F334372

General Info

Members Datasets Scaffolds Average Seq Length
222 123 223 193

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10325859|Ga0105240_103258592
Length 221
Sequence LPRAAPIPFFGRNYHCPETQFGETVSELNERTTMTAGIIGMAAIGIYNKLVTMRNRYKNAYAQIDVQLKRRYDLIPNLVETAKGYMKHESGTLTAVTEARNIAYAASKNAASNPGDASAMKNLVSAEAGLGGALSRLMVVSEQYPDLKANQNMMQLTEELTSTENKISFARQAYNDAVMTYNTDREVFPSNLLAGMFNFMAAELFVIDKPEEKVAPKVSFS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
13 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
41 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
42 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
63 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
64 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
65 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
66 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
67 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0.45
Rhizosphere 95.95
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10123101 3300003320 Bacteria 1862
2 rootH1_10004144 3300003316 Bacteria 5124
3 rootH1_10004144 3300003323 Bacteria 6742
4 Ga0070683_101002875 3300005329 Bacteria 802
5 Ga0070691_10071405 3300005341 Bacteria 1685
6 Ga0070701_10311617 3300005438 Bacteria 971
7 Ga0070711_100006039 3300005439 Bacteria 7271
8 Ga0070711_101055099 3300005439 Bacteria 699
9 Ga0070681_10097945 3300005458 Bacteria 2879
10 Ga0070684_100100496 3300005535 Bacteria 2583
11 Ga0070697_101283047 3300005536 Bacteria 653
12 Ga0068855_100025087 3300005563 Bacteria 7137
13 Ga0068855_100158849 3300005563 Bacteria 2567
14 Ga0068855_100185625 3300005563 Bacteria 2349
15 Ga0068855_100272264 3300005563 Bacteria 1883
16 Ga0068855_100501595 3300005563 Bacteria 1319
17 Ga0068856_100005652 3300005614 Bacteria 12308
18 Ga0068856_100509056 3300005614 Bacteria 1225
19 Ga0068856_100702916 3300005614 Bacteria 1031
20 Ga0070715_10079987 3300006163 Bacteria 1481
21 Ga0070716_100032518 3300006173 Bacteria 2845
22 Ga0075428_100187327 3300006844 Bacteria 2239
23 Ga0075430_100189266 3300006846 Bacteria 1711
24 Ga0075431_100100940 3300006847 Bacteria 2977
25 Ga0075434_100505479 3300006871 Bacteria 1229
26 Ga0075436_100096924 3300006914 Bacteria 2052
27 Ga0075435_100464242 3300007076 Bacteria 1092
28 Ga0099794_10088079 3300007265 Bacteria 1538
29 Ga0105240_10076717 3300009093 Bacteria 4120
30 Ga0105240_10325859 3300009093 Bacteria 1749
31 Ga0105240_11127153 3300009093 Bacteria 834
32 Ga0111539_11195898 3300009094 Bacteria 883
33 Ga0111539_11540715 3300009094 Bacteria 771
34 Ga0105238_10004182 3300009551 Bacteria 14328
35 Ga0105238_10006351 3300009551 Bacteria 11756
36 Ga0157370_10171810 3300013104 Bacteria 2015
37 Ga0157370_10342051 3300013104 Bacteria 1379
38 Ga0157374_10385369 3300013296 Bacteria 1397
39 Ga0157372_10270284 3300013307 Bacteria 1975
40 Ga0157375_11351609 3300013308 Bacteria 838
41 Ga0163163_10217644 3300014325 Bacteria 1959
42 Ga0207699_10358104 3300025906 Bacteria 1031
43 Ga0207707_10076895 3300025912 Bacteria 2913
44 Ga0207707_10169803 3300025912 Bacteria 1906
45 Ga0207695_10030400 3300025913 Bacteria 5945
46 Ga0207695_10271058 3300025913 Bacteria 1593
47 Ga0207695_10583346 3300025913 Bacteria 999
48 Ga0207663_10092139 3300025916 Bacteria 2014
49 Ga0207660_10539778 3300025917 Bacteria 948
50 Ga0207652_10478992 3300025921 Bacteria 1121
51 Ga0207694_10058720 3300025924 Bacteria 2992
52 Ga0207665_10224708 3300025939 Bacteria 1377
53 Ga0207667_10028613 3300025949 Bacteria 6051
54 Ga0207667_10049867 3300025949 Bacteria 4419
55 Ga0207667_10079562 3300025949 Bacteria 3397
56 Ga0207667_10271932 3300025949 Bacteria 1732
57 Ga0207667_10325730 3300025949 Bacteria 1569
58 Ga0207667_10347000 3300025949 Bacteria 1514
59 Ga0207702_10000259 3300026078 Bacteria 61188
60 Ga0207702_10524792 3300026078 Bacteria 1156
61 Ga0209974_10127635 3300027876 Bacteria 905
62 Ga0265337_1001401 3300028556 Bacteria 11833
63 Ga0265337_1002879 3300028556 Bacteria 7675
64 Ga0265337_1007667 3300028556 Bacteria 4015
65 Ga0265337_1032268 3300028556 Bacteria 1550
66 Ga0265326_10046255 3300028558 Bacteria 1234
67 Ga0265319_1000001 3300028563 Bacteria 549513
68 Ga0265319_1006257 3300028563 Bacteria 5538
69 Ga0265319_1013427 3300028563 Bacteria 3257
70 Ga0265334_10003741 3300028573 Bacteria 6877
71 Ga0265334_10038382 3300028573 Bacteria 1884
72 Ga0265318_10009032 3300028577 Bacteria 4407
73 Ga0265318_10015049 3300028577 Bacteria 3230
74 Ga0265318_10144015 3300028577 Bacteria 875
75 Ga0265323_10000005 3300028653 Bacteria 196003
76 Ga0265323_10001379 3300028653 Bacteria 12026
77 Ga0265323_10022127 3300028653 Bacteria 2431
78 Ga0265323_10024216 3300028653 Bacteria 2310
79 Ga0265323_10025147 3300028653 Bacteria 2257
80 Ga0265322_10005452 3300028654 Bacteria 3764
81 Ga0265322_10029123 3300028654 Bacteria 1578
82 Ga0265336_10000586 3300028666 Bacteria 20502
83 Ga0265336_10038943 3300028666 Bacteria 1458
84 Ga0265336_10063123 3300028666 Bacteria 1110
85 Ga0265338_10001233 3300028800 Bacteria 42256
86 Ga0265338_10002413 3300028800 Bacteria 28135
87 Ga0265338_10002424 3300028800 Bacteria 28039
88 Ga0265338_10002727 3300028800 Bacteria 25922
89 Ga0265338_10003378 3300028800 Bacteria 22540
90 Ga0265338_10004460 3300028800 Bacteria 18885
91 Ga0265338_10007493 3300028800 Bacteria 13521
92 Ga0265338_10010087 3300028800 Bacteria 11161
93 Ga0265338_10010551 3300028800 Bacteria 10805
94 Ga0265338_10012838 3300028800 Bacteria 9521
95 Ga0265338_10022704 3300028800 Bacteria 6480
96 Ga0265338_10026583 3300028800 Bacteria 5831
97 Ga0265338_10036396 3300028800 Bacteria 4711
98 Ga0265338_10038685 3300028800 Bacteria 4514
99 Ga0265338_10077868 3300028800 Bacteria 2800
100 Ga0265338_10088107 3300028800 Bacteria 2577
101 Ga0265338_10168529 3300028800 Bacteria 1683
102 Ga0265338_10193940 3300028800 Bacteria 1537
103 Ga0265338_10224875 3300028800 Bacteria 1399
104 Ga0265338_10248678 3300028800 Bacteria 1313
105 Ga0265338_10318171 3300028800 Bacteria 1127
106 Ga0265338_10361702 3300028800 Bacteria 1041
107 Ga0265324_10000250 3300029957 Bacteria 39869
108 Ga0265324_10010062 3300029957 Bacteria 3664
109 Ga0265324_10019094 3300029957 Bacteria 2471
110 Ga0265324_10046061 3300029957 Bacteria 1501
111 Ga0265324_10070572 3300029957 Bacteria 1190
112 Ga0265324_10105203 3300029957 Bacteria 958
113 Ga0265328_10016593 3300031239 Bacteria 2862
114 Ga0265328_10083352 3300031239 Bacteria 1179
115 Ga0265320_10009003 3300031240 Bacteria 6054
116 Ga0265320_10027832 3300031240 Bacteria 2942
117 Ga0265320_10225798 3300031240 Bacteria 833
118 Ga0265325_10021501 3300031241 Bacteria 3543
119 Ga0265325_10202117 3300031241 Bacteria 916
120 Ga0265329_10067194 3300031242 Bacteria 1134
121 Ga0265340_10000417 3300031247 Bacteria 22826
122 Ga0265340_10045405 3300031247 Bacteria 2146
123 Ga0265340_10098750 3300031247 Bacteria 1359
124 Ga0265339_10021129 3300031249 Bacteria 3793
125 Ga0265339_10170360 3300031249 Bacteria 1090
126 Ga0265339_10194305 3300031249 Bacteria 1004
127 Ga0265327_10000985 3300031251 Bacteria 40550
128 Ga0265327_10199688 3300031251 Bacteria 906
129 Ga0265316_10003749 3300031344 Bacteria 15275
130 Ga0265316_10010177 3300031344 Bacteria 8589
131 Ga0265316_10012679 3300031344 Bacteria 7544
132 Ga0265316_10015674 3300031344 Bacteria 6613
133 Ga0265316_10018484 3300031344 Bacteria 5988
134 Ga0265316_10194029 3300031344 Bacteria 1507
135 Ga0265316_10245473 3300031344 Bacteria 1316
136 Ga0265316_10286486 3300031344 Bacteria 1203
137 Ga0265316_10416482 3300031344 Bacteria 966
138 Ga0265316_10578549 3300031344 Bacteria 798
139 Ga0265313_10002406 3300031595 Bacteria 16202
140 Ga0265313_10008078 3300031595 Bacteria 7047
141 Ga0316579_10154472 3300031691 Bacteria 1108
142 Ga0265314_10036268 3300031711 Bacteria 3585
143 Ga0265342_10004167 3300031712 Bacteria 11507
144 Ga0373948_0022817 3300034817 Bacteria 1209
145 Ga0373928_0000446 3300035084 Bacteria 8154
146 Ga0373949_0001423 3300035090 Bacteria 6846
147 Ga0373932_0000003 3300035112 Bacteria 459351
148 Ga0373939_0051068 3300035114 Bacteria 1284
149 Ga0373962_0000059 3300035242 Bacteria 23801
150 Ga0373931_0000054 3300035691 Bacteria 58930
151 Ga0373935_0036692 3300035692 Bacteria 3066
152 Ga0373927_0023953 3300035695 Bacteria 3993
153 Ga0373927_0034255 3300035695 Bacteria 3304
154 Ga0373933_0110808 3300035724 Bacteria 1712
155 Ga0373937_0003731 3300036401 Bacteria 12873
156 Ga0316582_0573829 3300036647 Bacteria 777
157 Ga0373925_0000299 3300037068 Bacteria 51930
158 Ga0373925_0058591 3300037068 Bacteria 2888
159 Ga0395900_0066168 3300037418 Bacteria 3714
160 Ga0395901_0363778 3300038443 Bacteria 1491
161 Ga0395901_1012588 3300038443 Bacteria 806
162 Ga0400490_20719 3300038726 Bacteria 2365
163 Ga0400490_35456 3300038726 Bacteria 3251
164 Ga0400483_055203 3300039062 Bacteria 2250
165 Ga0400483_161293 3300039062 Bacteria 1443
166 Ga0400489_88884 3300039093 Bacteria 1163
167 Ga0436361_0421006 3300039447 Bacteria 1116
168 Ga0450913_003606 3300042117 Bacteria 1022
169 Ga0451577_0006758 3300042876 Bacteria 11378
170 Ga0451577_0389166 3300042876 Bacteria 1265
171 Ga0466972_0000098 3300044658 Bacteria 76807
172 Ga0453683_0040455 3300044673 Bacteria 2927
173 Ga0466965_0001399 3300044683 Bacteria 9708
174 Ga0466964_0016294 3300044706 Bacteria 2836
175 Ga0466964_0081078 3300044706 Bacteria 1393
176 Ga0453684_0001424 3300044712 Bacteria 68740
177 Ga0453684_0063077 3300044712 Bacteria 4743
178 Ga0453684_0081480 3300044712 Bacteria 4036
179 Ga0466968_0009868 3300044735 Bacteria 3685
180 Ga0466968_0269414 3300044735 Bacteria 812
181 Ga0466960_0093975 3300044901 Bacteria 1533
182 Ga0451576_0000526 3300045051 Bacteria 83427
183 Ga0451576_0280274 3300045051 Bacteria 1743
184 Ga0495592_0149720 3300046454 Bacteria 1615
185 Ga0495592_0343839 3300046454 Bacteria 958
186 Ga0495603_0092759 3300046455 Bacteria 1765
187 Ga0495618_0005160 3300046514 Bacteria 7983
188 Ga0495628_0108708 3300046516 Bacteria 2135
189 Ga0495628_0140952 3300046516 Bacteria 1840
190 Ga0495630_0191734 3300046517 Bacteria 1559
191 Ga0495652_0128486 3300046529 Bacteria 2010
192 Ga0495652_0310565 3300046529 Bacteria 1143
193 Ga0495640_0019523 3300046533 Bacteria 5001
194 Ga0495586_0000121 3300046535 Bacteria 47320
195 Ga0495634_0010245 3300046642 Bacteria 6867
196 Ga0495657_0145154 3300046675 Bacteria 1477
197 Ga0495599_0290564 3300046678 Bacteria 988
198 Ga0495613_0001229 3300046689 Bacteria 19576
199 Ga0495600_0220326 3300046809 Bacteria 1214
200 Ga0495604_0261822 3300047317 Bacteria 1175
201 Ga0495680_0015893 3300047322 Bacteria 6480
202 Ga0495675_0550434 3300047444 Bacteria 658
203 Ga0496115_0002172 3300048918 Bacteria 14041
204 Ga0495682_0178713 3300049460 Bacteria 754
205 Ga0501031_0004532 3300049568 Bacteria 9003
206 Ga0501032_0085816 3300049569 Bacteria 2092
207 Ga0501033_0000212 3300049570 Bacteria 55695
208 Ga0501033_0012625 3300049570 Bacteria 6448
209 Ga0501036_0266433 3300049572 Bacteria 1435
210 Ga0501037_0068230 3300049573 Bacteria 2589
211 Ga0501043_0762022 3300049579 Bacteria 703
212 Ga0501047_0443858 3300049581 Bacteria 1127
213 Ga0501035_0004959 3300049822 Bacteria 12624
214 Ga0501035_0016283 3300049822 Bacteria 6859
215 Ga0501044_0000024 3300049823 Bacteria 194302
216 Ga0501044_0225496 3300049823 Bacteria 1823
217 Ga0501045_0326597 3300049824 Bacteria 1142
218 nmdc:mga09592_144974_c1 3300050508 Bacteria 2047
219 nmdc:mga0qj67_191448_c1 3300050509 Bacteria 1662
220 nmdc:mga08x19_27772_c1 3300050514 Bacteria 3541
221 nmdc:mga08x19_66101_c1 3300050514 Bacteria 2349
222 nmdc:mga0a205_425575_c1 3300050515 Bacteria 1189
223 Ga0500595_076311 3300053119 Bacteria 987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028653 Ga0265323_10025147 Ga0265323_100251472 178
2 3300006871 Ga0075434_100505479 Ga0075434_1005054792 180
3 3300028800 Ga0265338_10001233 Ga0265338_1000123315 180
4 3300028800 Ga0265338_10010087 Ga0265338_100100872 180
5 3300028800 Ga0265338_10022704 Ga0265338_100227043 180
6 3300028800 Ga0265338_10224875 Ga0265338_102248752 180
7 3300046454 Ga0495592_0149720 Ga0495592_0149720_78_680 180
8 3300046516 Ga0495628_0140952 Ga0495628_0140952_229_831 180
9 3300046529 Ga0495652_0128486 Ga0495652_0128486_810_1412 180
10 3300046809 Ga0495600_0220326 Ga0495600_0220326_497_1099 180
11 3300047317 Ga0495604_0261822 Ga0495604_0261822_407_1009 180
12 3300047444 Ga0495675_0550434 Ga0495675_0550434_17_619 180
13 3300028800 Ga0265338_10026583 Ga0265338_100265835 182
14 3300046516 Ga0495628_0108708 Ga0495628_0108708_59_658 182
15 3300049579 Ga0501043_0762022 Ga0501043_0762022_61_693 182
16 3300050508 nmdc:mga09592_144974_c1 nmdc:mga09592_144974_c1_1052_1696 182
17 3300050509 nmdc:mga0qj67_191448_c1 nmdc:mga0qj67_191448_c1_512_1156 182
18 3300005563 Ga0068855_100025087 Ga0068855_1000250875 183
19 3300005614 Ga0068856_100005652 Ga0068856_1000056529 183
20 3300025949 Ga0207667_10028613 Ga0207667_100286132 183
21 3300026078 Ga0207702_10000259 Ga0207702_100002597 183
22 3300028563 Ga0265319_1006257 Ga0265319_10062572 183
23 3300028577 Ga0265318_10009032 Ga0265318_100090321 183
24 3300028800 Ga0265338_10036396 Ga0265338_100363962 183
25 3300028800 Ga0265338_10088107 Ga0265338_100881072 183
26 3300031242 Ga0265329_10067194 Ga0265329_100671942 183
27 3300034817 Ga0373948_0022817 Ga0373948_0022817_522_1127 183
28 3300046454 Ga0495592_0343839 Ga0495592_0343839_70_672 183
29 3300046678 Ga0495599_0290564 Ga0495599_0290564_318_920 183
30 3300005439 Ga0070711_100006039 Ga0070711_1000060394 184
31 3300005563 Ga0068855_100158849 Ga0068855_1001588492 184
32 3300006846 Ga0075430_100189266 Ga0075430_1001892662 184
33 3300025916 Ga0207663_10092139 Ga0207663_100921392 184
34 3300025949 Ga0207667_10079562 Ga0207667_100795623 184
35 3300028556 Ga0265337_1007667 Ga0265337_10076671 184
36 3300028577 Ga0265318_10144015 Ga0265318_101440151 184
37 3300028666 Ga0265336_10038943 Ga0265336_100389432 184
38 3300028666 Ga0265336_10063123 Ga0265336_100631231 184
39 3300028800 Ga0265338_10038685 Ga0265338_100386852 184
40 3300035084 Ga0373928_0000446 Ga0373928_0000446_708_1310 184
41 3300035090 Ga0373949_0001423 Ga0373949_0001423_4466_5068 184
42 3300035112 Ga0373932_0000003 Ga0373932_0000003_233626_234228 184
43 3300035114 Ga0373939_0051068 Ga0373939_0051068_200_802 184
44 3300035242 Ga0373962_0000059 Ga0373962_0000059_20455_21057 184
45 3300035691 Ga0373931_0000054 Ga0373931_0000054_35728_36330 184
46 3300035692 Ga0373935_0036692 Ga0373935_0036692_1469_2071 184
47 3300035695 Ga0373927_0023953 Ga0373927_0023953_110_712 184
48 3300037068 Ga0373925_0000299 Ga0373925_0000299_48180_48782 184
49 3300044706 Ga0466964_0081078 Ga0466964_0081078_771_1361 184
50 3300049570 Ga0501033_0000212 Ga0501033_0000212_52018_52629 184
51 3300049573 Ga0501037_0068230 Ga0501037_0068230_901_1512 184
52 3300049581 Ga0501047_0443858 Ga0501047_0443858_35_646 184
53 3300049822 Ga0501035_0016283 Ga0501035_0016283_4971_5582 184
54 3300049823 Ga0501044_0225496 Ga0501044_0225496_875_1486 184
55 3300005536 Ga0070697_101283047 Ga0070697_1012830471 185
56 3300031251 Ga0265327_10199688 Ga0265327_101996882 185
57 3300048918 Ga0496115_0002172 Ga0496115_0002172_3398_4009 185
58 3300009093 Ga0105240_10325859 Ga0105240_103258592 186
59 3300028653 Ga0265323_10000005 Ga0265323_10000005114 186
60 3300028654 Ga0265322_10005452 Ga0265322_100054522 186
61 3300028800 Ga0265338_10318171 Ga0265338_103181711 186
62 3300031344 Ga0265316_10003749 Ga0265316_100037492 186
63 3300031712 Ga0265342_10004167 Ga0265342_100041679 186
64 3300046455 Ga0495603_0092759 Ga0495603_0092759_768_1370 186
65 3300046675 Ga0495657_0145154 Ga0495657_0145154_394_996 186
66 3300005341 Ga0070691_10071405 Ga0070691_100714051 187
67 3300028556 Ga0265337_1001401 Ga0265337_10014018 187
68 3300028558 Ga0265326_10046255 Ga0265326_100462552 187
69 3300028563 Ga0265319_1013427 Ga0265319_10134272 187
70 3300028573 Ga0265334_10003741 Ga0265334_100037412 187
71 3300028577 Ga0265318_10015049 Ga0265318_100150492 187
72 3300028654 Ga0265322_10029123 Ga0265322_100291232 187
73 3300028666 Ga0265336_10000586 Ga0265336_100005869 187
74 3300028800 Ga0265338_10003378 Ga0265338_100033785 187
75 3300028800 Ga0265338_10007493 Ga0265338_100074935 187
76 3300029957 Ga0265324_10010062 Ga0265324_100100622 187
77 3300031239 Ga0265328_10083352 Ga0265328_100833522 187
78 3300031240 Ga0265320_10225798 Ga0265320_102257981 187
79 3300031241 Ga0265325_10021501 Ga0265325_100215012 187
80 3300031247 Ga0265340_10098750 Ga0265340_100987502 187
81 3300031249 Ga0265339_10021129 Ga0265339_100211293 187
82 3300031344 Ga0265316_10194029 Ga0265316_101940291 187
83 3300031344 Ga0265316_10578549 Ga0265316_105785491 187
84 3300031595 Ga0265313_10008078 Ga0265313_100080785 187
85 3300031711 Ga0265314_10036268 Ga0265314_100362682 187
86 3300037418 Ga0395900_0066168 Ga0395900_0066168_764_1354 187
87 3300046529 Ga0495652_0310565 Ga0495652_0310565_254_856 187
88 3300005563 Ga0068855_100272264 Ga0068855_1002722642 188
89 3300005614 Ga0068856_100509056 Ga0068856_1005090562 188
90 3300005614 Ga0068856_100702916 Ga0068856_1007029161 188
91 3300006173 Ga0070716_100032518 Ga0070716_1000325182 188
92 3300009551 Ga0105238_10006351 Ga0105238_100063518 188
93 3300025906 Ga0207699_10358104 Ga0207699_103581042 188
94 3300025913 Ga0207695_10583346 Ga0207695_105833462 188
95 3300025924 Ga0207694_10058720 Ga0207694_100587203 188
96 3300025939 Ga0207665_10224708 Ga0207665_102247082 188
97 3300025949 Ga0207667_10271932 Ga0207667_102719322 188
98 3300028556 Ga0265337_1002879 Ga0265337_10028793 188
99 3300028800 Ga0265338_10077868 Ga0265338_100778682 188
100 3300031240 Ga0265320_10009003 Ga0265320_100090033 188
101 3300031247 Ga0265340_10045405 Ga0265340_100454051 188
102 3300044901 Ga0466960_0093975 Ga0466960_0093975_87_674 188
103 3300031344 Ga0265316_10286486 Ga0265316_102864862 189
104 3300005563 Ga0068855_100185625 Ga0068855_1001856252 190
105 3300009093 Ga0105240_10076717 Ga0105240_100767175 190
106 3300009551 Ga0105238_10004182 Ga0105238_100041821 190
107 3300013307 Ga0157372_10270284 Ga0157372_102702842 190
108 3300025913 Ga0207695_10271058 Ga0207695_102710582 190
109 3300025949 Ga0207667_10347000 Ga0207667_103470002 190
110 3300026078 Ga0207702_10524792 Ga0207702_105247922 190
111 3300028800 Ga0265338_10248678 Ga0265338_102486782 190
112 3300031249 Ga0265339_10170360 Ga0265339_101703601 190
113 3300049568 Ga0501031_0004532 Ga0501031_0004532_902_1540 190
114 3300049569 Ga0501032_0085816 Ga0501032_0085816_883_1521 190
115 3300049822 Ga0501035_0004959 Ga0501035_0004959_154_792 190
116 3300049823 Ga0501044_0000024 Ga0501044_0000024_156082_156720 190
117 3300005329 Ga0070683_101002875 Ga0070683_1010028751 191
118 3300005535 Ga0070684_100100496 Ga0070684_1001004964 191
119 3300013104 Ga0157370_10342051 Ga0157370_103420512 191
120 3300025913 Ga0207695_10030400 Ga0207695_100304004 191
121 3300028800 Ga0265338_10193940 Ga0265338_101939401 191
122 3300029957 Ga0265324_10019094 Ga0265324_100190942 191
123 3300031247 Ga0265340_10000417 Ga0265340_100004174 191
124 3300013104 Ga0157370_10171810 Ga0157370_101718103 192
125 3300013308 Ga0157375_11351609 Ga0157375_113516091 192
126 3300028653 Ga0265323_10001379 Ga0265323_100013798 192
127 3300028653 Ga0265323_10022127 Ga0265323_100221272 192
128 3300028800 Ga0265338_10002424 Ga0265338_1000242419 192
129 3300028800 Ga0265338_10168529 Ga0265338_101685291 192
130 3300029957 Ga0265324_10000250 Ga0265324_100002504 192
131 3300031241 Ga0265325_10202117 Ga0265325_102021171 192
132 3300031344 Ga0265316_10012679 Ga0265316_100126794 192
133 3300031344 Ga0265316_10245473 Ga0265316_102454731 192
134 3300003323 rootH1_10004144 rootH1_100041444 193
135 3300005438 Ga0070701_10311617 Ga0070701_103116171 193
136 3300005458 Ga0070681_10097945 Ga0070681_100979452 193
137 3300006163 Ga0070715_10079987 Ga0070715_100799873 193
138 3300006844 Ga0075428_100187327 Ga0075428_1001873272 193
139 3300006847 Ga0075431_100100940 Ga0075431_1001009402 193
140 3300006914 Ga0075436_100096924 Ga0075436_1000969242 193
141 3300007076 Ga0075435_100464242 Ga0075435_1004642421 193
142 3300007265 Ga0099794_10088079 Ga0099794_100880791 193
143 3300009094 Ga0111539_11195898 Ga0111539_111958981 193
144 3300009094 Ga0111539_11540715 Ga0111539_115407151 193
145 3300025912 Ga0207707_10076895 Ga0207707_100768953 193
146 3300025949 Ga0207667_10049867 Ga0207667_100498671 193
147 3300027876 Ga0209974_10127635 Ga0209974_101276352 193
148 3300029957 Ga0265324_10070572 Ga0265324_100705721 193
149 3300031691 Ga0316579_10154472 Ga0316579_101544722 193
150 3300036647 Ga0316582_0573829 Ga0316582_0573829_15_602 193
151 3300042117 Ga0450913_003606 Ga0450913_003606_14_601 193
152 3300049572 Ga0501036_0266433 Ga0501036_0266433_800_1387 193
153 3300050514 nmdc:mga08x19_27772_c1 nmdc:mga08x19_27772_c1_2307_2894 193
154 3300050514 nmdc:mga08x19_66101_c1 nmdc:mga08x19_66101_c1_625_1212 193
155 3300050515 nmdc:mga0a205_425575_c1 nmdc:mga0a205_425575_c1_131_733 193
156 3300005439 Ga0070711_101055099 Ga0070711_1010550991 194
157 3300014325 Ga0163163_10217644 Ga0163163_102176442 194
158 3300038443 Ga0395901_0363778 Ga0395901_0363778_793_1476 194
159 3300038443 Ga0395901_1012588 Ga0395901_1012588_173_763 194
160 3300039447 Ga0436361_0421006 Ga0436361_0421006_139_729 194
161 3300042876 Ga0451577_0389166 Ga0451577_0389166_14_604 194
162 3300044658 Ga0466972_0000098 Ga0466972_0000098_4976_5566 194
163 3300044673 Ga0453683_0040455 Ga0453683_0040455_25_615 194
164 3300044683 Ga0466965_0001399 Ga0466965_0001399_6576_7166 194
165 3300044706 Ga0466964_0016294 Ga0466964_0016294_2113_2703 194
166 3300044712 Ga0453684_0001424 Ga0453684_0001424_5231_5821 194
167 3300044735 Ga0466968_0009868 Ga0466968_0009868_2578_3168 194
168 3300044735 Ga0466968_0269414 Ga0466968_0269414_198_788 194
169 3300045051 Ga0451576_0000526 Ga0451576_0000526_14099_14689 194
170 3300028556 Ga0265337_1032268 Ga0265337_10322682 195
171 3300028800 Ga0265338_10002413 Ga0265338_1000241321 195
172 3300028800 Ga0265338_10002727 Ga0265338_100027276 195
173 3300028800 Ga0265338_10010551 Ga0265338_100105515 195
174 3300031249 Ga0265339_10194305 Ga0265339_101943052 195
175 3300031344 Ga0265316_10010177 Ga0265316_100101773 195
176 3300035724 Ga0373933_0110808 Ga0373933_0110808_288_890 195
177 3300036401 Ga0373937_0003731 Ga0373937_0003731_6132_6734 195
178 3300038726 Ga0400490_20719 Ga0400490_20719_147_743 195
179 3300038726 Ga0400490_35456 Ga0400490_35456_437_1033 195
180 3300039062 Ga0400483_055203 Ga0400483_055203_93_689 195
181 3300039062 Ga0400483_161293 Ga0400483_161293_259_855 195
182 3300039093 Ga0400489_88884 Ga0400489_88884_551_1147 195
183 3300042876 Ga0451577_0006758 Ga0451577_0006758_3114_3749 195
184 3300044712 Ga0453684_0081480 Ga0453684_0081480_1858_2493 195
185 3300046514 Ga0495618_0005160 Ga0495618_0005160_2887_3489 195
186 3300046517 Ga0495630_0191734 Ga0495630_0191734_625_1227 195
187 3300046533 Ga0495640_0019523 Ga0495640_0019523_3334_3936 195
188 3300046535 Ga0495586_0000121 Ga0495586_0000121_44201_44803 195
189 3300046642 Ga0495634_0010245 Ga0495634_0010245_4175_4777 195
190 3300046689 Ga0495613_0001229 Ga0495613_0001229_10112_10714 195
191 3300047322 Ga0495680_0015893 Ga0495680_0015893_5718_6320 195
192 3300049824 Ga0501045_0326597 Ga0501045_0326597_282_872 195
193 3300028653 Ga0265323_10024216 Ga0265323_100242162 196
194 3300031251 Ga0265327_10000985 Ga0265327_1000098534 196
195 3300031344 Ga0265316_10015674 Ga0265316_100156742 196
196 3300031344 Ga0265316_10018484 Ga0265316_100184844 196
197 3300031344 Ga0265316_10416482 Ga0265316_104164821 196
198 3300044712 Ga0453684_0063077 Ga0453684_0063077_1588_2181 196
199 3300005563 Ga0068855_100501595 Ga0068855_1005015952 197
200 3300009093 Ga0105240_11127153 Ga0105240_111271532 197
201 3300013296 Ga0157374_10385369 Ga0157374_103853692 197
202 3300025912 Ga0207707_10169803 Ga0207707_101698031 197
203 3300025917 Ga0207660_10539778 Ga0207660_105397781 197
204 3300025921 Ga0207652_10478992 Ga0207652_104789921 197
205 3300025949 Ga0207667_10325730 Ga0207667_103257302 197
206 3300028573 Ga0265334_10038382 Ga0265334_100383822 197
207 3300028800 Ga0265338_10004460 Ga0265338_1000446013 197
208 3300028800 Ga0265338_10012838 Ga0265338_100128386 197
209 3300031239 Ga0265328_10016593 Ga0265328_100165933 197
210 3300045051 Ga0451576_0280274 Ga0451576_0280274_269_895 197
211 3300049460 Ga0495682_0178713 Ga0495682_0178713_21_629 197
212 3300049570 Ga0501033_0012625 Ga0501033_0012625_1590_2198 197
213 3300053119 Ga0500595_076311 Ga0500595_076311_338_949 197
214 3300028800 Ga0265338_10361702 Ga0265338_103617022 198
215 3300029957 Ga0265324_10046061 Ga0265324_100460612 198
216 3300029957 Ga0265324_10105203 Ga0265324_101052032 198
217 3300035695 Ga0373927_0034255 Ga0373927_0034255_1637_2251 198
218 3300037068 Ga0373925_0058591 Ga0373925_0058591_693_1307 198
219 3300003320 rootH2_10123101 rootH2_101231012 199
220 3300028563 Ga0265319_1000001 Ga0265319_1000001151 199
221 3300031240 Ga0265320_10027832 Ga0265320_100278322 199
222 3300031595 Ga0265313_10002406 Ga0265313_1000240612 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

60

220

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9155 28 184
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.8782 28 184
2lqg-assembly1.cif.gz_A solution structure of the r4 domain of talin 0.719 37 156
2lqg-assembly1.cif.gz_A solution structure of the r4 domain of talin 0.6363 37 156
7qhb-assembly1.cif.gz_I active state of glua1/2 in complex with tarp gamma 8, l-glutamate and ctz 0.6351 71 159
ID Description Score Start End Superfamily
4iggA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.9597 65 122 1.10.287.160
4iggB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.9121 62 122 1.10.287.160
4iggB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.8446 62 122 1.10.287.160
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8393 20 199 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8303 20 199 1.20.1440.20
ID Description Score Start End GO Terms
AF-A0A848Z4X2-F1-model_v4 LemA family protein 0.9946 4 185 GO:0016020
AF-A0A1Z4SM94-F1-model_v4 deleted 0.983 9 152
AF-A0A2E2RDE3-F1-model_v4 LemA family protein 0.9818 1 187 GO:0016020
AF-A0A836T8L0-F1-model_v4 deleted 0.9805 8 169
AF-A0A258PZ28-F1-model_v4 deleted 0.9804 11 164

Feature Viewer

pLDDT pTM Quality
85.43 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map