F334600

General Info

Members Datasets Scaffolds Average Seq Length
222 118 444 178

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10023374|Ga0265324_100233742
Length 192
Sequence MGPVRAPERTLVMKHASAPGPRKPKAAVRIGVINVSDRASAGVYEDTPGKACVALLLEWLSTPFDVDYRVVADERARIEAELKRMADEAGGTGPAPRDVTPEATAAVCDKLLPGFGEVMRSASLAFVPTAILSRQTAGIRGKTLIINLPGRPKAIRENLGAVFPAIPYCVDLIGGPRLEANESVIKVFRPKG

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
41 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
42 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
43 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
44 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
77 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
107 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
113 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
114 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
115 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
116 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
117 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
118 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 0.9
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0.9
Rhizoplane 0.9
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10023374 3300029957 Bacteria 2202
2 rootH2_10017661 3300003320 Bacteria 25781
3 rootL2_10055567 3300003322 Unclassified 4335
4 rootL2_10185597 3300003322 Bacteria 1162
5 rootL2_10289761 3300003322 Bacteria 1363
6 rootH1_10107725 3300003323 Unclassified 2479
7 rootH1_10176051 3300003323 Unclassified 2534
8 Ga0065704_10272669 3300005289 Bacteria 939
9 Ga0065707_10091906 3300005295 Bacteria 3854
10 Ga0070658_10027345 3300005327 Bacteria 4578
11 Ga0070658_10641685 3300005327 Bacteria 921
12 Ga0070690_100299790 3300005330 Bacteria 1152
13 Ga0070714_100915201 3300005435 Bacteria 852
14 Ga0070713_100008615 3300005436 Bacteria 7245
15 Ga0070678_100030822 3300005456 Bacteria 3691
16 Ga0070698_100756525 3300005471 Bacteria 915
17 Ga0070679_100033881 3300005530 Bacteria 5058
18 Ga0070665_101592562 3300005548 Bacteria 661
19 Ga0068857_100074542 3300005577 Bacteria 3024
20 Ga0068856_100022800 3300005614 Bacteria 6088
21 Ga0070717_10000018 3300006028 Bacteria 195516
22 Ga0075369_10043000 3300006186 Bacteria 1937
23 Ga0068865_100720241 3300006881 Bacteria 854
24 Ga0105250_10000004 3300009092 Bacteria 438653
25 Ga0105245_10693094 3300009098 Bacteria 1051
26 Ga0157374_11437196 3300013296 Bacteria 713
27 Ga0163163_10875951 3300014325 Bacteria 961
28 Ga0157377_11049020 3300014745 Bacteria 621
29 Ga0157379_10001197 3300014968 Bacteria 21117
30 Ga0209130_1011643 3300025284 Bacteria 2345
31 Ga0207696_1000114 3300025711 Bacteria 151422
32 Ga0207705_10087513 3300025909 Bacteria 2278
33 Ga0207649_10440773 3300025920 Bacteria 981
34 Ga0207652_10016304 3300025921 Bacteria 6063
35 Ga0207704_10205094 3300025938 Bacteria 1446
36 Ga0207661_10071013 3300025944 Bacteria 2844
37 Ga0207702_10009132 3300026078 Bacteria 8346
38 Ga0207674_10024392 3300026116 Bacteria 6465
39 Ga0207683_10592169 3300026121 Bacteria 1026
40 Ga0268266_10116639 3300028379 Bacteria 2372
41 Ga0265337_1004727 3300028556 Bacteria 5592
42 Ga0265337_1007962 3300028556 Bacteria 3905
43 Ga0265337_1053136 3300028556 Bacteria 1136
44 Ga0265337_1110892 3300028556 Bacteria 745
45 Ga0265326_10017531 3300028558 Bacteria 2065
46 Ga0265319_1002804 3300028563 Bacteria 9346
47 Ga0265319_1005998 3300028563 Bacteria 5708
48 Ga0265319_1006679 3300028563 Bacteria 5308
49 Ga0265319_1013574 3300028563 Bacteria 3230
50 Ga0265319_1024080 3300028563 Bacteria 2196
51 Ga0265334_10005320 3300028573 Bacteria 5625
52 Ga0265334_10010245 3300028573 Bacteria 3956
53 Ga0265318_10001574 3300028577 Bacteria 13215
54 Ga0265318_10009989 3300028577 Bacteria 4153
55 Ga0265318_10057500 3300028577 Bacteria 1453
56 Ga0265318_10193112 3300028577 Bacteria 745
57 Ga0265323_10008643 3300028653 Bacteria 4191
58 Ga0265323_10011966 3300028653 Bacteria 3487
59 Ga0265323_10131499 3300028653 Bacteria 810
60 Ga0265322_10001494 3300028654 Bacteria 7604
61 Ga0265336_10000405 3300028666 Bacteria 26992
62 Ga0265336_10010706 3300028666 Bacteria 3136
63 Ga0307515_10711243 3300028794 Unclassified 621
64 Ga0265338_10000326 3300028800 Bacteria 86601
65 Ga0265338_10010124 3300028800 Bacteria 11128
66 Ga0265338_10012359 3300028800 Bacteria 9737
67 Ga0265324_10000005 3300029957 Bacteria 347038
68 Ga0265324_10001343 3300029957 Bacteria 14380
69 Ga0265330_10003893 3300031235 Bacteria 7679
70 Ga0265332_10022207 3300031238 Bacteria 2801
71 Ga0265332_10162435 3300031238 Bacteria 933
72 Ga0265328_10057743 3300031239 Bacteria 1425
73 Ga0265328_10078558 3300031239 Bacteria 1216
74 Ga0265320_10001244 3300031240 Bacteria 18699
75 Ga0265320_10001580 3300031240 Bacteria 16359
76 Ga0265320_10002022 3300031240 Bacteria 14313
77 Ga0265320_10005961 3300031240 Bacteria 7746
78 Ga0265320_10008821 3300031240 Bacteria 6135
79 Ga0265320_10024584 3300031240 Bacteria 3184
80 Ga0265320_10035478 3300031240 Bacteria 2527
81 Ga0265320_10084870 3300031240 Bacteria 1474
82 Ga0265320_10113786 3300031240 Bacteria 1238
83 Ga0265320_10357731 3300031240 Bacteria 645
84 Ga0265325_10001873 3300031241 Bacteria 14510
85 Ga0265325_10031795 3300031241 Bacteria 2821
86 Ga0265340_10081621 3300031247 Bacteria 1522
87 Ga0265339_10102142 3300031249 Bacteria 1491
88 Ga0265339_10121111 3300031249 Bacteria 1345
89 Ga0265331_10030768 3300031250 Bacteria 2670
90 Ga0265331_10337204 3300031250 Bacteria 675
91 Ga0265327_10023108 3300031251 Bacteria 3692
92 Ga0265327_10265394 3300031251 Bacteria 762
93 Ga0265316_10023449 3300031344 Bacteria 5184
94 Ga0265316_10061227 3300031344 Bacteria 2924
95 Ga0265316_10076085 3300031344 Bacteria 2580
96 Ga0265316_10086015 3300031344 Bacteria 2404
97 Ga0265316_10130553 3300031344 Bacteria 1892
98 Ga0265316_10173594 3300031344 Bacteria 1607
99 Ga0265316_10486461 3300031344 Bacteria 883
100 Ga0265313_10002957 3300031595 Bacteria 14178
101 Ga0265313_10002984 3300031595 Bacteria 14110
102 Ga0265313_10004740 3300031595 Bacteria 10255
103 Ga0265313_10007993 3300031595 Bacteria 7103
104 Ga0265313_10009234 3300031595 Bacteria 6426
105 Ga0265313_10009881 3300031595 Bacteria 6134
106 Ga0265313_10111540 3300031595 Bacteria 1202
107 Ga0265314_10002857 3300031711 Bacteria 17181
108 Ga0265314_10011688 3300031711 Bacteria 7224
109 Ga0265314_10013402 3300031711 Bacteria 6623
110 Ga0265314_10024823 3300031711 Bacteria 4535
111 Ga0265314_10049469 3300031711 Bacteria 2943
112 Ga0265314_10158528 3300031711 Bacteria 1380
113 Ga0265314_10242098 3300031711 Bacteria 1040
114 Ga0265314_10308403 3300031711 Bacteria 885
115 Ga0265314_10387828 3300031711 Bacteria 758
116 Ga0265342_10005089 3300031712 Bacteria 10130
117 Ga0265342_10033636 3300031712 Bacteria 3150
118 Ga0265342_10311126 3300031712 Bacteria 827
119 Ga0307516_10265298 3300031730 Bacteria 1406
120 Ga0307405_10397846 3300031731 Bacteria 1077
121 Ga0307410_10286804 3300031852 Bacteria 1294
122 Ga0307406_10122041 3300031901 Bacteria 1814
123 Ga0307407_10432582 3300031903 Bacteria 951
124 Ga0307409_100555568 3300031995 Bacteria 1128
125 Ga0307414_10299519 3300032004 Unclassified 1360
126 Ga0316593_10002063 3300032168 Bacteria 4653
127 Ga0316593_10030127 3300032168 Bacteria 1759
128 Ga0373934_0130795 3300035086 Bacteria 1024
129 Ga0373937_0702009 3300036401 Bacteria 958
130 Ga0316582_0656478 3300036647 Bacteria 721
131 Ga0395905_0000036 3300037471 Bacteria 271733
132 Ga0395905_0044842 3300037471 Bacteria 4148
133 Ga0395901_0182072 3300038443 Bacteria 2204
134 Ga0395901_0326247 3300038443 Bacteria 1588
135 Ga0436365_1071739 3300039437 Bacteria 768
136 Ga0451791_1346765 3300041451 Bacteria 625
137 Ga0451807_2063159 3300041486 Bacteria 989
138 Ga0451837_1673076 3300041494 Bacteria 669
139 Ga0451849_0797148 3300041505 Bacteria 1149
140 Ga0451577_0009670 3300042876 Bacteria 9252
141 Ga0451577_0043874 3300042876 Bacteria 4004
142 Ga0451577_0172033 3300042876 Bacteria 1952
143 Ga0451577_0898412 3300042876 Bacteria 798
144 Ga0453683_0000003 3300044673 Bacteria 942572
145 Ga0453683_0000376 3300044673 Bacteria 53325
146 Ga0453683_0049682 3300044673 Bacteria 2629
147 Ga0453684_0000002 3300044712 Bacteria 1731375
148 Ga0453684_0018234 3300044712 Bacteria 10794
149 Ga0453684_0096539 3300044712 Bacteria 3630
150 Ga0453684_0188559 3300044712 Bacteria 2414
151 Ga0453684_0899819 3300044712 Bacteria 948
152 Ga0453684_1132547 3300044712 Bacteria 825
153 Ga0453684_1328931 3300044712 Bacteria 749
154 Ga0466968_0194320 3300044735 Bacteria 948
155 Ga0466957_0055705 3300044842 Bacteria 2417
156 Ga0451576_0000004 3300045051 Bacteria 1312238
157 Ga0451576_0000030 3300045051 Bacteria 403352
158 Ga0451576_0000071 3300045051 Bacteria 258795
159 Ga0451576_0000548 3300045051 Bacteria 80649
160 Ga0451576_0002181 3300045051 Bacteria 30265
161 Ga0451576_0028002 3300045051 Bacteria 6041
162 Ga0451576_0042588 3300045051 Bacteria 4793
163 Ga0451576_0049886 3300045051 Bacteria 4392
164 Ga0451576_0319057 3300045051 Bacteria 1626
165 Ga0451576_2082559 3300045051 Bacteria 584
166 Ga0466967_0007288 3300045976 Bacteria 7961
167 Ga0495630_0745829 3300046517 Bacteria 748
168 Ga0495622_0180489 3300046557 Bacteria 947
169 Ga0501031_0003074 3300049568 Bacteria 10670
170 Ga0501032_0000795 3300049569 Bacteria 25595
171 Ga0501032_0020129 3300049569 Bacteria 4652
172 Ga0501032_0593478 3300049569 Bacteria 705
173 Ga0501033_0004351 3300049570 Bacteria 11349
174 Ga0501033_0005766 3300049570 Bacteria 9747
175 Ga0501033_0151886 3300049570 Bacteria 1670
176 Ga0501034_0199348 3300049571 Bacteria 1960
177 Ga0501036_0000906 3300049572 Bacteria 22209
178 Ga0501037_0001553 3300049573 Bacteria 16756
179 Ga0501038_0000802 3300049574 Bacteria 27895
180 Ga0501038_0098227 3300049574 Bacteria 2442
181 Ga0501039_0007072 3300049575 Bacteria 8548
182 Ga0501039_0766177 3300049575 Bacteria 753
183 Ga0501042_0005611 3300049578 Bacteria 8090
184 Ga0501043_0025861 3300049579 Bacteria 4604
185 Ga0501046_0010314 3300049580 Bacteria 8035
186 Ga0501046_0018906 3300049580 Bacteria 5722
187 Ga0501046_0031408 3300049580 Bacteria 4304
188 Ga0501046_0153066 3300049580 Bacteria 1739
189 Ga0501047_0021189 3300049581 Bacteria 6241
190 Ga0501047_0029200 3300049581 Bacteria 5319
191 Ga0501047_0043952 3300049581 Bacteria 4315
192 Ga0501047_0543870 3300049581 Bacteria 986
193 Ga0501048_0004619 3300049582 Bacteria 10477
194 Ga0501067_0335254 3300049583 Bacteria 843
195 Ga0501070_0038184 3300049586 Bacteria 4007
196 Ga0501070_0210950 3300049586 Bacteria 1594
197 Ga0501243_006372 3300049675 Bacteria 1786
198 Ga0501079_0799146 3300049741 Bacteria 743
199 Ga0501080_0033638 3300049742 Bacteria 4785
200 Ga0501080_0103671 3300049742 Bacteria 2638
201 Ga0501083_0002148 3300049744 Bacteria 13525
202 Ga0501083_0028686 3300049744 Bacteria 3834
203 Ga0501263_019743 3300049760 Unclassified 900
204 Ga0501269_039040 3300049766 Unclassified 628
205 Ga0501035_0002199 3300049822 Bacteria 19351
206 Ga0501035_0018673 3300049822 Bacteria 6386
207 Ga0501035_0291136 3300049822 Bacteria 1378
208 Ga0501035_0350709 3300049822 Bacteria 1235
209 Ga0501035_0908443 3300049822 Bacteria 697
210 Ga0501044_0005550 3300049823 Bacteria 14007
211 Ga0501044_0046933 3300049823 Bacteria 4469
212 Ga0501044_0082289 3300049823 Bacteria 3257
213 Ga0501044_0100564 3300049823 Bacteria 2909
214 nmdc:mga0sz30_10877_c1 3300050516 Bacteria 3498
215 Ga0500568_0004324 3300053139 Bacteria 7618
216 Ga0590071_112203 3300059421 Unclassified 692
217 Ga0466962_0118396 3300061719 Bacteria 1277
218 2545675171 2545555834 Bacteria 8130841
219 2673162613 2671180531 Bacteria 9045424
220 2788437187 2786546940 Bacteria 6396474
221 2854682107 2854681122 Bacteria 4548679
222 641645787 641522639 Bacteria 7737025
223 Ga0265324_10023374
224 rootH2_10017661
225 rootL2_10055567
226 rootL2_10185597
227 rootL2_10289761
228 rootH1_10107725
229 rootH1_10176051
230 Ga0065704_10272669
231 Ga0065707_10091906
232 Ga0070658_10027345
233 Ga0070658_10641685
234 Ga0070690_100299790
235 Ga0070714_100915201
236 Ga0070713_100008615
237 Ga0070678_100030822
238 Ga0070698_100756525
239 Ga0070679_100033881
240 Ga0070665_101592562
241 Ga0068857_100074542
242 Ga0068856_100022800
243 Ga0070717_10000018
244 Ga0075369_10043000
245 Ga0068865_100720241
246 Ga0105250_10000004
247 Ga0105245_10693094
248 Ga0157374_11437196
249 Ga0163163_10875951
250 Ga0157377_11049020
251 Ga0157379_10001197
252 Ga0209130_1011643
253 Ga0207696_1000114
254 Ga0207705_10087513
255 Ga0207649_10440773
256 Ga0207652_10016304
257 Ga0207704_10205094
258 Ga0207661_10071013
259 Ga0207702_10009132
260 Ga0207674_10024392
261 Ga0207683_10592169
262 Ga0268266_10116639
263 Ga0265337_1004727
264 Ga0265337_1007962
265 Ga0265337_1053136
266 Ga0265337_1110892
267 Ga0265326_10017531
268 Ga0265319_1002804
269 Ga0265319_1005998
270 Ga0265319_1006679
271 Ga0265319_1013574
272 Ga0265319_1024080
273 Ga0265334_10005320
274 Ga0265334_10010245
275 Ga0265318_10001574
276 Ga0265318_10009989
277 Ga0265318_10057500
278 Ga0265318_10193112
279 Ga0265323_10008643
280 Ga0265323_10011966
281 Ga0265323_10131499
282 Ga0265322_10001494
283 Ga0265336_10000405
284 Ga0265336_10010706
285 Ga0307515_10711243
286 Ga0265338_10000326
287 Ga0265338_10010124
288 Ga0265338_10012359
289 Ga0265324_10000005
290 Ga0265324_10001343
291 Ga0265330_10003893
292 Ga0265332_10022207
293 Ga0265332_10162435
294 Ga0265328_10057743
295 Ga0265328_10078558
296 Ga0265320_10001244
297 Ga0265320_10001580
298 Ga0265320_10002022
299 Ga0265320_10005961
300 Ga0265320_10008821
301 Ga0265320_10024584
302 Ga0265320_10035478
303 Ga0265320_10084870
304 Ga0265320_10113786
305 Ga0265320_10357731
306 Ga0265325_10001873
307 Ga0265325_10031795
308 Ga0265340_10081621
309 Ga0265339_10102142
310 Ga0265339_10121111
311 Ga0265331_10030768
312 Ga0265331_10337204
313 Ga0265327_10023108
314 Ga0265327_10265394
315 Ga0265316_10023449
316 Ga0265316_10061227
317 Ga0265316_10076085
318 Ga0265316_10086015
319 Ga0265316_10130553
320 Ga0265316_10173594
321 Ga0265316_10486461
322 Ga0265313_10002957
323 Ga0265313_10002984
324 Ga0265313_10004740
325 Ga0265313_10007993
326 Ga0265313_10009234
327 Ga0265313_10009881
328 Ga0265313_10111540
329 Ga0265314_10002857
330 Ga0265314_10011688
331 Ga0265314_10013402
332 Ga0265314_10024823
333 Ga0265314_10049469
334 Ga0265314_10158528
335 Ga0265314_10242098
336 Ga0265314_10308403
337 Ga0265314_10387828
338 Ga0265342_10005089
339 Ga0265342_10033636
340 Ga0265342_10311126
341 Ga0307516_10265298
342 Ga0307405_10397846
343 Ga0307410_10286804
344 Ga0307406_10122041
345 Ga0307407_10432582
346 Ga0307409_100555568
347 Ga0307414_10299519
348 Ga0316593_10002063
349 Ga0316593_10030127
350 Ga0373934_0130795
351 Ga0373937_0702009
352 Ga0316582_0656478
353 Ga0395905_0000036
354 Ga0395905_0044842
355 Ga0395901_0182072
356 Ga0395901_0326247
357 Ga0436365_1071739
358 Ga0451791_1346765
359 Ga0451807_2063159
360 Ga0451837_1673076
361 Ga0451849_0797148
362 Ga0451577_0009670
363 Ga0451577_0043874
364 Ga0451577_0172033
365 Ga0451577_0898412
366 Ga0453683_0000003
367 Ga0453683_0000376
368 Ga0453683_0049682
369 Ga0453684_0000002
370 Ga0453684_0018234
371 Ga0453684_0096539
372 Ga0453684_0188559
373 Ga0453684_0899819
374 Ga0453684_1132547
375 Ga0453684_1328931
376 Ga0466968_0194320
377 Ga0466957_0055705
378 Ga0451576_0000004
379 Ga0451576_0000030
380 Ga0451576_0000071
381 Ga0451576_0000548
382 Ga0451576_0002181
383 Ga0451576_0028002
384 Ga0451576_0042588
385 Ga0451576_0049886
386 Ga0451576_0319057
387 Ga0451576_2082559
388 Ga0466967_0007288
389 Ga0495630_0745829
390 Ga0495622_0180489
391 Ga0501031_0003074
392 Ga0501032_0000795
393 Ga0501032_0020129
394 Ga0501032_0593478
395 Ga0501033_0004351
396 Ga0501033_0005766
397 Ga0501033_0151886
398 Ga0501034_0199348
399 Ga0501036_0000906
400 Ga0501037_0001553
401 Ga0501038_0000802
402 Ga0501038_0098227
403 Ga0501039_0007072
404 Ga0501039_0766177
405 Ga0501042_0005611
406 Ga0501043_0025861
407 Ga0501046_0010314
408 Ga0501046_0018906
409 Ga0501046_0031408
410 Ga0501046_0153066
411 Ga0501047_0021189
412 Ga0501047_0029200
413 Ga0501047_0043952
414 Ga0501047_0543870
415 Ga0501048_0004619
416 Ga0501067_0335254
417 Ga0501070_0038184
418 Ga0501070_0210950
419 Ga0501243_006372
420 Ga0501079_0799146
421 Ga0501080_0033638
422 Ga0501080_0103671
423 Ga0501083_0002148
424 Ga0501083_0028686
425 Ga0501263_019743
426 Ga0501269_039040
427 Ga0501035_0002199
428 Ga0501035_0018673
429 Ga0501035_0291136
430 Ga0501035_0350709
431 Ga0501035_0908443
432 Ga0501044_0005550
433 Ga0501044_0046933
434 Ga0501044_0082289
435 Ga0501044_0100564
436 nmdc:mga0sz30_10877_c1
437 Ga0500568_0004324
438 Ga0590071_112203
439 Ga0466962_0118396
440 2545675171
441 2673162613
442 2788437187
443 2854682107
444 641645787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

31

168

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mci-assembly1.cif.gz_A crystal structure of molybdenum cofactor biosynthesis (aq_061) from aquifex aeolicus vf5 0.9913 2 175
8cuu-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9892 2 172
4nwo-assembly1.cif.gz_A computationally designed two-component self-assembling tetrahedral cage t33-15 0.9884 2 172
8cuw-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9883 2 172
8cuv-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9866 2 174
ID Description Score Start End Superfamily
4xcwB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9613 1 175 3.40.980.10
4xcwB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9507 1 175 3.40.980.10
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9446 2 156 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9388 2 157 3.40.980.10
1di6A00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9185 1 174 3.40.980.10
ID Description Score Start End GO Terms
AF-B5JJ70-F1-model_v4 MoaB/Mog domain-containing protein 0.9968 1 174 GO:0006777
AF-A0A2M7N7J4-F1-model_v4 Molybdopterin adenylyltransferase 0.9938 45 174 GO:0006777
GO:0016779
AF-A0A2J6X044-F1-model_v4 Molybdopterin adenylyltransferase 0.9927 45 175 GO:0006777
GO:0016779
AF-A0A2D3WI81-F1-model_v4 Molybdopterin adenylyltransferase 0.9922 3 175 GO:0006777
GO:0016779
AF-A0A259NSE8-F1-model_v4 Molybdopterin adenylyltransferase 0.9919 21 175 GO:0006777
GO:0016779

Map