ga0395901_0000034
368 Ga0395901_0000432
369 Ga0395901_0577999
370 Ga0436361_0348172
371 Ga0436361_0883190
372 Ga0451793_0352073
373 Ga0451797_1401566
374 Ga0439433_0012036
375 Ga0439445_0003780
376 Ga0439449_0000956
377 Ga0450911_000097
378 Ga0450894_015946
379 Ga0450898_014338
380 Ga0439434_0016821
381 Ga0451577_0007642
382 Ga0466969_0022670
383 Ga0466969_0088865
384 Ga0466969_0095581
385 Ga0466972_0014591
386 Ga0466977_0001549
387 Ga0466965_0013056
388 Ga0466965_0023569
389 Ga0466965_0059775
390 Ga0466965_0062946
391 Ga0466966_0103511
392 Ga0466961_0001031
393 Ga0466961_0071371
394 Ga0466963_0001017
395 Ga0466964_0014540
396 Ga0453684_0136147
397 Ga0466971_0000224
398 Ga0466971_0015314
399 Ga0466968_0014983
400 Ga0466968_0184134
401 Ga0466970_0008629
402 Ga0466970_0030416
403 Ga0466970_0034983
404 Ga0466970_0153697
405 Ga0466957_0061527
406 Ga0466960_0026489
407 Ga0466959_0000620
408 Ga0466959_0073867
409 Ga0466958_0001219
410 Ga0495650_0003261
411 Ga0495585_0023316
412 Ga0495607_0001256
413 Ga0495610_0013444
414 Ga0495616_0034022
415 Ga0495632_0003077
416 Ga0495643_0091451
417 Ga0495648_0048442
418 Ga0495654_0000307
419 Ga0495654_0098115
420 Ga0495625_0001839
421 Ga0495661_0001271
422 Ga0495669_0080040
423 Ga0495671_0118741
424 Ga0495649_0009921
425 Ga0495589_0059085
426 Ga0495686_0093349
427 Ga0495626_0001074
428 Ga0496116_0011975
429 Ga0496117_0002257
430 Ga0496118_0002464
431 Ga0496118_0184319
432 Ga0496121_0000257
433 Ga0496121_0014575
434 Ga0496122_0000199
435 Ga0496123_0000102
436 Ga0496124_0075212
437 Ga0496124_0129818
438 Ga0496125_0005965
439 Ga0496125_0009217
440 Ga0496125_0009870
441 Ga0496125_0072960
442 Ga0496126_0028163
443 Ga0496126_0061836
444 Ga0501300_025588
445 Ga0501047_0135204
446 Ga0501206_000803
447 Ga0501223_006747
448 Ga0501241_011397
449 Ga0500646_0037674
450 Ga0500594_0008864
451 Ga0500658_0011694
452 Ga0500559_0002982
453 Ga0500559_0016612
454 Ga0466962_0001465
455 2548498997
456 2587754716
457 2643992010
458 2644062168
459 2644071356
460 2644648454
461 2739245779
462 2816470473
463 2831267547
464 2842739008
465 2842748700
466 2842751778
467 2900643277
468 2928117524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

7

287

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.8969 2 287
3vsh-assembly1.cif.gz_C crystal structure of native 1,6-apd (with iron), 2-animophenol-1,6-dioxygenase 0.8851 3 287
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.885 2 287
3vsh-assembly1.cif.gz_C crystal structure of native 1,6-apd (with iron), 2-animophenol-1,6-dioxygenase 0.8796 3 287
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.8536 1 288
ID Description Score Start End Superfamily
3vshA00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.886 3 287 3.40.830.10
3vshA00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8803 3 287 3.40.830.10
3vsgD00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8349 2 292 3.40.830.10
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8188 3 286 3.40.830.10
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8131 3 286 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A7W2Q9R7-F1-model_v4 Extradiol ring-cleavage dioxygenase 0.9879 1 286 GO:0008198
GO:0051213
AF-A0A7W2Q9R7-F1-model_v4 Extradiol ring-cleavage dioxygenase 0.9777 1 286 GO:0008198
GO:0051213
AF-A0A0R2S4Y2-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9715 69 286 GO:0008198
GO:0016491
AF-A0A0R2ST64-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9677 178 286
AF-A0A519EJL6-F1-model_v4 Extradiol ring-cleavage dioxygenase 0.9624 38 294 GO:0008198
GO:0051213

Map