F334952

General Info

Members Datasets Scaffolds Average Seq Length
222 172 221 201

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0000046|Ga0501046_0000046_6352_6927
Length 186
Sequence MHDVQVIEDPEAAIVALGPIRSRLLAESAEPVSAATLATRVGLARQKVNYHLNALEAAGLLRLAEKRKWGGLTERLLVATSASYVVSPGALGPVAVDPNRKVDRLSASYARVVREVGALVRRANEAGKRLATLAVDTEIRFRSPADRAAFSNELAEAIANLVSKYHDASAPGGRPHRLVVMSHPLP

Samples

Sample ID Description Type Environment
1 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
103 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
107 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
138 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
141 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
142 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
147 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
148 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.51
Nodule 0.45
Rhizoplane 2.7
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10034749 3300003320 Bacteria 19427
2 Ga0070683_100579708 3300005329 Bacteria 1073
3 Ga0068869_100509511 3300005334 Bacteria 1006
4 Ga0070680_100108970 3300005336 Bacteria 2304
5 Ga0070682_100348389 3300005337 Bacteria 1103
6 Ga0070689_101210439 3300005340 Unclassified 678
7 Ga0070668_100056065 3300005347 Bacteria 3043
8 Ga0070669_100035843 3300005353 Bacteria 3594
9 Ga0070675_101471101 3300005354 Bacteria 628
10 Ga0070671_100000115 3300005355 Bacteria 51960
11 Ga0070674_100077346 3300005356 Bacteria 2369
12 Ga0070667_100080291 3300005367 Bacteria 2790
13 Ga0070681_10014163 3300005458 Bacteria 7938
14 Ga0068867_100009977 3300005459 Bacteria 6691
15 Ga0070685_10203979 3300005466 Bacteria 1287
16 Ga0070679_100009502 3300005530 Bacteria 9198
17 Ga0068853_100771127 3300005539 Bacteria 920
18 Ga0068857_101186857 3300005577 Bacteria 739
19 Ga0068861_100109029 3300005719 Bacteria 2216
20 Ga0068861_100285373 3300005719 Bacteria 1423
21 Ga0068861_100583795 3300005719 Bacteria 1023
22 Ga0068863_100335317 3300005841 Bacteria 1471
23 Ga0081538_10001602 3300005981 Bacteria 23216
24 Ga0081538_10002268 3300005981 Bacteria 19025
25 Ga0081538_10003765 3300005981 Bacteria 14203
26 Ga0081538_10011475 3300005981 Bacteria 7174
27 Ga0081538_10016327 3300005981 Bacteria 5698
28 Ga0081538_10022857 3300005981 Bacteria 4514
29 Ga0081538_10044038 3300005981 Bacteria 2791
30 Ga0081538_10067247 3300005981 Bacteria 2002
31 Ga0081538_10120882 3300005981 Bacteria 1259
32 Ga0075363_100007024 3300006048 Bacteria 5148
33 Ga0075363_100007713 3300006048 Bacteria 4968
34 Ga0075364_10009896 3300006051 Bacteria 5735
35 Ga0075364_10017572 3300006051 Bacteria 4473
36 Ga0070716_100537680 3300006173 Bacteria 869
37 Ga0075367_10005183 3300006178 Bacteria 6441
38 Ga0075367_10011206 3300006178 Bacteria 4734
39 Ga0075369_10057208 3300006186 Bacteria 1696
40 Ga0097621_100032994 3300006237 Bacteria 4119
41 Ga0075370_10007772 3300006353 Bacteria 5478
42 Ga0068871_100157318 3300006358 Bacteria 1941
43 Ga0075428_100521160 3300006844 Bacteria 1271
44 Ga0075431_100630701 3300006847 Bacteria 1053
45 Ga0075434_100052389 3300006871 Unclassified 4055
46 Ga0075429_100021925 3300006880 Bacteria 5538
47 Ga0105240_10385149 3300009093 Bacteria 1582
48 Ga0105245_11132514 3300009098 Bacteria 829
49 Ga0114129_10453310 3300009147 Bacteria 1682
50 Ga0114129_11446766 3300009147 Bacteria 846
51 Ga0105243_10262319 3300009148 Bacteria 1547
52 Ga0105242_10302059 3300009176 Bacteria 1461
53 Ga0105248_10157494 3300009177 Bacteria 2563
54 Ga0105248_10163099 3300009177 Bacteria 2513
55 Ga0105248_10398820 3300009177 Bacteria 1549
56 Ga0105237_10000440 3300009545 Bacteria 59281
57 Ga0105238_10416272 3300009551 Bacteria 1338
58 Ga0105249_10111215 3300009553 Bacteria 2590
59 Ga0157374_10186549 3300013296 Bacteria 2028
60 Ga0163162_10199256 3300013306 Bacteria 2131
61 Ga0163162_11583772 3300013306 Bacteria 747
62 Ga0157380_10050843 3300014326 Bacteria 3275
63 Ga0157380_10096601 3300014326 Bacteria 2450
64 Ga0157376_10142543 3300014969 Bacteria 2151
65 Ga0157376_10219858 3300014969 Bacteria 1759
66 Ga0157376_10238407 3300014969 Bacteria 1693
67 Ga0163161_10012630 3300017792 Bacteria 5868
68 Ga0209257_1004376 3300025304 Bacteria 10988
69 Ga0209257_1044968 3300025304 Unclassified 1285
70 Ga0207682_10053776 3300025893 Bacteria 1671
71 Ga0207680_10069459 3300025903 Bacteria 2177
72 Ga0207707_10065743 3300025912 Bacteria 3158
73 Ga0207671_10000010 3300025914 Bacteria 568302
74 Ga0207660_10084788 3300025917 Bacteria 2335
75 Ga0207649_10755387 3300025920 Bacteria 757
76 Ga0207652_10019695 3300025921 Bacteria 5552
77 Ga0207646_10142385 3300025922 Bacteria 2160
78 Ga0207644_10000311 3300025931 Bacteria 31659
79 Ga0207686_10481969 3300025934 Bacteria 959
80 Ga0207709_10662564 3300025935 Bacteria 832
81 Ga0207709_10683235 3300025935 Bacteria 820
82 Ga0207670_10949908 3300025936 Bacteria 722
83 Ga0207669_10225567 3300025937 Bacteria 1378
84 Ga0207669_11013786 3300025937 Bacteria 698
85 Ga0207704_10531795 3300025938 Bacteria 952
86 Ga0207691_10047820 3300025940 Bacteria 3924
87 Ga0207691_10286691 3300025940 Bacteria 1416
88 Ga0207711_10114930 3300025941 Bacteria 2397
89 Ga0207711_10563467 3300025941 Bacteria 1063
90 Ga0207689_10473361 3300025942 Bacteria 1048
91 Ga0207712_10441746 3300025961 Bacteria 1102
92 Ga0207668_10026333 3300025972 Bacteria 3775
93 Ga0207658_10306214 3300025986 Bacteria 1371
94 Ga0207703_10952354 3300026035 Bacteria 823
95 Ga0207641_10616163 3300026088 Bacteria 1064
96 Ga0207648_10038361 3300026089 Bacteria 4215
97 Ga0207675_100088243 3300026118 Bacteria 2913
98 Ga0207675_100819724 3300026118 Bacteria 945
99 Ga0207698_10276681 3300026142 Bacteria 1550
100 Ga0268264_10269317 3300028381 Bacteria 1591
101 Ga0307515_10266757 3300028794 Bacteria 1440
102 Ga0265338_10000072 3300028800 Bacteria 182263
103 Ga0265339_10207803 3300031249 Unclassified 963
104 Ga0307513_10008679 3300031456 Bacteria 12948
105 Ga0307408_100017264 3300031548 Bacteria 4828
106 Ga0307516_10404408 3300031730 Bacteria 1024
107 Ga0307405_10150078 3300031731 Bacteria 1637
108 Ga0307413_10056460 3300031824 Bacteria 2395
109 Ga0307413_10116511 3300031824 Bacteria 1800
110 Ga0307410_10014698 3300031852 Bacteria 4618
111 Ga0307410_10148474 3300031852 Bacteria 1742
112 Ga0307406_10012642 3300031901 Bacteria 4813
113 Ga0307406_10116908 3300031901 Bacteria 1846
114 Ga0307407_10212508 3300031903 Bacteria 1303
115 Ga0307407_10260880 3300031903 Bacteria 1192
116 Ga0307407_10475397 3300031903 Bacteria 912
117 Ga0307412_10462069 3300031911 Bacteria 1048
118 Ga0307409_100041404 3300031995 Bacteria 3440
119 Ga0307409_100142705 3300031995 Bacteria 2066
120 Ga0307409_100224530 3300031995 Bacteria 1698
121 Ga0307409_101040098 3300031995 Bacteria 838
122 Ga0307416_100515806 3300032002 Bacteria 1262
123 Ga0307416_101237486 3300032002 Bacteria 852
124 Ga0307414_10358904 3300032004 Bacteria 1253
125 Ga0307411_10012666 3300032005 Bacteria 4615
126 Ga0307411_10044927 3300032005 Bacteria 2838
127 Ga0307411_10137100 3300032005 Bacteria 1799
128 Ga0307415_100223707 3300032126 Bacteria 1510
129 Ga0373942_0094016 3300035207 Bacteria 907
130 Ga0373925_0080664 3300037068 Bacteria 2473
131 Ga0395898_0572422 3300037466 Bacteria 1072
132 Ga0395905_0052198 3300037471 Bacteria 3828
133 Ga0395905_0103938 3300037471 Bacteria 2667
134 Ga0395901_0923232 3300038443 Bacteria 853
135 Ga0436365_0105659 3300039437 Bacteria 1003
136 Ga0436361_0757674 3300039447 Bacteria 1002
137 Ga0439461_0034073 3300041410 Bacteria 1074
138 Ga0439463_061746 3300042016 Bacteria 958
139 Ga0439435_0079942 3300042436 Bacteria 980
140 Ga0439444_0045165 3300042437 Bacteria 878
141 Ga0439464_0146362 3300042439 Bacteria 738
142 Ga0439460_0014658 3300042461 Bacteria 2062
143 Ga0450893_0041565 3300042532 Bacteria 844
144 Ga0439440_0002124 3300042993 Bacteria 3703
145 Ga0466972_0416516 3300044658 Bacteria 630
146 Ga0453684_0961153 3300044712 Bacteria 911
147 Ga0466960_0014007 3300044901 Bacteria 3420
148 Ga0495603_0087592 3300046455 Bacteria 1822
149 Ga0495656_0185006 3300046615 Bacteria 1026
150 Ga0495672_0017570 3300047320 Bacteria 4781
151 Ga0496104_0003590 3300048907 Bacteria 13401
152 Ga0496105_0006555 3300048908 Bacteria 8955
153 Ga0496110_0184712 3300048913 Bacteria 1893
154 Ga0496114_0014539 3300048917 Bacteria 6322
155 Ga0496114_0070173 3300048917 Bacteria 2942
156 Ga0496115_0001104 3300048918 Bacteria 19472
157 Ga0501031_0000810 3300049568 Bacteria 18799
158 Ga0501032_0060938 3300049569 Bacteria 2531
159 Ga0501036_0000066 3300049572 Bacteria 67540
160 Ga0501037_0007621 3300049573 Bacteria 7926
161 Ga0501038_0111811 3300049574 Bacteria 2262
162 Ga0501039_0000380 3300049575 Bacteria 31802
163 Ga0501040_0000744 3300049576 Bacteria 20205
164 Ga0501041_0000702 3300049577 Bacteria 17800
165 Ga0501042_0001054 3300049578 Bacteria 15751
166 Ga0501043_0050295 3300049579 Bacteria 3276
167 Ga0501046_0000046 3300049580 Bacteria 144066
168 Ga0501046_0000595 3300049580 Bacteria 35470
169 Ga0501048_0000213 3300049582 Bacteria 37962
170 Ga0501048_0111348 3300049582 Bacteria 1933
171 Ga0501071_0001040 3300049587 Bacteria 15362
172 Ga0501072_0000303 3300049588 Bacteria 34901
173 Ga0501074_0001971 3300049590 Bacteria 14111
174 Ga0501075_0002238 3300049591 Bacteria 12815
175 Ga0501076_0000264 3300049592 Bacteria 32410
176 Ga0501077_0000998 3300049593 Bacteria 17063
177 Ga0501211_002751 3300049658 Bacteria 1844
178 Ga0501222_000754 3300049662 Bacteria 4687
179 Ga0501223_011841 3300049663 Unclassified 1750
180 Ga0501233_072879 3300049668 Unclassified 873
181 Ga0501249_026100 3300049679 Unclassified 1290
182 Ga0501229_002349 3300049706 Bacteria 2234
183 Ga0501079_0000118 3300049741 Bacteria 41398
184 Ga0501080_0028679 3300049742 Bacteria 5181
185 Ga0501083_0055756 3300049744 Bacteria 2649
186 Ga0501083_0119823 3300049744 Bacteria 1726
187 Ga0501262_018067 3300049759 Bacteria 945
188 Ga0501267_002925 3300049764 Bacteria 1533
189 Ga0501272_004915 3300049769 Unclassified 1399
190 Ga0501035_0017304 3300049822 Bacteria 6646
191 Ga0501045_0000152 3300049824 Bacteria 37014
192 nmdc:mga03683_44072_c1 3300050489 Bacteria 1843
193 nmdc:mga03n38_110750_c1 3300050490 Bacteria 1337
194 nmdc:mga03n38_8684_c1 3300050490 Bacteria 3659
195 nmdc:mga00v17_10756_c1 3300050491 Bacteria 5012
196 nmdc:mga00v17_18317_c1 3300050491 Bacteria 3975
197 nmdc:mga0yw44_38624_c1 3300050492 Bacteria 2826
198 nmdc:mga0k408_122419_c1 3300050493 Bacteria 1541
199 nmdc:mga0k408_68754_c1 3300050493 Bacteria 2066
200 nmdc:mga06z11_118744_c1 3300050494 Bacteria 1473
201 nmdc:mga06z11_6986_c1 3300050494 Bacteria 4627
202 nmdc:mga04h51_176182_c1 3300050495 Bacteria 830
203 nmdc:mga07m45_26881_c1 3300050496 Bacteria 3165
204 nmdc:mga07m45_7618_c1 3300050496 Bacteria 5537
205 nmdc:mga09592_6143_c1 3300050508 Bacteria 9780
206 nmdc:mga09592_890058_c1 3300050508 Bacteria 749
207 nmdc:mga0n895_121098_c1 3300050512 Unclassified 2638
208 nmdc:mga08x19_602467_c1 3300050514 Bacteria 779
209 nmdc:mga0a205_108143_c1 3300050515 Bacteria 2679
210 nmdc:mga0sz30_52488_c1 3300050516 Bacteria 1731
211 Ga0500555_000048 3300053103 Bacteria 61782
212 Ga0500568_0012392 3300053139 Bacteria 3925
213 Ga0500616_0000017 3300053153 Bacteria 622969
214 Ga0500616_0000278 3300053153 Bacteria 75900
215 Ga0500616_0000514 3300053153 Bacteria 48995
216 Ga0500645_000118 3300053730 Bacteria 62173
217 Ga0501084_0000607 3300054114 Bacteria 27348
218 Ga0590075_001485 3300059424 Bacteria 5847
219 Ga0590077_002424 3300059426 Bacteria 4000
220 Ga0501082_0000935 3300060353 Bacteria 25818
221 Ga0530510_0000194 3300061734 Bacteria 37649

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0757674 Ga0436361_0757674_430_975 181
2 3300044712 Ga0453684_0961153 Ga0453684_0961153_308_853 181
3 3300050514 nmdc:mga08x19_602467_c1 nmdc:mga08x19_602467_c1_112_657 181
4 3300044658 Ga0466972_0416516 Ga0466972_0416516_60_620 186
5 3300049580 Ga0501046_0000046 Ga0501046_0000046_6352_6927 186
6 3300005337 Ga0070682_100348389 Ga0070682_1003483892 187
7 3300025304 Ga0209257_1004376 Ga0209257_10043761 191
8 3300047320 Ga0495672_0017570 Ga0495672_0017570_628_1242 191
9 3300044901 Ga0466960_0014007 Ga0466960_0014007_1731_2423 192
10 iso_pu_bacteria 2842134933 2842135357 193
11 3300006048 Ga0075363_100007024 Ga0075363_1000070243 195
12 3300006048 Ga0075363_100007713 Ga0075363_1000077134 195
13 3300006051 Ga0075364_10009896 Ga0075364_100098966 195
14 3300006051 Ga0075364_10017572 Ga0075364_100175722 195
15 3300006178 Ga0075367_10005183 Ga0075367_100051833 195
16 3300006178 Ga0075367_10011206 Ga0075367_100112064 195
17 3300006186 Ga0075369_10057208 Ga0075369_100572082 195
18 3300006353 Ga0075370_10007772 Ga0075370_100077723 195
19 3300031824 Ga0307413_10116511 Ga0307413_101165111 195
20 3300031852 Ga0307410_10014698 Ga0307410_100146984 195
21 3300031903 Ga0307407_10212508 Ga0307407_102125082 195
22 3300031995 Ga0307409_100224530 Ga0307409_1002245302 195
23 3300041410 Ga0439461_0034073 Ga0439461_0034073_404_1009 195
24 3300042436 Ga0439435_0079942 Ga0439435_0079942_207_812 195
25 3300050489 nmdc:mga03683_44072_c1 nmdc:mga03683_44072_c1_908_1495 195
26 3300050490 nmdc:mga03n38_110750_c1 nmdc:mga03n38_110750_c1_281_868 195
27 3300050490 nmdc:mga03n38_8684_c1 nmdc:mga03n38_8684_c1_166_753 195
28 3300050491 nmdc:mga00v17_10756_c1 nmdc:mga00v17_10756_c1_943_1530 195
29 3300050491 nmdc:mga00v17_18317_c1 nmdc:mga00v17_18317_c1_1647_2234 195
30 3300050492 nmdc:mga0yw44_38624_c1 nmdc:mga0yw44_38624_c1_1770_2357 195
31 3300050493 nmdc:mga0k408_122419_c1 nmdc:mga0k408_122419_c1_908_1495 195
32 3300050493 nmdc:mga0k408_68754_c1 nmdc:mga0k408_68754_c1_506_1093 195
33 3300050494 nmdc:mga06z11_118744_c1 nmdc:mga06z11_118744_c1_746_1333 195
34 3300050494 nmdc:mga06z11_6986_c1 nmdc:mga06z11_6986_c1_454_1041 195
35 3300050495 nmdc:mga04h51_176182_c1 nmdc:mga04h51_176182_c1_218_805 195
36 3300050496 nmdc:mga07m45_26881_c1 nmdc:mga07m45_26881_c1_2514_3101 195
37 3300050496 nmdc:mga07m45_7618_c1 nmdc:mga07m45_7618_c1_884_1471 195
38 3300050516 nmdc:mga0sz30_52488_c1 nmdc:mga0sz30_52488_c1_943_1548 195
39 3300005334 Ga0068869_100509511 Ga0068869_1005095112 196
40 3300005367 Ga0070667_100080291 Ga0070667_1000802914 196
41 3300006237 Ga0097621_100032994 Ga0097621_1000329945 196
42 3300009098 Ga0105245_11132514 Ga0105245_111325142 196
43 3300009551 Ga0105238_10416272 Ga0105238_104162722 196
44 3300013296 Ga0157374_10186549 Ga0157374_101865493 196
45 3300014969 Ga0157376_10142543 Ga0157376_101425434 196
46 3300017792 Ga0163161_10012630 Ga0163161_100126302 196
47 3300025935 Ga0207709_10683235 Ga0207709_106832351 196
48 3300025938 Ga0207704_10531795 Ga0207704_105317952 196
49 3300025942 Ga0207689_10473361 Ga0207689_104733612 196
50 3300025986 Ga0207658_10306214 Ga0207658_103062142 196
51 3300026142 Ga0207698_10276681 Ga0207698_102766812 196
52 3300031903 Ga0307407_10475397 Ga0307407_104753972 196
53 3300031995 Ga0307409_101040098 Ga0307409_1010400981 196
54 3300032002 Ga0307416_101237486 Ga0307416_1012374862 196
55 3300048917 Ga0496114_0070173 Ga0496114_0070173_1022_1612 196
56 3300053153 Ga0500616_0000017 Ga0500616_0000017_311938_312531 196
57 3300005981 Ga0081538_10044038 Ga0081538_100440382 197
58 3300006880 Ga0075429_100021925 Ga0075429_1000219253 199
59 3300009093 Ga0105240_10385149 Ga0105240_103851493 199
60 3300031903 Ga0307407_10260880 Ga0307407_102608802 199
61 3300032005 Ga0307411_10137100 Ga0307411_101371003 199
62 3300039437 Ga0436365_0105659 Ga0436365_0105659_338_937 199
63 3300042016 Ga0439463_061746 Ga0439463_061746_211_837 199
64 3300050508 nmdc:mga09592_6143_c1 nmdc:mga09592_6143_c1_799_1401 199
65 3300005336 Ga0070680_100108970 Ga0070680_1001089704 200
66 3300005340 Ga0070689_101210439 Ga0070689_1012104391 200
67 3300005347 Ga0070668_100056065 Ga0070668_1000560654 200
68 3300005353 Ga0070669_100035843 Ga0070669_1000358434 200
69 3300005354 Ga0070675_101471101 Ga0070675_1014711011 200
70 3300005355 Ga0070671_100000115 Ga0070671_10000011531 200
71 3300005356 Ga0070674_100077346 Ga0070674_1000773462 200
72 3300005458 Ga0070681_10014163 Ga0070681_100141634 200
73 3300005459 Ga0068867_100009977 Ga0068867_1000099773 200
74 3300005466 Ga0070685_10203979 Ga0070685_102039792 200
75 3300005530 Ga0070679_100009502 Ga0070679_1000095023 200
76 3300005577 Ga0068857_101186857 Ga0068857_1011868571 200
77 3300005719 Ga0068861_100109029 Ga0068861_1001090294 200
78 3300005719 Ga0068861_100285373 Ga0068861_1002853732 200
79 3300005719 Ga0068861_100583795 Ga0068861_1005837951 200
80 3300005841 Ga0068863_100335317 Ga0068863_1003353172 200
81 3300005981 Ga0081538_10001602 Ga0081538_1000160220 200
82 3300005981 Ga0081538_10011475 Ga0081538_1001147513 200
83 3300005981 Ga0081538_10016327 Ga0081538_100163275 200
84 3300005981 Ga0081538_10022857 Ga0081538_100228572 200
85 3300005981 Ga0081538_10067247 Ga0081538_100672472 200
86 3300005981 Ga0081538_10120882 Ga0081538_101208822 200
87 3300006173 Ga0070716_100537680 Ga0070716_1005376802 200
88 3300006358 Ga0068871_100157318 Ga0068871_1001573182 200
89 3300006844 Ga0075428_100521160 Ga0075428_1005211602 200
90 3300006847 Ga0075431_100630701 Ga0075431_1006307012 200
91 3300006871 Ga0075434_100052389 Ga0075434_1000523894 200
92 3300009147 Ga0114129_11446766 Ga0114129_114467661 200
93 3300009148 Ga0105243_10262319 Ga0105243_102623192 200
94 3300009176 Ga0105242_10302059 Ga0105242_103020592 200
95 3300009177 Ga0105248_10157494 Ga0105248_101574942 200
96 3300009177 Ga0105248_10163099 Ga0105248_101630993 200
97 3300009177 Ga0105248_10398820 Ga0105248_103988201 200
98 3300009545 Ga0105237_10000440 Ga0105237_1000044046 200
99 3300009553 Ga0105249_10111215 Ga0105249_101112152 200
100 3300013306 Ga0163162_10199256 Ga0163162_101992561 200
101 3300013306 Ga0163162_11583772 Ga0163162_115837721 200
102 3300014326 Ga0157380_10050843 Ga0157380_100508433 200
103 3300014326 Ga0157380_10096601 Ga0157380_100966012 200
104 3300014969 Ga0157376_10219858 Ga0157376_102198582 200
105 3300014969 Ga0157376_10238407 Ga0157376_102384072 200
106 3300025304 Ga0209257_1044968 Ga0209257_10449681 200
107 3300025893 Ga0207682_10053776 Ga0207682_100537762 200
108 3300025903 Ga0207680_10069459 Ga0207680_100694592 200
109 3300025912 Ga0207707_10065743 Ga0207707_100657432 200
110 3300025914 Ga0207671_10000010 Ga0207671_10000010418 200
111 3300025917 Ga0207660_10084788 Ga0207660_100847884 200
112 3300025920 Ga0207649_10755387 Ga0207649_107553871 200
113 3300025921 Ga0207652_10019695 Ga0207652_100196953 200
114 3300025931 Ga0207644_10000311 Ga0207644_1000031113 200
115 3300025934 Ga0207686_10481969 Ga0207686_104819691 200
116 3300025935 Ga0207709_10662564 Ga0207709_106625641 200
117 3300025936 Ga0207670_10949908 Ga0207670_109499081 200
118 3300025937 Ga0207669_10225567 Ga0207669_102255672 200
119 3300025937 Ga0207669_11013786 Ga0207669_110137861 200
120 3300025940 Ga0207691_10047820 Ga0207691_100478204 200
121 3300025940 Ga0207691_10286691 Ga0207691_102866912 200
122 3300025941 Ga0207711_10114930 Ga0207711_101149303 200
123 3300025941 Ga0207711_10563467 Ga0207711_105634672 200
124 3300025961 Ga0207712_10441746 Ga0207712_104417462 200
125 3300025972 Ga0207668_10026333 Ga0207668_100263332 200
126 3300026035 Ga0207703_10952354 Ga0207703_109523541 200
127 3300026088 Ga0207641_10616163 Ga0207641_106161632 200
128 3300026089 Ga0207648_10038361 Ga0207648_100383613 200
129 3300026118 Ga0207675_100088243 Ga0207675_1000882433 200
130 3300026118 Ga0207675_100819724 Ga0207675_1008197241 200
131 3300028381 Ga0268264_10269317 Ga0268264_102693172 200
132 3300028794 Ga0307515_10266757 Ga0307515_102667572 200
133 3300028800 Ga0265338_10000072 Ga0265338_1000007283 200
134 3300031456 Ga0307513_10008679 Ga0307513_100086792 200
135 3300031548 Ga0307408_100017264 Ga0307408_1000172642 200
136 3300031730 Ga0307516_10404408 Ga0307516_104044081 200
137 3300031901 Ga0307406_10012642 Ga0307406_100126424 200
138 3300031995 Ga0307409_100041404 Ga0307409_1000414043 200
139 3300031995 Ga0307409_100142705 Ga0307409_1001427053 200
140 3300032005 Ga0307411_10044927 Ga0307411_100449272 200
141 3300035207 Ga0373942_0094016 Ga0373942_0094016_200_802 200
142 3300037068 Ga0373925_0080664 Ga0373925_0080664_1567_2169 200
143 3300037471 Ga0395905_0103938 Ga0395905_0103938_942_1544 200
144 3300042439 Ga0439464_0146362 Ga0439464_0146362_77_679 200
145 3300042532 Ga0450893_0041565 Ga0450893_0041565_193_795 200
146 3300046455 Ga0495603_0087592 Ga0495603_0087592_602_1207 200
147 3300046615 Ga0495656_0185006 Ga0495656_0185006_353_955 200
148 3300048907 Ga0496104_0003590 Ga0496104_0003590_12747_13349 200
149 3300048908 Ga0496105_0006555 Ga0496105_0006555_2034_2636 200
150 3300048913 Ga0496110_0184712 Ga0496110_0184712_39_641 200
151 3300048917 Ga0496114_0014539 Ga0496114_0014539_1329_2006 200
152 3300048918 Ga0496115_0001104 Ga0496115_0001104_15118_15720 200
153 3300049582 Ga0501048_0111348 Ga0501048_0111348_1239_1856 200
154 3300049658 Ga0501211_002751 Ga0501211_002751_1032_1634 200
155 3300049662 Ga0501222_000754 Ga0501222_000754_1062_1664 200
156 3300049663 Ga0501223_011841 Ga0501223_011841_500_1102 200
157 3300049668 Ga0501233_072879 Ga0501233_072879_192_794 200
158 3300049679 Ga0501249_026100 Ga0501249_026100_302_904 200
159 3300049706 Ga0501229_002349 Ga0501229_002349_475_1077 200
160 3300049744 Ga0501083_0119823 Ga0501083_0119823_273_875 200
161 3300049759 Ga0501262_018067 Ga0501262_018067_242_844 200
162 3300049764 Ga0501267_002925 Ga0501267_002925_664_1266 200
163 3300049769 Ga0501272_004915 Ga0501272_004915_328_930 200
164 3300050508 nmdc:mga09592_890058_c1 nmdc:mga09592_890058_c1_42_644 200
165 3300050512 nmdc:mga0n895_121098_c1 nmdc:mga0n895_121098_c1_930_1568 200
166 3300050515 nmdc:mga0a205_108143_c1 nmdc:mga0a205_108143_c1_54_656 200
167 3300053103 Ga0500555_000048 Ga0500555_000048_31649_32251 200
168 3300053139 Ga0500568_0012392 Ga0500568_0012392_1807_2409 200
169 3300053153 Ga0500616_0000278 Ga0500616_0000278_9140_9832 200
170 3300053730 Ga0500645_000118 Ga0500645_000118_17579_18181 200
171 3300005329 Ga0070683_100579708 Ga0070683_1005797081 201
172 3300009147 Ga0114129_10453310 Ga0114129_104533103 201
173 3300025922 Ga0207646_10142385 Ga0207646_101423853 201
174 3300005539 Ga0068853_100771127 Ga0068853_1007711271 202
175 3300005981 Ga0081538_10002268 Ga0081538_100022687 202
176 3300005981 Ga0081538_10003765 Ga0081538_1000376511 202
177 3300031731 Ga0307405_10150078 Ga0307405_101500782 202
178 3300031824 Ga0307413_10056460 Ga0307413_100564603 202
179 3300031852 Ga0307410_10148474 Ga0307410_101484742 202
180 3300031901 Ga0307406_10116908 Ga0307406_101169082 202
181 3300031911 Ga0307412_10462069 Ga0307412_104620691 202
182 3300032002 Ga0307416_100515806 Ga0307416_1005158062 202
183 3300032004 Ga0307414_10358904 Ga0307414_103589042 202
184 3300032005 Ga0307411_10012666 Ga0307411_100126666 202
185 3300032126 Ga0307415_100223707 Ga0307415_1002237072 202
186 3300037466 Ga0395898_0572422 Ga0395898_0572422_186_794 202
187 3300037471 Ga0395905_0052198 Ga0395905_0052198_529_1137 202
188 3300038443 Ga0395901_0923232 Ga0395901_0923232_80_688 202
189 3300042437 Ga0439444_0045165 Ga0439444_0045165_202_810 202
190 3300042461 Ga0439460_0014658 Ga0439460_0014658_504_1112 202
191 3300042993 Ga0439440_0002124 Ga0439440_0002124_2217_2861 202
192 3300049568 Ga0501031_0000810 Ga0501031_0000810_13894_14502 202
193 3300049569 Ga0501032_0060938 Ga0501032_0060938_731_1339 202
194 3300049572 Ga0501036_0000066 Ga0501036_0000066_34715_35323 202
195 3300049573 Ga0501037_0007621 Ga0501037_0007621_6769_7377 202
196 3300049574 Ga0501038_0111811 Ga0501038_0111811_10_618 202
197 3300049575 Ga0501039_0000380 Ga0501039_0000380_740_1348 202
198 3300049576 Ga0501040_0000744 Ga0501040_0000744_14605_15213 202
199 3300049577 Ga0501041_0000702 Ga0501041_0000702_714_1322 202
200 3300049578 Ga0501042_0001054 Ga0501042_0001054_345_953 202
201 3300049579 Ga0501043_0050295 Ga0501043_0050295_1359_1967 202
202 3300049580 Ga0501046_0000595 Ga0501046_0000595_4973_5581 202
203 3300049582 Ga0501048_0000213 Ga0501048_0000213_8763_9371 202
204 3300049587 Ga0501071_0001040 Ga0501071_0001040_9927_10535 202
205 3300049588 Ga0501072_0000303 Ga0501072_0000303_4368_4976 202
206 3300049590 Ga0501074_0001971 Ga0501074_0001971_1727_2335 202
207 3300049591 Ga0501075_0002238 Ga0501075_0002238_5319_5927 202
208 3300049592 Ga0501076_0000264 Ga0501076_0000264_1866_2474 202
209 3300049593 Ga0501077_0000998 Ga0501077_0000998_15845_16453 202
210 3300049741 Ga0501079_0000118 Ga0501079_0000118_24413_25021 202
211 3300049742 Ga0501080_0028679 Ga0501080_0028679_1811_2419 202
212 3300049744 Ga0501083_0055756 Ga0501083_0055756_1267_1875 202
213 3300049822 Ga0501035_0017304 Ga0501035_0017304_824_1432 202
214 3300049824 Ga0501045_0000152 Ga0501045_0000152_5834_6442 202
215 3300054114 Ga0501084_0000607 Ga0501084_0000607_16336_16944 202
216 3300059424 Ga0590075_001485 Ga0590075_001485_1902_2519 202
217 3300059426 Ga0590077_002424 Ga0590077_002424_1858_2475 202
218 3300060353 Ga0501082_0000935 Ga0501082_0000935_23567_24175 202
219 3300061734 Ga0530510_0000194 Ga0530510_0000194_24412_25020 202
220 3300031249 Ga0265339_10207803 Ga0265339_102078032 203
221 3300053153 Ga0500616_0000514 Ga0500616_0000514_28208_28819 203
222 3300003320 rootH2_10034749 rootH2_1003474912 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

19

64

0.88

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

23

62

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x4h-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9352 30 63
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.8891 23 79
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.8878 18 79
5f7q-assembly1.cif.gz_C rok repressor lmo0178 from listeria monocytogenes bound to operator 0.8876 23 80
4wcg-assembly1.cif.gz_A the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.8855 18 79
ID Description Score Start End Superfamily
2x4hA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9461 32 65 1.10.10.10
1ulyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9404 1 87 1.10.10.10
1ulyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9193 1 87 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8996 17 78 1.10.10.10
af_Q57978_7_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8975 25 65 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A662W1U1-F1-model_v4 HTH arsR-type domain-containing protein 0.9835 17 79 GO:0003700
AF-A0A2M9WUP4-F1-model_v4 deleted 0.9712 11 79
AF-A0A359HHX7-F1-model_v4 HTH arsR-type domain-containing protein 0.9707 3 87 GO:0003700
AF-A0A6B1KAE5-F1-model_v4 deleted 0.9685 1 90
AF-A0A7C2W246-F1-model_v4 ArsR family transcriptional regulator 0.9626 2 86 GO:0003700
GO:0005509

Feature Viewer

pLDDT pTM Quality
74.92 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map