F344267

General Info

Members Datasets Scaffolds Average Seq Length
231 167 462 90

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0078566|Ga0436361_0078566_168_494
Length 108
Sequence LPAFSAGLTADRLRREALDMARVVFTANLQRHVDCPQTDADGATVREALDDVFRRNERLRGYILDDQAALRRHMAIVVDGKPLRDRTALSDPISTTSAIYVLQALSGG

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
63 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
64 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
65 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
66 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
67 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
80 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
100 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
101 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
149 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
150 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
151 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0
Rhizoplane 12.99
Rhizosphere 78.35
Stem 0
Stem Tuber 0
Unclassified 16.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0078566 3300039447 Bacteria 887
2 JGI25404J52841_10130591 3300003659 Unclassified 531
3 Ga0065712_10141733 3300005290 Bacteria 1444
4 Ga0065715_10098751 3300005293 Bacteria 3503
5 Ga0070670_100101397 3300005331 Bacteria 2478
6 Ga0070689_101301972 3300005340 Bacteria 654
7 Ga0070668_101010946 3300005347 Bacteria 747
8 Ga0070669_100029058 3300005353 Bacteria 3984
9 Ga0070675_100656692 3300005354 Bacteria 953
10 Ga0070674_100629626 3300005356 Bacteria 910
11 Ga0070711_101802090 3300005439 Bacteria 537
12 Ga0070708_100839460 3300005445 Unclassified 863
13 Ga0070678_101165108 3300005456 Bacteria 714
14 Ga0070672_100014612 3300005543 Bacteria 5568
15 Ga0070665_100982135 3300005548 Bacteria 857
16 Ga0070704_101389620 3300005549 Bacteria 644
17 Ga0070702_100946127 3300005615 Unclassified 678
18 Ga0070702_101596356 3300005615 Bacteria 539
19 Ga0068852_100905914 3300005616 Bacteria 899
20 Ga0068863_100138909 3300005841 Bacteria 2322
21 Ga0068860_100301761 3300005843 Bacteria 1569
22 Ga0081455_10005607 3300005937 Bacteria 13718
23 Ga0081540_1002057 3300005983 Bacteria 16782
24 Ga0081540_1052429 3300005983 Bacteria 2008
25 Ga0070717_10250013 3300006028 Bacteria 1566
26 Ga0075368_10103458 3300006042 Bacteria 1171
27 Ga0075362_10722246 3300006177 Unclassified 521
28 Ga0075367_10098981 3300006178 Bacteria 1781
29 Ga0075366_10288811 3300006195 Bacteria 1003
30 Ga0068871_100715318 3300006358 Unclassified 918
31 Ga0075431_100778531 3300006847 Bacteria 931
32 Ga0075433_10259713 3300006852 Bacteria 1540
33 Ga0075434_100202006 3300006871 Bacteria 2008
34 Ga0075434_100325495 3300006871 Bacteria 1557
35 Ga0099795_10475386 3300007788 Bacteria 579
36 Ga0105247_10996804 3300009101 Bacteria 654
37 Ga0114129_10875058 3300009147 Unclassified 1140
38 Ga0114129_10913965 3300009147 Unclassified 1111
39 Ga0114129_13255536 3300009147 Unclassified 526
40 Ga0105243_11996877 3300009148 Bacteria 614
41 Ga0105241_11571562 3300009174 Bacteria 635
42 Ga0105242_10480833 3300009176 Bacteria 1177
43 Ga0105249_10198831 3300009553 Bacteria 1961
44 Ga0099796_10004284 3300010159 Bacteria 3432
45 Ga0099796_10012721 3300010159 Bacteria 2385
46 Ga0157378_10390979 3300013297 Bacteria 1368
47 Ga0157380_10297913 3300014326 Bacteria 1484
48 Ga0157379_10352984 3300014968 Bacteria 1347
49 Ga0157379_11711876 3300014968 Bacteria 616
50 Ga0213872_10000445 3300021361 Bacteria 33820
51 Ga0213872_10072398 3300021361 Bacteria 1552
52 Ga0213872_10133827 3300021361 Bacteria 1091
53 Ga0213875_10366976 3300021388 Bacteria 685
54 Ga0213871_10038067 3300021441 Bacteria 1283
55 Ga0213871_10132740 3300021441 Unclassified 749
56 Ga0207682_10015718 3300025893 Bacteria 2948
57 Ga0207645_10302487 3300025907 Bacteria 1065
58 Ga0207693_11091191 3300025915 Bacteria 606
59 Ga0207681_10165587 3300025923 Bacteria 1671
60 Ga0207650_10630146 3300025925 Bacteria 903
61 Ga0207669_10159105 3300025937 Bacteria 1593
62 Ga0207691_10013145 3300025940 Bacteria 7925
63 Ga0207641_10894533 3300026088 Unclassified 881
64 Ga0207648_11417008 3300026089 Bacteria 653
65 Ga0207683_10157761 3300026121 Bacteria 2050
66 Ga0207698_10784565 3300026142 Bacteria 954
67 Ga0209179_1014958 3300027512 Bacteria 1434
68 Ga0209813_10066788 3300027866 Bacteria 1161
69 Ga0265334_10016185 3300028573 Bacteria 3086
70 Ga0307515_10002776 3300028794 Bacteria 37347
71 Ga0307515_10149745 3300028794 Bacteria 2447
72 Ga0307515_10308800 3300028794 Bacteria 1259
73 Ga0265338_10014960 3300028800 Bacteria 8576
74 Ga0265338_10281144 3300028800 Unclassified 1216
75 Ga0316177_1026594 3300030731 Bacteria 5511
76 Ga0316177_1084203 3300030731 Unclassified 1354
77 Ga0314311_1256155 3300030733 Bacteria 952
78 Ga0316178_1098777 3300030735 Bacteria 835
79 Ga0316180_1190640 3300030736 Bacteria 3766
80 Ga0316181_1018080 3300030744 Unclassified 1885
81 Ga0316181_1025357 3300030744 Bacteria 609
82 Ga0316182_1008330 3300030745 Bacteria 1931
83 Ga0316182_1070496 3300030745 Bacteria 2662
84 Ga0316182_1146260 3300030745 Bacteria 960
85 Ga0307513_10034602 3300031456 Bacteria 5666
86 Ga0307408_100180379 3300031548 Bacteria 1693
87 Ga0307408_100328477 3300031548 Bacteria 1291
88 Ga0265314_10089473 3300031711 Bacteria 2008
89 Ga0265342_10270383 3300031712 Bacteria 902
90 Ga0307516_10147903 3300031730 Unclassified 2113
91 Ga0307516_10653005 3300031730 Bacteria 707
92 Ga0307405_10112566 3300031731 Bacteria 1847
93 Ga0307405_10397231 3300031731 Bacteria 1078
94 Ga0307412_10079046 3300031911 Bacteria 2268
95 Ga0307412_10152267 3300031911 Bacteria 1708
96 Ga0307412_10686278 3300031911 Unclassified 877
97 Ga0307412_12230649 3300031911 Bacteria 510
98 Ga0307409_102848713 3300031995 Bacteria 511
99 Ga0307416_100752913 3300032002 Bacteria 1067
100 Ga0307416_100961192 3300032002 Unclassified 956
101 Ga0307416_103239468 3300032002 Bacteria 545
102 Ga0307414_11766447 3300032004 Bacteria 577
103 Ga0307414_11803526 3300032004 Bacteria 571
104 Ga0307415_101273021 3300032126 Bacteria 695
105 Ga0373929_0230465 3300035085 Unclassified 530
106 Ga0373952_0024075 3300035092 Bacteria 1305
107 Ga0373936_0196979 3300035113 Bacteria 888
108 Ga0373943_0122967 3300035170 Unclassified 1381
109 Ga0373943_0981535 3300035170 Bacteria 506
110 Ga0316574_0205102 3300035398 Bacteria 1266
111 Ga0373931_0085182 3300035691 Unclassified 1751
112 Ga0373935_0390031 3300035692 Bacteria 998
113 Ga0373927_0004542 3300035695 Bacteria 9696
114 Ga0373927_0117654 3300035695 Bacteria 1733
115 Ga0373927_1192514 3300035695 Unclassified 502
116 Ga0373947_0157031 3300035725 Bacteria 1468
117 Ga0373947_0446693 3300035725 Bacteria 875
118 Ga0373937_0901621 3300036401 Bacteria 833
119 Ga0373925_0021447 3300037068 Bacteria 4706
120 Ga0373925_0047458 3300037068 Plasmid 3197
121 Ga0373925_0285912 3300037068 Bacteria 1329
122 Ga0395899_0128926 3300037312 Bacteria 1808
123 Ga0395898_0879467 3300037466 Bacteria 835
124 Ga0395905_0059769 3300037471 Bacteria 3563
125 Ga0395905_0409394 3300037471 Bacteria 1251
126 Ga0395905_1370427 3300037471 Bacteria 611
127 Ga0436364_1020722 3300037853 Bacteria 768
128 Ga0436365_1495882 3300039437 Bacteria 2858
129 Ga0436360_0040237 3300039438 Unclassified 948
130 Ga0436360_0148610 3300039438 Bacteria 1853
131 Ga0436360_0621189 3300039438 Bacteria 1633
132 Ga0436360_0632687 3300039438 Bacteria 3597
133 Ga0436360_0721351 3300039438 Bacteria 1371
134 Ga0436361_0497774 3300039447 Bacteria 1455
135 Ga0436361_0614637 3300039447 Bacteria 17052
136 Ga0436361_0661476 3300039447 Bacteria 1198
137 Ga0436361_0723519 3300039447 Bacteria 39014
138 Ga0436361_0864320 3300039447 Bacteria 1716
139 Ga0436361_0894935 3300039447 Bacteria 4077
140 Ga0436362_0910817 3300039453 Bacteria 3306
141 Ga0439465_0172342 3300041413 Bacteria 780
142 Ga0451791_1659295 3300041451 Unclassified 522
143 Ga0451798_0071914 3300041458 Unclassified 717
144 Ga0450896_052883 3300042133 Bacteria 650
145 Ga0450906_022725 3300042145 Bacteria 1118
146 Ga0439434_0084364 3300042435 Bacteria 1011
147 Ga0451577_0000540 3300042876 Bacteria 62191
148 Ga0466972_0278149 3300044658 Bacteria 782
149 Ga0453684_0812986 3300044712 Bacteria 1007
150 Ga0466960_0916289 3300044901 Bacteria 535
151 Ga0495603_0408810 3300046455 Unclassified 778
152 Ga0495603_0787485 3300046455 Unclassified 542
153 Ga0495650_0007001 3300046471 Bacteria 6884
154 Ga0495664_0814915 3300046477 Unclassified 548
155 Ga0495584_0194902 3300046491 Bacteria 1030
156 Ga0495584_0203468 3300046491 Bacteria 1006
157 Ga0495630_0191769 3300046517 Unclassified 1559
158 Ga0495630_0235605 3300046517 Unclassified 1399
159 Ga0495665_0253681 3300046531 Unclassified 905
160 Ga0495609_0353285 3300046538 Bacteria 593
161 Ga0495621_0029467 3300046539 Bacteria 1872
162 Ga0495621_0046120 3300046539 Bacteria 1545
163 Ga0495622_0293606 3300046557 Unclassified 709
164 Ga0495635_0370918 3300046663 Bacteria 953
165 Ga0495658_0057194 3300046683 Bacteria 2227
166 Ga0495658_0059092 3300046683 Bacteria 2195
167 Ga0495613_0401697 3300046689 Unclassified 935
168 Ga0495674_0364423 3300047319 Bacteria 1171
169 Ga0495676_0365900 3300047321 Unclassified 962
170 Ga0495684_0418882 3300047471 Bacteria 937
171 Ga0495614_0612475 3300048089 Unclassified 523
172 Ga0496100_0125355 3300048903 Bacteria 1802
173 Ga0496100_0132864 3300048903 Unclassified 1755
174 Ga0496100_0345062 3300048903 Bacteria 1123
175 Ga0496101_0224012 3300048904 Bacteria 1460
176 Ga0496101_0927461 3300048904 Bacteria 685
177 Ga0496102_0774833 3300048905 Bacteria 882
178 Ga0496103_0479308 3300048906 Unclassified 797
179 Ga0496104_0001464 3300048907 Bacteria 20379
180 Ga0496104_0127427 3300048907 Bacteria 2444
181 Ga0496104_0244113 3300048907 Bacteria 1708
182 Ga0496105_0004688 3300048908 Bacteria 10306
183 Ga0496105_0348769 3300048908 Bacteria 1183
184 Ga0496106_0623307 3300048909 Bacteria 863
185 Ga0496106_1341547 3300048909 Bacteria 554
186 Ga0496107_0365617 3300048910 Bacteria 1073
187 Ga0496108_0116093 3300048911 Bacteria 2293
188 Ga0496108_0348786 3300048911 Bacteria 1292
189 Ga0496108_0796810 3300048911 Bacteria 815
190 Ga0496109_0321103 3300048912 Bacteria 1461
191 Ga0496110_0101108 3300048913 Bacteria 2584
192 Ga0496110_0258512 3300048913 Bacteria 1585
193 Ga0496110_0638186 3300048913 Bacteria 964
194 Ga0496112_0170308 3300048915 Bacteria 2143
195 Ga0496113_0051428 3300048916 Bacteria 3075
196 Ga0496114_0939913 3300048917 Bacteria 747
197 Ga0496115_0186125 3300048918 Bacteria 1716
198 Ga0496115_0234304 3300048918 Bacteria 1513
199 Ga0496115_1162976 3300048918 Bacteria 582
200 Ga0496126_0915468 3300048929 Bacteria 664
201 Ga0501034_1600658 3300049571 Bacteria 524
202 Ga0501036_0510548 3300049572 Bacteria 1000
203 Ga0501037_1155538 3300049573 Bacteria 500
204 Ga0501038_0757706 3300049574 Bacteria 724
205 Ga0501039_1204334 3300049575 Unclassified 586
206 Ga0501041_0292051 3300049577 Bacteria 1027
207 Ga0501072_0337147 3300049588 Bacteria 1198
208 Ga0501075_0477784 3300049591 Bacteria 951
209 Ga0501075_1560270 3300049591 Bacteria 500
210 Ga0501076_0490109 3300049592 Unclassified 1013
211 Ga0501199_039466 3300049650 Bacteria 608
212 Ga0501206_095622 3300049653 Bacteria 533
213 Ga0501222_017381 3300049662 Bacteria 953
214 Ga0501233_076822 3300049668 Bacteria 854
215 Ga0501079_0964923 3300049741 Bacteria 671
216 Ga0501079_1076683 3300049741 Bacteria 633
217 Ga0501266_021799 3300049763 Bacteria 878
218 Ga0501045_0708297 3300049824 Bacteria 743
219 nmdc:mga0yw44_630798_c1 3300050492 Bacteria 728
220 nmdc:mga0k408_355239_c1 3300050493 Bacteria 873
221 nmdc:mga06z11_16208_c1 3300050494 Bacteria 3350
222 nmdc:mga04h51_108105_c1 3300050495 Bacteria 1022
223 nmdc:mga07m45_54488_c1 3300050496 Bacteria 2260
224 nmdc:mga09592_157878_c1 3300050508 Unclassified 1958
225 nmdc:mga06r32_1043697_c1 3300050510 Bacteria 768
226 nmdc:mga0n895_813134_c1 3300050512 Bacteria 924
227 nmdc:mga0a205_323329_c1 3300050515 Bacteria 1413
228 Ga0495601_0680528 3300053077 Unclassified 657
229 Ga0501084_0227043 3300054114 Bacteria 1576
230 Ga0590075_069217 3300059424 Bacteria 911
231 Ga0530510_0858851 3300061734 Bacteria 693
232 Ga0436361_0078566
233 JGI25404J52841_10130591
234 Ga0065712_10141733
235 Ga0065715_10098751
236 Ga0070670_100101397
237 Ga0070689_101301972
238 Ga0070668_101010946
239 Ga0070669_100029058
240 Ga0070675_100656692
241 Ga0070674_100629626
242 Ga0070711_101802090
243 Ga0070708_100839460
244 Ga0070678_101165108
245 Ga0070672_100014612
246 Ga0070665_100982135
247 Ga0070704_101389620
248 Ga0070702_100946127
249 Ga0070702_101596356
250 Ga0068852_100905914
251 Ga0068863_100138909
252 Ga0068860_100301761
253 Ga0081455_10005607
254 Ga0081540_1002057
255 Ga0081540_1052429
256 Ga0070717_10250013
257 Ga0075368_10103458
258 Ga0075362_10722246
259 Ga0075367_10098981
260 Ga0075366_10288811
261 Ga0068871_100715318
262 Ga0075431_100778531
263 Ga0075433_10259713
264 Ga0075434_100202006
265 Ga0075434_100325495
266 Ga0099795_10475386
267 Ga0105247_10996804
268 Ga0114129_10875058
269 Ga0114129_10913965
270 Ga0114129_13255536
271 Ga0105243_11996877
272 Ga0105241_11571562
273 Ga0105242_10480833
274 Ga0105249_10198831
275 Ga0099796_10004284
276 Ga0099796_10012721
277 Ga0157378_10390979
278 Ga0157380_10297913
279 Ga0157379_10352984
280 Ga0157379_11711876
281 Ga0213872_10000445
282 Ga0213872_10072398
283 Ga0213872_10133827
284 Ga0213875_10366976
285 Ga0213871_10038067
286 Ga0213871_10132740
287 Ga0207682_10015718
288 Ga0207645_10302487
289 Ga0207693_11091191
290 Ga0207681_10165587
291 Ga0207650_10630146
292 Ga0207669_10159105
293 Ga0207691_10013145
294 Ga0207641_10894533
295 Ga0207648_11417008
296 Ga0207683_10157761
297 Ga0207698_10784565
298 Ga0209179_1014958
299 Ga0209813_10066788
300 Ga0265334_10016185
301 Ga0307515_10002776
302 Ga0307515_10149745
303 Ga0307515_10308800
304 Ga0265338_10014960
305 Ga0265338_10281144
306 Ga0316177_1026594
307 Ga0316177_1084203
308 Ga0314311_1256155
309 Ga0316178_1098777
310 Ga0316180_1190640
311 Ga0316181_1018080
312 Ga0316181_1025357
313 Ga0316182_1008330
314 Ga0316182_1070496
315 Ga0316182_1146260
316 Ga0307513_10034602
317 Ga0307408_100180379
318 Ga0307408_100328477
319 Ga0265314_10089473
320 Ga0265342_10270383
321 Ga0307516_10147903
322 Ga0307516_10653005
323 Ga0307405_10112566
324 Ga0307405_10397231
325 Ga0307412_10079046
326 Ga0307412_10152267
327 Ga0307412_10686278
328 Ga0307412_12230649
329 Ga0307409_102848713
330 Ga0307416_100752913
331 Ga0307416_100961192
332 Ga0307416_103239468
333 Ga0307414_11766447
334 Ga0307414_11803526
335 Ga0307415_101273021
336 Ga0373929_0230465
337 Ga0373952_0024075
338 Ga0373936_0196979
339 Ga0373943_0122967
340 Ga0373943_0981535
341 Ga0316574_0205102
342 Ga0373931_0085182
343 Ga0373935_0390031
344 Ga0373927_0004542
345 Ga0373927_0117654
346 Ga0373927_1192514
347 Ga0373947_0157031
348 Ga0373947_0446693
349 Ga0373937_0901621
350 Ga0373925_0021447
351 Ga0373925_0047458
352 Ga0373925_0285912
353 Ga0395899_0128926
354 Ga0395898_0879467
355 Ga0395905_0059769
356 Ga0395905_0409394
357 Ga0395905_1370427
358 Ga0436364_1020722
359 Ga0436365_1495882
360 Ga0436360_0040237
361 Ga0436360_0148610
362 Ga0436360_0621189
363 Ga0436360_0632687
364 Ga0436360_0721351
365 Ga0436361_0497774
366 Ga0436361_0614637
367 Ga0436361_0661476
368 Ga0436361_0723519
369 Ga0436361_0864320
370 Ga0436361_0894935
371 Ga0436362_0910817
372 Ga0439465_0172342
373 Ga0451791_1659295
374 Ga0451798_0071914
375 Ga0450896_052883
376 Ga0450906_022725
377 Ga0439434_0084364
378 Ga0451577_0000540
379 Ga0466972_0278149
380 Ga0453684_0812986
381 Ga0466960_0916289
382 Ga0495603_0408810
383 Ga0495603_0787485
384 Ga0495650_0007001
385 Ga0495664_0814915
386 Ga0495584_0194902
387 Ga0495584_0203468
388 Ga0495630_0191769
389 Ga0495630_0235605
390 Ga0495665_0253681
391 Ga0495609_0353285
392 Ga0495621_0029467
393 Ga0495621_0046120
394 Ga0495622_0293606
395 Ga0495635_0370918
396 Ga0495658_0057194
397 Ga0495658_0059092
398 Ga0495613_0401697
399 Ga0495674_0364423
400 Ga0495676_0365900
401 Ga0495684_0418882
402 Ga0495614_0612475
403 Ga0496100_0125355
404 Ga0496100_0132864
405 Ga0496100_0345062
406 Ga0496101_0224012
407 Ga0496101_0927461
408 Ga0496102_0774833
409 Ga0496103_0479308
410 Ga0496104_0001464
411 Ga0496104_0127427
412 Ga0496104_0244113
413 Ga0496105_0004688
414 Ga0496105_0348769
415 Ga0496106_0623307
416 Ga0496106_1341547
417 Ga0496107_0365617
418 Ga0496108_0116093
419 Ga0496108_0348786
420 Ga0496108_0796810
421 Ga0496109_0321103
422 Ga0496110_0101108
423 Ga0496110_0258512
424 Ga0496110_0638186
425 Ga0496112_0170308
426 Ga0496113_0051428
427 Ga0496114_0939913
428 Ga0496115_0186125
429 Ga0496115_0234304
430 Ga0496115_1162976
431 Ga0496126_0915468
432 Ga0501034_1600658
433 Ga0501036_0510548
434 Ga0501037_1155538
435 Ga0501038_0757706
436 Ga0501039_1204334
437 Ga0501041_0292051
438 Ga0501072_0337147
439 Ga0501075_0477784
440 Ga0501075_1560270
441 Ga0501076_0490109
442 Ga0501199_039466
443 Ga0501206_095622
444 Ga0501222_017381
445 Ga0501233_076822
446 Ga0501079_0964923
447 Ga0501079_1076683
448 Ga0501266_021799
449 Ga0501045_0708297
450 nmdc:mga0yw44_630798_c1
451 nmdc:mga0k408_355239_c1
452 nmdc:mga06z11_16208_c1
453 nmdc:mga04h51_108105_c1
454 nmdc:mga07m45_54488_c1
455 nmdc:mga09592_157878_c1
456 nmdc:mga06r32_1043697_c1
457 nmdc:mga0n895_813134_c1
458 nmdc:mga0a205_323329_c1
459 Ga0495601_0680528
460 Ga0501084_0227043
461 Ga0590075_069217
462 Ga0530510_0858851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8467 3 89
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8421 1 86
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8283 1 89
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.823 3 84
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8129 3 89
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8283 1 89 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.823 3 84 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8059 2 86 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7971 3 84 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7909 2 89 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A3D3P0P6-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9906 1 89
AF-A0A6G6KEV2-F1-model_v4 MoaD/ThiS family protein 0.9901 1 89
AF-A0A812M9W8-F1-model_v4 deleted 0.9878 5 84
AF-A0A2A5DBY8-F1-model_v4 Thiamine biosynthesis protein ThiS 0.986 1 89
AF-A0A518DR92-F1-model_v4 ThiS family protein 0.9846 2 89

Map