F336050

General Info

Members Datasets Scaffolds Average Seq Length
223 165 212 112

Family's Representative Sequence

Representative Sequence 3300049679|Ga0501249_003214|Ga0501249_003214_809_1213
Length 134
Sequence VVRPKGRGYYEQSAYGAQETRTMNTTTAPESAVDPRRFKSFAEFYPFYLTEHANRTCRRLHFVGSTISLVCLVALVVTRDPLWLLAGLVAGYGFAWIGHFGFEKNRPASFKRPLYSFMGDWAMYRDIWLGRVKI

Samples

Sample ID Description Type Environment
1 2721755523 Delftia sp. HK171 Isolate Unclassified
2 2738541307 Variovorax sp. GV008 Isolate Unclassified
3 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
4 2842677519 Variovorax sp. R-72495 Isolate Unclassified
5 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
6 2904456579 Variovorax sp. 2002 Isolate Unclassified
7 2929520902 Variovorax beijingensis 502 Isolate Unclassified
8 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
9 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
10 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
11 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
78 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
79 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
80 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
81 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
82 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
105 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
106 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
113 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
114 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
144 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
145 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
146 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
150 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
151 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
152 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
160 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
161 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
162 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.62
Metatranscriptomes 0.45
Isolates 4.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.15
Nodule 0.9
Rhizoplane 2.24
Rhizosphere 53.81
Stem 0
Stem Tuber 0
Unclassified 13.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000488 3300002773 Bacteria 22516
2 JGI25150J39212_1012726 3300002774 Bacteria 1479
3 JGI25159J45721_1047008 3300002987 Bacteria 604
4 JGI25153J46596_10000358 3300003215 Bacteria 31518
5 Ga0006562J51391_1035916 3300003578 Bacteria 3300
6 Ga0055526_1000952 3300003771 Bacteria 21399
7 Ga0055526_1006759 3300003771 Bacteria 6135
8 Ga0055534_1006336 3300003784 Bacteria 2994
9 Ga0055540_1003546 3300003792 Bacteria 7471
10 Ga0055531_10060716 3300003794 Bacteria 926
11 Ga0055531_10069066 3300003794 Bacteria 823
12 Ga0065704_10108817 3300005289 Bacteria 2019
13 Ga0065704_10612294 3300005289 Bacteria 601
14 Ga0070668_101637569 3300005347 Bacteria 590
15 Ga0070669_101485991 3300005353 Bacteria 589
16 Ga0068855_100077774 3300005563 Bacteria 3850
17 Ga0068859_100407142 3300005617 Bacteria 1456
18 Ga0075365_10073838 3300006038 Bacteria 2300
19 Ga0075365_11212643 3300006038 Bacteria 531
20 Ga0075363_100063123 3300006048 Bacteria 1999
21 Ga0075364_10485301 3300006051 Bacteria 845
22 Ga0075362_10015222 3300006177 Bacteria 3124
23 Ga0075362_10048690 3300006177 Bacteria 1891
24 Ga0075362_10096015 3300006177 Bacteria 1381
25 Ga0075362_10270543 3300006177 Bacteria 839
26 Ga0075362_10770435 3300006177 Bacteria 505
27 Ga0075369_10019434 3300006186 Bacteria 2773
28 Ga0075366_10031844 3300006195 Bacteria 3104
29 Ga0075366_10042534 3300006195 Bacteria 2690
30 Ga0075366_10117900 3300006195 Bacteria 1599
31 Ga0075366_10658714 3300006195 Bacteria 650
32 Ga0075370_10153129 3300006353 Bacteria 1352
33 Ga0075370_10188820 3300006353 Bacteria 1214
34 Ga0097620_100407171 3300006931 Bacteria 1456
35 Ga0079104_1000002 3300006946 Bacteria 514469
36 Ga0105250_10001455 3300009092 Bacteria 12783
37 Ga0105243_10002846 3300009148 Bacteria 14356
38 Ga0105243_10096438 3300009148 Bacteria 2446
39 Ga0105242_11745765 3300009176 Bacteria 659
40 Ga0157347_1004711 3300012502 Bacteria 1279
41 Ga0157378_11293803 3300013297 Bacteria 770
42 Ga0163162_10491896 3300013306 Bacteria 1357
43 Ga0163162_13422241 3300013306 Bacteria 506
44 Ga0163163_11536219 3300014325 Bacteria 727
45 Ga0182008_10103132 3300014497 Bacteria 1411
46 Ga0157379_10088484 3300014968 Bacteria 2778
47 Ga0157376_12349647 3300014969 Bacteria 572
48 Ga0182006_1105296 3300015261 Bacteria 996
49 Ga0163161_10003921 3300017792 Bacteria 10434
50 Ga0163161_11594179 3300017792 Bacteria 575
51 Ga0213872_10078240 3300021361 Bacteria 1486
52 Ga0207425_1000175 3300025245 Bacteria 52768
53 Ga0209129_1000200 3300025258 Bacteria 77042
54 Ga0209565_1022439 3300025263 Bacteria 1307
55 Ga0209673_1004065 3300025273 Bacteria 8082
56 Ga0209673_1028514 3300025273 Bacteria 1795
57 Ga0209130_1001742 3300025284 Bacteria 12970
58 Ga0209675_1002523 3300025291 Bacteria 9334
59 Ga0209675_1003350 3300025291 Bacteria 7677
60 Ga0209675_1033711 3300025291 Bacteria 1185
61 Ga0209676_1005733 3300025292 Bacteria 6374
62 Ga0209025_1027731 3300025294 Bacteria 2799
63 Ga0209564_1000046 3300025295 Bacteria 373787
64 Ga0209564_1002784 3300025295 Bacteria 13066
65 Ga0209758_1000285 3300025297 Bacteria 99959
66 Ga0209256_1040667 3300025299 Bacteria 1186
67 Ga0209051_1000240 3300025303 Bacteria 92221
68 Ga0209051_1024876 3300025303 Bacteria 2451
69 Ga0209257_1008538 3300025304 Bacteria 5785
70 Ga0209257_1022573 3300025304 Bacteria 2240
71 Ga0207696_1037615 3300025711 Bacteria 1431
72 Ga0207645_10145414 3300025907 Bacteria 1545
73 Ga0207705_10439129 3300025909 Bacteria 1011
74 Ga0207649_11686668 3300025920 Bacteria 502
75 Ga0207681_11384965 3300025923 Bacteria 590
76 Ga0207709_10000015 3300025935 Bacteria 493221
77 Ga0207709_10167923 3300025935 Bacteria 1537
78 Ga0207667_10265102 3300025949 Bacteria 1757
79 Ga0207668_11167426 3300025972 Bacteria 691
80 Ga0207648_10617024 3300026089 Bacteria 1001
81 Ga0209281_1000007 3300027111 Bacteria 938265
82 Ga0268265_11471012 3300028380 Bacteria 684
83 Ga0268265_11764213 3300028380 Bacteria 625
84 Ga0268264_10157763 3300028381 Bacteria 2041
85 Ga0265336_10000044 3300028666 Bacteria 131932
86 Ga0307517_10131829 3300028786 Bacteria 1796
87 Ga0307517_10297525 3300028786 Bacteria 907
88 Ga0307515_10017377 3300028794 Bacteria 13105
89 Ga0307515_10151467 3300028794 Bacteria 2422
90 Ga0307515_10598397 3300028794 Bacteria 713
91 Ga0265324_10000440 3300029957 Bacteria 29513
92 Ga0314311_1185435 3300030733 Bacteria 10401
93 Ga0316179_1089008 3300030734 Bacteria 4268
94 Ga0316180_1132439 3300030736 Bacteria 2316
95 Ga0316183_1170808 3300030742 Bacteria 5271
96 Ga0316181_1020171 3300030744 Bacteria 4351
97 Ga0316182_1398018 3300030745 Bacteria 1580
98 Ga0307513_10000975 3300031456 Bacteria 41400
99 Ga0307513_10416326 3300031456 Bacteria 1075
100 Ga0307509_10131801 3300031507 Bacteria 2454
101 Ga0307408_100003804 3300031548 Bacteria 10279
102 Ga0307408_100197068 3300031548 Bacteria 1627
103 Ga0307408_100369902 3300031548 Bacteria 1222
104 Ga0307408_100624674 3300031548 Bacteria 960
105 Ga0307508_10000004 3300031616 Bacteria 287547
106 Ga0307514_10005331 3300031649 Bacteria 11524
107 Ga0307514_10011697 3300031649 Bacteria 7300
108 Ga0307516_10001516 3300031730 Bacteria 31958
109 Ga0307516_10023918 3300031730 Bacteria 6249
110 Ga0307516_10950143 3300031730 Bacteria 529
111 Ga0307405_11710584 3300031731 Bacteria 557
112 Ga0307405_11975833 3300031731 Bacteria 521
113 Ga0307413_11297607 3300031824 Bacteria 637
114 Ga0307410_10106470 3300031852 Bacteria 2021
115 Ga0307406_10001303 3300031901 Bacteria 13987
116 Ga0307412_10031226 3300031911 Bacteria 3362
117 Ga0307412_10060681 3300031911 Bacteria 2538
118 Ga0307412_10178658 3300031911 Bacteria 1594
119 Ga0307412_10467330 3300031911 Bacteria 1043
120 Ga0307412_10758862 3300031911 Bacteria 838
121 Ga0307412_11112884 3300031911 Bacteria 703
122 Ga0307409_100313135 3300031995 Bacteria 1466
123 Ga0307416_100758555 3300032002 Bacteria 1063
124 Ga0307414_11045833 3300032004 Bacteria 753
125 Ga0307411_10019997 3300032005 Bacteria 3883
126 Ga0307415_100663067 3300032126 Bacteria 937
127 Ga0307415_100913108 3300032126 Bacteria 810
128 Ga0307507_10025762 3300033179 Bacteria 6366
129 Ga0395900_0000046 3300037418 Bacteria 230114
130 Ga0395898_0001070 3300037466 Bacteria 42389
131 Ga0395905_0003044 3300037471 Bacteria 18154
132 Ga0436361_0067500 3300039447 Bacteria 2504
133 Ga0436361_0748462 3300039447 Bacteria 9686
134 Ga0439438_076693 3300041405 Bacteria 823
135 Ga0439439_0171189 3300041406 Bacteria 623
136 Ga0451791_0155403 3300041451 Bacteria 602
137 Ga0451797_0249453 3300041453 Bacteria 796
138 Ga0451797_1063181 3300041453 Bacteria 547
139 Ga0451802_1975947 3300041460 Bacteria 990
140 Ga0451807_0311311 3300041486 Bacteria 1412
141 Ga0451841_0454140 3300041498 Bacteria 601
142 Ga0451843_0400592 3300041509 Bacteria 640
143 Ga0439442_048686 3300042002 Bacteria 893
144 Ga0439445_0009518 3300042004 Bacteria 2291
145 Ga0450911_000938 3300042115 Bacteria 7633
146 Ga0439435_0187963 3300042436 Bacteria 677
147 Ga0439460_0325996 3300042461 Bacteria 539
148 Ga0450893_0015128 3300042532 Bacteria 1299
149 Ga0450893_0051102 3300042532 Bacteria 775
150 Ga0466972_0495166 3300044658 Bacteria 575
151 Ga0466965_0086676 3300044683 Bacteria 1588
152 Ga0466965_0088159 3300044683 Bacteria 1575
153 Ga0466965_0710264 3300044683 Bacteria 577
154 Ga0466971_0021635 3300044719 Bacteria 2862
155 Ga0466971_0516659 3300044719 Bacteria 590
156 Ga0466970_0104127 3300044765 Bacteria 1547
157 Ga0466960_0013206 3300044901 Bacteria 3503
158 Ga0466960_0501620 3300044901 Bacteria 711
159 Ga0466967_1759733 3300045976 Bacteria 617
160 Ga0495627_002211 3300046453 Bacteria 9676
161 Ga0495605_0286546 3300046474 Bacteria 699
162 Ga0495585_0049504 3300046492 Bacteria 2333
163 Ga0495606_0074507 3300046507 Bacteria 2126
164 Ga0495610_0146095 3300046512 Bacteria 1013
165 Ga0495637_0003874 3300046520 Bacteria 7854
166 Ga0495637_0329875 3300046520 Bacteria 538
167 Ga0495642_0503704 3300046528 Bacteria 536
168 Ga0495588_0009789 3300046674 Bacteria 4444
169 Ga0495670_0012650 3300046691 Bacteria 4151
170 Ga0495660_0236851 3300046810 Bacteria 853
171 Ga0495686_0017104 3300047472 Bacteria 4894
172 Ga0495626_0092170 3300048091 Bacteria 1331
173 Ga0496116_0334467 3300048919 Bacteria 702
174 Ga0496121_0006447 3300048924 Bacteria 14558
175 Ga0496122_0451441 3300048925 Bacteria 638
176 Ga0496122_0585119 3300048925 Bacteria 525
177 Ga0496123_0040652 3300048926 Bacteria 3234
178 Ga0496125_0007209 3300048928 Bacteria 11852
179 Ga0496125_0017606 3300048928 Bacteria 6807
180 Ga0496126_0338706 3300048929 Bacteria 1232
181 Ga0501047_0447161 3300049581 Bacteria 1122
182 Ga0501202_137473 3300049652 Bacteria 629
183 Ga0501222_032158 3300049662 Bacteria 724
184 Ga0501223_008299 3300049663 Bacteria 2118
185 Ga0501249_003214 3300049679 Bacteria 3293
186 Ga0501257_139873 3300049686 Bacteria 660
187 Ga0501225_0013616 3300049705 Bacteria 2275
188 Ga0501241_167133 3300049758 Bacteria 515
189 Ga0501262_000660 3300049759 Bacteria 4023
190 Ga0501269_063102 3300049766 Bacteria 527
191 Ga0501280_005439 3300049776 Bacteria 1820
192 nmdc:mga03683_12792_c1 3300050489 Bacteria 3073
193 nmdc:mga03683_501033_c1 3300050489 Bacteria 588
194 nmdc:mga03683_57415_c1 3300050489 Bacteria 1638
195 nmdc:mga03683_688270_c1 3300050489 Bacteria 505
196 nmdc:mga03n38_9985_c1 3300050490 Bacteria 3474
197 nmdc:mga0yw44_1146725_c1 3300050492 Bacteria 525
198 nmdc:mga0k408_36683_c1 3300050493 Bacteria 2814
199 nmdc:mga0k408_51437_c1 3300050493 Bacteria 2387
200 nmdc:mga0k408_607526_c1 3300050493 Bacteria 645
201 nmdc:mga0k408_930571_c1 3300050493 Bacteria 504
202 nmdc:mga06z11_72899_c1 3300050494 Bacteria 1822
203 nmdc:mga07m45_460067_c1 3300050496 Bacteria 738
204 nmdc:mga07m45_645657_c1 3300050496 Bacteria 610
205 Ga0500635_0000235 3300053080 Bacteria 24500
206 Ga0500608_011660 3300053122 Bacteria 3826
207 Ga0500614_128785 3300053123 Bacteria 750
208 Ga0500628_000903 3300053129 Bacteria 5239
209 Ga0500568_0113189 3300053139 Bacteria 1013
210 Ga0500622_0004024 3300053156 Bacteria 9465
211 Ga0500622_0035354 3300053156 Bacteria 2614
212 Ga0466962_0150863 3300061719 Bacteria 1127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1006759 Ga0055526_10067591 97
2 3300025291 Ga0209675_1033711 Ga0209675_10337113 97
3 3300025295 Ga0209564_1002784 Ga0209564_100278412 97
4 3300050494 nmdc:mga06z11_72899_c1 nmdc:mga06z11_72899_c1_470_871 98
5 3300031456 Ga0307513_10000975 Ga0307513_1000097513 99
6 3300041509 Ga0451843_0400592 Ga0451843_0400592_211_579 100
7 3300041453 Ga0451797_1063181 Ga0451797_1063181_114_476 102
8 3300053129 Ga0500628_000903 Ga0500628_000903_2431_2784 102
9 3300005563 Ga0068855_100077774 Ga0068855_1000777743 103
10 3300005617 Ga0068859_100407142 Ga0068859_1004071422 103
11 3300006931 Ga0097620_100407171 Ga0097620_1004071712 103
12 3300014968 Ga0157379_10088484 Ga0157379_100884843 103
13 3300025907 Ga0207645_10145414 Ga0207645_101454142 103
14 3300025920 Ga0207649_11686668 Ga0207649_116866681 103
15 3300025949 Ga0207667_10265102 Ga0207667_102651022 103
16 3300028666 Ga0265336_10000044 Ga0265336_1000004430 103
17 3300029957 Ga0265324_10000440 Ga0265324_100004404 103
18 3300042004 Ga0439445_0009518 Ga0439445_0009518_773_1102 103
19 3300042115 Ga0450911_000938 Ga0450911_000938_3421_3750 103
20 3300046492 Ga0495585_0049504 Ga0495585_0049504_1490_1819 103
21 3300046528 Ga0495642_0503704 Ga0495642_0503704_155_484 103
22 3300047472 Ga0495686_0017104 Ga0495686_0017104_2195_2524 103
23 3300048924 Ga0496121_0006447 Ga0496121_0006447_13211_13546 103
24 3300048928 Ga0496125_0007209 Ga0496125_0007209_4861_5196 103
25 3300048928 Ga0496125_0017606 Ga0496125_0017606_6089_6427 103
26 3300048929 Ga0496126_0338706 Ga0496126_0338706_377_715 103
27 3300053080 Ga0500635_0000235 Ga0500635_0000235_2976_3305 103
28 3300053123 Ga0500614_128785 Ga0500614_128785_172_501 103
29 iso_pu_bacteria 2738541307 2738879859 104
30 iso_pu_bacteria 2842677519 2842677978 104
31 iso_pu_bacteria 2904449895 2904450254 104
32 iso_pu_bacteria 2904456579 2904456923 104
33 iso_pu_bacteria 2929520902 2929520945 104
34 iso_pu_bacteria 2945909444 2945913364 104
35 iso_pu_bacteria 2945945610 2945948915 104
36 iso_pu_bacteria 2945972063 2945973031 104
37 iso_pu_bacteria 2945984333 2945984406 104
38 3300032126 Ga0307415_100663067 Ga0307415_1006630671 105
39 3300049581 Ga0501047_0447161 Ga0501047_0447161_269_604 105
40 3300053139 Ga0500568_0113189 Ga0500568_0113189_327_659 105
41 3300053156 Ga0500622_0004024 Ga0500622_0004024_7750_8082 105
42 3300053156 Ga0500622_0035354 Ga0500622_0035354_882_1214 105
43 iso_pu_bacteria 2721755523 2722882533 105
44 iso_pu_bacteria 2839138175 2839141205 105
45 3300005347 Ga0070668_101637569 Ga0070668_1016375692 106
46 3300006038 Ga0075365_10073838 Ga0075365_100738383 106
47 3300006195 Ga0075366_10031844 Ga0075366_100318443 106
48 3300006195 Ga0075366_10117900 Ga0075366_101179001 106
49 3300006195 Ga0075366_10658714 Ga0075366_106587141 106
50 3300013306 Ga0163162_10491896 Ga0163162_104918961 106
51 3300014325 Ga0163163_11536219 Ga0163163_115362192 106
52 3300025972 Ga0207668_11167426 Ga0207668_111674262 106
53 3300026089 Ga0207648_10617024 Ga0207648_106170242 106
54 3300028380 Ga0268265_11764213 Ga0268265_117642132 106
55 3300028381 Ga0268264_10157763 Ga0268264_101577632 106
56 3300028786 Ga0307517_10297525 Ga0307517_102975252 106
57 3300028794 Ga0307515_10017377 Ga0307515_100173777 106
58 3300031507 Ga0307509_10131801 Ga0307509_101318013 106
59 3300031548 Ga0307408_100624674 Ga0307408_1006246742 106
60 3300031616 Ga0307508_10000004 Ga0307508_10000004140 106
61 3300031649 Ga0307514_10011697 Ga0307514_100116972 106
62 3300031730 Ga0307516_10001516 Ga0307516_1000151611 106
63 3300031730 Ga0307516_10950143 Ga0307516_109501431 106
64 3300031852 Ga0307410_10106470 Ga0307410_101064703 106
65 3300031911 Ga0307412_10178658 Ga0307412_101786582 106
66 3300031995 Ga0307409_100313135 Ga0307409_1003131352 106
67 3300032002 Ga0307416_100758555 Ga0307416_1007585552 106
68 3300032005 Ga0307411_10019997 Ga0307411_100199974 106
69 3300033179 Ga0307507_10025762 Ga0307507_100257622 106
70 3300037471 Ga0395905_0003044 Ga0395905_0003044_2041_2370 106
71 3300046520 Ga0495637_0329875 Ga0495637_0329875_94_423 106
72 3300050493 nmdc:mga0k408_51437_c1 nmdc:mga0k408_51437_c1_372_698 106
73 3300050493 nmdc:mga0k408_930571_c1 nmdc:mga0k408_930571_c1_151_483 106
74 3300005353 Ga0070669_101485991 Ga0070669_1014859911 107
75 3300006177 Ga0075362_10270543 Ga0075362_102705431 107
76 3300009176 Ga0105242_11745765 Ga0105242_117457651 107
77 3300021361 Ga0213872_10078240 Ga0213872_100782403 107
78 3300025909 Ga0207705_10439129 Ga0207705_104391291 107
79 3300025923 Ga0207681_11384965 Ga0207681_113849651 107
80 3300039447 Ga0436361_0067500 Ga0436361_0067500_1046_1372 107
81 3300039447 Ga0436361_0748462 Ga0436361_0748462_7212_7538 107
82 3300050489 nmdc:mga03683_501033_c1 nmdc:mga03683_501033_c1_47_382 107
83 3300002987 JGI25159J45721_1047008 JGI25159J45721_10470082 108
84 3300003578 Ga0006562J51391_1035916 Ga0006562J51391_10359162 108
85 3300003784 Ga0055534_1006336 Ga0055534_10063363 108
86 3300003792 Ga0055540_1003546 Ga0055540_10035463 108
87 3300003794 Ga0055531_10060716 Ga0055531_100607162 108
88 3300005289 Ga0065704_10612294 Ga0065704_106122942 108
89 3300006038 Ga0075365_11212643 Ga0075365_112126432 108
90 3300006048 Ga0075363_100063123 Ga0075363_1000631233 108
91 3300006051 Ga0075364_10485301 Ga0075364_104853012 108
92 3300006177 Ga0075362_10015222 Ga0075362_100152224 108
93 3300006177 Ga0075362_10048690 Ga0075362_100486902 108
94 3300006177 Ga0075362_10096015 Ga0075362_100960152 108
95 3300006177 Ga0075362_10770435 Ga0075362_107704351 108
96 3300006186 Ga0075369_10019434 Ga0075369_100194343 108
97 3300006195 Ga0075366_10042534 Ga0075366_100425342 108
98 3300006353 Ga0075370_10153129 Ga0075370_101531292 108
99 3300006353 Ga0075370_10188820 Ga0075370_101888203 108
100 3300009148 Ga0105243_10096438 Ga0105243_100964382 108
101 3300012502 Ga0157347_1004711 Ga0157347_10047112 108
102 3300013297 Ga0157378_11293803 Ga0157378_112938031 108
103 3300014497 Ga0182008_10103132 Ga0182008_101031322 108
104 3300015261 Ga0182006_1105296 Ga0182006_11052962 108
105 3300017792 Ga0163161_10003921 Ga0163161_100039217 108
106 3300025273 Ga0209673_1028514 Ga0209673_10285142 108
107 3300025284 Ga0209130_1001742 Ga0209130_100174214 108
108 3300025291 Ga0209675_1002523 Ga0209675_10025234 108
109 3300025291 Ga0209675_1003350 Ga0209675_10033509 108
110 3300025292 Ga0209676_1005733 Ga0209676_10057335 108
111 3300025294 Ga0209025_1027731 Ga0209025_10277314 108
112 3300025303 Ga0209051_1000240 Ga0209051_100024056 108
113 3300025303 Ga0209051_1024876 Ga0209051_10248762 108
114 3300025304 Ga0209257_1008538 Ga0209257_10085383 108
115 3300025935 Ga0207709_10167923 Ga0207709_101679231 108
116 3300028380 Ga0268265_11471012 Ga0268265_114710121 108
117 3300028794 Ga0307515_10598397 Ga0307515_105983971 108
118 3300030733 Ga0314311_1185435 Ga0314311_11854355 108
119 3300030734 Ga0316179_1089008 Ga0316179_10890085 108
120 3300030736 Ga0316180_1132439 Ga0316180_11324393 108
121 3300030742 Ga0316183_1170808 Ga0316183_11708082 108
122 3300030744 Ga0316181_1020171 Ga0316181_10201714 108
123 3300030745 Ga0316182_1398018 Ga0316182_13980182 108
124 3300031456 Ga0307513_10416326 Ga0307513_104163262 108
125 3300031548 Ga0307408_100003804 Ga0307408_1000038047 108
126 3300031548 Ga0307408_100197068 Ga0307408_1001970682 108
127 3300031548 Ga0307408_100369902 Ga0307408_1003699022 108
128 3300031649 Ga0307514_10005331 Ga0307514_100053314 108
129 3300031731 Ga0307405_11710584 Ga0307405_117105841 108
130 3300031731 Ga0307405_11975833 Ga0307405_119758331 108
131 3300031824 Ga0307413_11297607 Ga0307413_112976071 108
132 3300031901 Ga0307406_10001303 Ga0307406_1000130312 108
133 3300031911 Ga0307412_10031226 Ga0307412_100312262 108
134 3300031911 Ga0307412_10060681 Ga0307412_100606812 108
135 3300031911 Ga0307412_10467330 Ga0307412_104673302 108
136 3300031911 Ga0307412_11112884 Ga0307412_111128841 108
137 3300032004 Ga0307414_11045833 Ga0307414_110458332 108
138 3300032126 Ga0307415_100913108 Ga0307415_1009131082 108
139 3300037418 Ga0395900_0000046 Ga0395900_0000046_11330_11668 108
140 3300037466 Ga0395898_0001070 Ga0395898_0001070_15454_15792 108
141 3300041405 Ga0439438_076693 Ga0439438_076693_98_436 108
142 3300041406 Ga0439439_0171189 Ga0439439_0171189_14_352 108
143 3300041451 Ga0451791_0155403 Ga0451791_0155403_138_476 108
144 3300041453 Ga0451797_0249453 Ga0451797_0249453_299_643 108
145 3300041460 Ga0451802_1975947 Ga0451802_1975947_105_443 108
146 3300041486 Ga0451807_0311311 Ga0451807_0311311_742_1080 108
147 3300041498 Ga0451841_0454140 Ga0451841_0454140_84_422 108
148 3300042002 Ga0439442_048686 Ga0439442_048686_40_378 108
149 3300042532 Ga0450893_0015128 Ga0450893_0015128_301_639 108
150 3300042532 Ga0450893_0051102 Ga0450893_0051102_422_760 108
151 3300044658 Ga0466972_0495166 Ga0466972_0495166_61_399 108
152 3300044683 Ga0466965_0086676 Ga0466965_0086676_510_848 108
153 3300044683 Ga0466965_0710264 Ga0466965_0710264_130_468 108
154 3300044719 Ga0466971_0021635 Ga0466971_0021635_2063_2407 108
155 3300044719 Ga0466971_0516659 Ga0466971_0516659_52_390 108
156 3300044765 Ga0466970_0104127 Ga0466970_0104127_830_1168 108
157 3300044901 Ga0466960_0013206 Ga0466960_0013206_2078_2416 108
158 3300044901 Ga0466960_0501620 Ga0466960_0501620_191_529 108
159 3300046453 Ga0495627_002211 Ga0495627_002211_7592_7930 108
160 3300046474 Ga0495605_0286546 Ga0495605_0286546_223_579 108
161 3300046507 Ga0495606_0074507 Ga0495606_0074507_1499_1837 108
162 3300046512 Ga0495610_0146095 Ga0495610_0146095_555_911 108
163 3300046520 Ga0495637_0003874 Ga0495637_0003874_3128_3466 108
164 3300046674 Ga0495588_0009789 Ga0495588_0009789_1791_2129 108
165 3300046691 Ga0495670_0012650 Ga0495670_0012650_2180_2518 108
166 3300046810 Ga0495660_0236851 Ga0495660_0236851_11_349 108
167 3300048091 Ga0495626_0092170 Ga0495626_0092170_414_770 108
168 3300048919 Ga0496116_0334467 Ga0496116_0334467_19_357 108
169 3300048925 Ga0496122_0451441 Ga0496122_0451441_69_407 108
170 3300048925 Ga0496122_0585119 Ga0496122_0585119_96_434 108
171 3300048926 Ga0496123_0040652 Ga0496123_0040652_725_1063 108
172 3300049652 Ga0501202_137473 Ga0501202_137473_86_424 108
173 3300049663 Ga0501223_008299 Ga0501223_008299_1645_1983 108
174 3300049679 Ga0501249_003214 Ga0501249_003214_809_1213 108
175 3300049705 Ga0501225_0013616 Ga0501225_0013616_1896_2234 108
176 3300049758 Ga0501241_167133 Ga0501241_167133_87_491 108
177 3300049759 Ga0501262_000660 Ga0501262_000660_1456_1860 108
178 3300049766 Ga0501269_063102 Ga0501269_063102_151_489 108
179 3300050489 nmdc:mga03683_12792_c1 nmdc:mga03683_12792_c1_1953_2291 108
180 3300050489 nmdc:mga03683_57415_c1 nmdc:mga03683_57415_c1_1027_1368 108
181 3300050489 nmdc:mga03683_688270_c1 nmdc:mga03683_688270_c1_44_382 108
182 3300050490 nmdc:mga03n38_9985_c1 nmdc:mga03n38_9985_c1_1346_1684 108
183 3300050492 nmdc:mga0yw44_1146725_c1 nmdc:mga0yw44_1146725_c1_100_438 108
184 3300050493 nmdc:mga0k408_36683_c1 nmdc:mga0k408_36683_c1_2214_2552 108
185 3300050493 nmdc:mga0k408_607526_c1 nmdc:mga0k408_607526_c1_228_566 108
186 3300050496 nmdc:mga07m45_460067_c1 nmdc:mga07m45_460067_c1_74_412 108
187 3300053122 Ga0500608_011660 Ga0500608_011660_1397_1735 108
188 3300002773 JGI25152J39213_1000488 JGI25152J39213_100048813 109
189 3300002774 JGI25150J39212_1012726 JGI25150J39212_10127262 109
190 3300003215 JGI25153J46596_10000358 JGI25153J46596_1000035833 109
191 3300003771 Ga0055526_1000952 Ga0055526_10009529 109
192 3300003794 Ga0055531_10069066 Ga0055531_100690662 109
193 3300005289 Ga0065704_10108817 Ga0065704_101088172 109
194 3300006946 Ga0079104_1000002 Ga0079104_100000216 109
195 3300009092 Ga0105250_10001455 Ga0105250_100014551 109
196 3300009148 Ga0105243_10002846 Ga0105243_100028466 109
197 3300013306 Ga0163162_13422241 Ga0163162_134222412 109
198 3300014969 Ga0157376_12349647 Ga0157376_123496472 109
199 3300017792 Ga0163161_11594179 Ga0163161_115941791 109
200 3300025245 Ga0207425_1000175 Ga0207425_100017531 109
201 3300025258 Ga0209129_1000200 Ga0209129_100020068 109
202 3300025263 Ga0209565_1022439 Ga0209565_10224391 109
203 3300025273 Ga0209673_1004065 Ga0209673_10040655 109
204 3300025295 Ga0209564_1000046 Ga0209564_100004688 109
205 3300025297 Ga0209758_1000285 Ga0209758_100028513 109
206 3300025299 Ga0209256_1040667 Ga0209256_10406672 109
207 3300025304 Ga0209257_1022573 Ga0209257_10225732 109
208 3300025711 Ga0207696_1037615 Ga0207696_10376152 109
209 3300025935 Ga0207709_10000015 Ga0207709_1000001515 109
210 3300027111 Ga0209281_1000007 Ga0209281_1000007235 109
211 3300028786 Ga0307517_10131829 Ga0307517_101318292 109
212 3300028794 Ga0307515_10151467 Ga0307515_101514672 109
213 3300031730 Ga0307516_10023918 Ga0307516_100239183 109
214 3300031911 Ga0307412_10758862 Ga0307412_107588622 109
215 3300042436 Ga0439435_0187963 Ga0439435_0187963_120_473 109
216 3300042461 Ga0439460_0325996 Ga0439460_0325996_84_437 109
217 3300044683 Ga0466965_0088159 Ga0466965_0088159_580_927 109
218 3300045976 Ga0466967_1759733 Ga0466967_1759733_141_488 109
219 3300049662 Ga0501222_032158 Ga0501222_032158_58_429 109
220 3300049686 Ga0501257_139873 Ga0501257_139873_250_621 109
221 3300049776 Ga0501280_005439 Ga0501280_005439_941_1312 109
222 3300050496 nmdc:mga07m45_645657_c1 nmdc:mga07m45_645657_c1_228_593 109
223 3300061719 Ga0466962_0150863 Ga0466962_0150863_69_416 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

38

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x21-assembly1.cif.gz_A cryo-em structure of non gastric h,k-atpase alpha2 k794a in (k+)e2-alf state 0.4967 20 78
8wa5-assembly1.cif.gz_A cryo-em structure of the gastric proton pump y799w/e936q mutant in k+-occluded (k+)e2-alf state 0.446 13 76
3tul-assembly5.cif.gz_B crystal structure of n-terminal region of type iii secretion major translocator sipb (residues 82-226) 0.4106 16 97
6h2f-assembly1.cif.gz_A structure of the pre-pore ahlb of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.4064 16 103
7o3w-assembly1.cif.gz_F structural basis for vipp1 oligomerization and maintenance of thylakoid membrane integrity 0.3726 16 106
ID Description Score Start End Superfamily
1kkcY01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.571 24 81 1.10.287.990
af_I1MG16_39_183_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5454 16 96 1.20.140.40
4c7uA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.5442 24 80 1.10.287.990
3c3tB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.5413 24 81 1.10.287.990
4c7uB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.5359 24 81 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A521TV82-F1-model_v4 DUF962 domain-containing protein 0.8886 6 105
AF-A0A2V8HTX1-F1-model_v4 DUF962 domain-containing protein 0.8769 13 85 GO:0016020
AF-A0A2D6A9D0-F1-model_v4 DUF962 domain-containing protein 0.8742 13 105 GO:0016020
AF-A0A1X9NDT0-F1-model_v4 DUF962 family protein 0.8712 12 107 GO:0016020
AF-E6Q486-F1-model_v4 Membrane protein containing DUF962 0.8706 14 105 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.44 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map