F333977

General Info

Members Datasets Scaffolds Average Seq Length
222 169 444 110

Family's Representative Sequence

Representative Sequence 3300000546|LJNas_1000681|LJNas_10006812
Length 122
Sequence MERNAGRAGSQGMKRGEIWLVSLDPTSGHEQQGRRPVLIVSPDPFNRVTKVPVVVPITSGGNFARGAGFAVSLTGVGTRTTGIVRCDQPRALDLAARSGKKLESVPEAIMDEVLARLTPIFD

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
16 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
26 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
34 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
37 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
49 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
61 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
62 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
63 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
73 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
74 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
75 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
83 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
152 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
153 2636415599 Klebsiella variicola DX120E Isolate Unclassified
154 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
155 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
156 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
157 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
158 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
159 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
160 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
161 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
162 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
163 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
164 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
165 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
166 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
167 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
168 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
169 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.44
Metatranscriptomes 0
Isolates 8.56

Biome Distribution

Category Percentage (%)
Aerial Root 1.8
Bulb 0
Endosphere 0.45
Nodule 0.9
Rhizoplane 2.25
Rhizosphere 73.42
Stem 0
Stem Tuber 0
Unclassified 20.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000681 3300000546 Bacteria 5740
2 LJNas_1008001 3300000546 Bacteria 1139
3 Ga0070691_10847740 3300005341 Bacteria 560
4 Ga0070669_100150870 3300005353 Bacteria 1799
5 Ga0070714_100616033 3300005435 Bacteria 1043
6 Ga0070711_100129426 3300005439 Unclassified 1878
7 Ga0068867_101902712 3300005459 Bacteria 561
8 Ga0070707_100394163 3300005468 Bacteria 1344
9 Ga0070699_100165241 3300005518 Unclassified 1960
10 Ga0070693_101033211 3300005547 Unclassified 623
11 Ga0070665_100479409 3300005548 Bacteria 1255
12 Ga0068856_101042327 3300005614 Unclassified 836
13 Ga0070716_100009266 3300006173 Bacteria 4906
14 Ga0070712_100001734 3300006175 Bacteria 13345
15 Ga0075430_100729568 3300006846 Bacteria 817
16 Ga0075430_101029069 3300006846 Bacteria 678
17 Ga0079104_1000382 3300006946 Bacteria 51488
18 Ga0099795_10083444 3300007788 Unclassified 1227
19 Ga0099795_10083914 3300007788 Bacteria 1224
20 Ga0105251_10002305 3300009011 Bacteria 15132
21 Ga0105244_10022224 3300009036 Bacteria 3494
22 Ga0105244_10085650 3300009036 Bacteria 1555
23 Ga0105250_10006569 3300009092 Bacteria 5063
24 Ga0105240_10314561 3300009093 Unclassified 1787
25 Ga0105240_10439342 3300009093 Bacteria 1462
26 Ga0105241_10176296 3300009174 Bacteria 1770
27 Ga0105248_10877744 3300009177 Bacteria 1013
28 Ga0105237_12489404 3300009545 Unclassified 528
29 Ga0105249_11853742 3300009553 Unclassified 676
30 Ga0105029_103301 3300009984 Bacteria 1075
31 Ga0099796_10000305 3300010159 Bacteria 7790
32 Ga0099796_10252315 3300010159 Unclassified 733
33 Ga0105246_10165441 3300011119 Bacteria 1689
34 Ga0157373_10056630 3300013100 Bacteria 2783
35 Ga0157373_10113917 3300013100 Bacteria 1900
36 Ga0157373_10750142 3300013100 Bacteria 717
37 Ga0157373_10850748 3300013100 Unclassified 675
38 Ga0157371_10004555 3300013102 Bacteria 12063
39 Ga0157371_10013566 3300013102 Bacteria 6186
40 Ga0157370_10000711 3300013104 Bacteria 41727
41 Ga0157372_10310666 3300013307 Bacteria 1835
42 Ga0157372_11094881 3300013307 Bacteria 922
43 Ga0182007_10083914 3300015262 Unclassified 1046
44 Ga0213872_10061595 3300021361 Bacteria 1696
45 Ga0213874_10019513 3300021377 Unclassified 1846
46 Ga0213876_10000034 3300021384 Bacteria 202967
47 Ga0213876_10035903 3300021384 Bacteria 2614
48 Ga0213876_10087292 3300021384 Bacteria 1651
49 Ga0213876_10319382 3300021384 Unclassified 826
50 Ga0213871_10070716 3300021441 Bacteria 985
51 Ga0207696_1000058 3300025711 Bacteria 248495
52 Ga0207655_1004665 3300025728 Bacteria 9609
53 Ga0207692_10676017 3300025898 Bacteria 669
54 Ga0207685_10256158 3300025905 Bacteria 848
55 Ga0207654_10241212 3300025911 Bacteria 1208
56 Ga0207693_10003632 3300025915 Bacteria 13175
57 Ga0207663_10116365 3300025916 Unclassified 1823
58 Ga0207646_10730516 3300025922 Bacteria 884
59 Ga0207664_10448426 3300025929 Bacteria 1151
60 Ga0207669_11414604 3300025937 Bacteria 592
61 Ga0207665_10022033 3300025939 Bacteria 4189
62 Ga0207665_10911078 3300025939 Bacteria 698
63 Ga0209281_1000006 3300027111 Bacteria 1170244
64 Ga0209371_1013464 3300027312 Bacteria 2293
65 Ga0209371_1074643 3300027312 Bacteria 596
66 Ga0209179_1040285 3300027512 Bacteria 982
67 Ga0268266_10177003 3300028379 Bacteria 1940
68 Ga0307515_10103715 3300028794 Bacteria 3406
69 Ga0268256_1031553 3300030500 Bacteria 1270
70 Ga0268256_1082916 3300030500 Bacteria 596
71 Ga0265325_10344984 3300031241 Unclassified 658
72 Ga0265331_10387551 3300031250 Unclassified 626
73 Ga0265327_10012107 3300031251 Bacteria 5854
74 Ga0307513_10027098 3300031456 Bacteria 6587
75 Ga0307513_10877517 3300031456 Bacteria 604
76 Ga0316575_10191627 3300031665 Bacteria 850
77 Ga0307516_10509727 3300031730 Bacteria 857
78 Ga0316214_1012555 3300033545 Bacteria 1157
79 Ga0373934_0082080 3300035086 Bacteria 1296
80 Ga0373945_0313288 3300035116 Bacteria 674
81 Ga0373954_0012646 3300035118 Bacteria 3755
82 Ga0373935_0611378 3300035692 Bacteria 798
83 Ga0373927_0011415 3300035695 Bacteria 5918
84 Ga0373947_0050973 3300035725 Bacteria 2489
85 Ga0373947_0856983 3300035725 Unclassified 620
86 Ga0373937_0028928 3300036401 Bacteria 5017
87 Ga0373925_0000328 3300037068 Bacteria 49421
88 Ga0373925_0149140 3300037068 Bacteria 1835
89 Ga0395900_0416632 3300037418 Unclassified 1305
90 Ga0395898_0042216 3300037466 Bacteria 4501
91 Ga0436364_0865551 3300037853 Bacteria 901
92 Ga0436364_1477097 3300037853 Bacteria 600
93 Ga0400484_13127 3300038725 Bacteria 2063
94 Ga0400488_19372 3300038741 Bacteria 1475
95 Ga0400489_79181 3300039093 Unclassified 1287
96 Ga0400487_05774 3300039110 Bacteria 2202
97 Ga0400487_08426 3300039110 Bacteria 3365
98 Ga0436365_0048989 3300039437 Bacteria 2675
99 Ga0436365_0965775 3300039437 Bacteria 470291
100 Ga0436365_1349633 3300039437 Unclassified 1057
101 Ga0436365_1712420 3300039437 Bacteria 6016
102 Ga0436365_1814822 3300039437 Unclassified 826
103 Ga0436360_1131157 3300039438 Bacteria 2815
104 Ga0436361_0057378 3300039447 Bacteria 1287
105 Ga0436361_0890967 3300039447 Bacteria 1809
106 Ga0436361_0979536 3300039447 Unclassified 1240
107 Ga0436361_1080946 3300039447 Bacteria 2647
108 Ga0436363_0410179 3300039450 Bacteria 2809
109 Ga0436363_1667662 3300039450 Unclassified 694
110 Ga0436362_0044149 3300039453 Unclassified 1196
111 Ga0436362_1073045 3300039453 Bacteria 1512
112 Ga0439465_0033912 3300041413 Bacteria 1633
113 Ga0451807_1174013 3300041486 Bacteria 564
114 Ga0439452_000001 3300042010 Bacteria 1725439
115 Ga0451577_0003566 3300042876 Bacteria 17152
116 Ga0451577_1975672 3300042876 Unclassified 510
117 Ga0466969_0030793 3300044656 Bacteria 2733
118 Ga0466961_0064979 3300044693 Bacteria 2319
119 Ga0466963_0923275 3300044694 Unclassified 615
120 Ga0453684_0066659 3300044712 Bacteria 4583
121 Ga0453684_0083158 3300044712 Bacteria 3985
122 Ga0453684_1083645 3300044712 Unclassified 847
123 Ga0453684_2046378 3300044712 Bacteria 576
124 Ga0451576_0000295 3300045051 Bacteria 121139
125 Ga0451576_1963636 3300045051 Unclassified 603
126 Ga0495627_011139 3300046453 Bacteria 3237
127 Ga0495603_0094994 3300046455 Bacteria 1742
128 Ga0495591_009431 3300046458 Bacteria 3883
129 Ga0495650_0000265 3300046471 Bacteria 100744
130 Ga0495650_0006499 3300046471 Bacteria 7267
131 Ga0495580_0016927 3300046472 Bacteria 5463
132 Ga0495605_0000221 3300046474 Bacteria 70254
133 Ga0495583_0000368 3300046506 Bacteria 70160
134 Ga0495606_0001030 3300046507 Bacteria 40419
135 Ga0495610_0070811 3300046512 Bacteria 1627
136 Ga0495610_0074079 3300046512 Bacteria 1580
137 Ga0495616_0284278 3300046513 Unclassified 702
138 Ga0495620_0000191 3300046515 Bacteria 46699
139 Ga0495630_0936582 3300046517 Bacteria 659
140 Ga0495637_0006483 3300046520 Bacteria 5872
141 Ga0495648_0005853 3300046524 Bacteria 10120
142 Ga0495642_0046537 3300046528 Bacteria 1775
143 Ga0495654_0002455 3300046530 Bacteria 11934
144 Ga0495654_0109874 3300046530 Bacteria 1259
145 Ga0495609_0111509 3300046538 Bacteria 1180
146 Ga0495661_0000568 3300046665 Bacteria 38311
147 Ga0495670_0039050 3300046691 Bacteria 2367
148 Ga0495671_0054146 3300046692 Bacteria 1989
149 Ga0495649_0100191 3300046694 Bacteria 1540
150 Ga0495589_0004098 3300046794 Bacteria 7803
151 Ga0495660_0017776 3300046810 Bacteria 4090
152 Ga0495672_0000001 3300047320 Bacteria 1458820
153 Ga0495683_0000147 3300047323 Bacteria 68938
154 Ga0495679_003095 3300047446 Bacteria 8158
155 Ga0495673_0002032 3300047469 Bacteria 14857
156 Ga0495684_0281099 3300047471 Unclassified 1201
157 Ga0495684_0613739 3300047471 Unclassified 732
158 Ga0496101_0014024 3300048904 Bacteria 5382
159 Ga0496116_0000929 3300048919 Bacteria 36119
160 Ga0496117_0001735 3300048920 Bacteria 30177
161 Ga0496117_0119787 3300048920 Bacteria 1620
162 Ga0496118_0011209 3300048921 Bacteria 8777
163 Ga0496118_0196819 3300048921 Bacteria 1198
164 Ga0496119_0138262 3300048922 Bacteria 1318
165 Ga0496120_0135279 3300048923 Bacteria 1257
166 Ga0496122_0006527 3300048925 Bacteria 13355
167 Ga0496122_0026472 3300048925 Bacteria 4997
168 Ga0496123_0003051 3300048926 Bacteria 19262
169 Ga0496123_0059105 3300048926 Bacteria 2481
170 Ga0496123_0061978 3300048926 Bacteria 2399
171 Ga0496124_0014449 3300048927 Bacteria 7634
172 Ga0496124_0169115 3300048927 Bacteria 1695
173 Ga0496125_0032209 3300048928 Bacteria 4660
174 Ga0496125_0308689 3300048928 Bacteria 965
175 Ga0495678_000254 3300049459 Bacteria 59650
176 Ga0501033_0912545 3300049570 Unclassified 590
177 Ga0501036_1471673 3300049572 Unclassified 551
178 Ga0501038_0431724 3300049574 Bacteria 1015
179 Ga0501038_0488172 3300049574 Unclassified 943
180 Ga0501039_0015677 3300049575 Bacteria 5798
181 Ga0501039_1517459 3300049575 Unclassified 515
182 Ga0501041_0274619 3300049577 Unclassified 1060
183 Ga0501042_0600351 3300049578 Unclassified 800
184 Ga0501048_0970447 3300049582 Unclassified 611
185 Ga0501068_0024559 3300049584 Bacteria 3541
186 Ga0501071_0259172 3300049587 Unclassified 1313
187 Ga0501072_0000464 3300049588 Bacteria 29314
188 Ga0501074_0418489 3300049590 Unclassified 950
189 Ga0501074_1287692 3300049590 Unclassified 512
190 Ga0501075_0073266 3300049591 Bacteria 2590
191 Ga0501076_0063207 3300049592 Bacteria 2949
192 Ga0501079_0027479 3300049741 Bacteria 4363
193 Ga0501080_0450225 3300049742 Unclassified 1154
194 Ga0501081_0211836 3300049743 Unclassified 1407
195 nmdc:mga0qj67_835238_c1 3300050509 Bacteria 728
196 Ga0495601_0006191 3300053077 Bacteria 6987
197 Ga0495595_0022228 3300053084 Bacteria 2782
198 Ga0500644_0259839 3300053088 Unclassified 734
199 Ga0501084_0000096 3300054114 Bacteria 65139
200 Ga0501084_0170267 3300054114 Unclassified 1838
201 Ga0501084_0498275 3300054114 Bacteria 1029
202 Ga0501084_1083604 3300054114 Unclassified 673
203 Ga0530510_0082622 3300061734 Bacteria 2339
204 2599926180 2599185299 Bacteria 4854625
205 2609909938 2609459761 Bacteria 5513740
206 2637224336 2636415599 Bacteria 5718434
207 2650899699 2648501693 Bacteria 5069560
208 2686353833 2684622997 Bacteria 4624240
209 2739352241 2738543031 Bacteria 5769731
210 2844534954 2844533157 Bacteria 7517899
211 2847799301 2847797336 Bacteria 5176640
212 2852104055 2852103415 Bacteria 5193810
213 2904514755 2904513164 Bacteria 5476410
214 2908673820 2908669403 Bacteria 5740494
215 2969081380 2969079654 Bacteria 5439582
216 2978978893 2978975091 Bacteria 4704313
217 2984497140 2984494565 Bacteria 5000175
218 2984563842 2984559226 Bacteria 5683096
219 2984596575 2984595703 Bacteria 5682994
220 2990261096 2990261002 Bacteria 4919493
221 8016735266 8016733728 Bacteria 5274317
222 8019501256 8019499862 Bacteria 5169538
223 LJNas_1000681
224 LJNas_1008001
225 Ga0070691_10847740
226 Ga0070669_100150870
227 Ga0070714_100616033
228 Ga0070711_100129426
229 Ga0068867_101902712
230 Ga0070707_100394163
231 Ga0070699_100165241
232 Ga0070693_101033211
233 Ga0070665_100479409
234 Ga0068856_101042327
235 Ga0070716_100009266
236 Ga0070712_100001734
237 Ga0075430_100729568
238 Ga0075430_101029069
239 Ga0079104_1000382
240 Ga0099795_10083444
241 Ga0099795_10083914
242 Ga0105251_10002305
243 Ga0105244_10022224
244 Ga0105244_10085650
245 Ga0105250_10006569
246 Ga0105240_10314561
247 Ga0105240_10439342
248 Ga0105241_10176296
249 Ga0105248_10877744
250 Ga0105237_12489404
251 Ga0105249_11853742
252 Ga0105029_103301
253 Ga0099796_10000305
254 Ga0099796_10252315
255 Ga0105246_10165441
256 Ga0157373_10056630
257 Ga0157373_10113917
258 Ga0157373_10750142
259 Ga0157373_10850748
260 Ga0157371_10004555
261 Ga0157371_10013566
262 Ga0157370_10000711
263 Ga0157372_10310666
264 Ga0157372_11094881
265 Ga0182007_10083914
266 Ga0213872_10061595
267 Ga0213874_10019513
268 Ga0213876_10000034
269 Ga0213876_10035903
270 Ga0213876_10087292
271 Ga0213876_10319382
272 Ga0213871_10070716
273 Ga0207696_1000058
274 Ga0207655_1004665
275 Ga0207692_10676017
276 Ga0207685_10256158
277 Ga0207654_10241212
278 Ga0207693_10003632
279 Ga0207663_10116365
280 Ga0207646_10730516
281 Ga0207664_10448426
282 Ga0207669_11414604
283 Ga0207665_10022033
284 Ga0207665_10911078
285 Ga0209281_1000006
286 Ga0209371_1013464
287 Ga0209371_1074643
288 Ga0209179_1040285
289 Ga0268266_10177003
290 Ga0307515_10103715
291 Ga0268256_1031553
292 Ga0268256_1082916
293 Ga0265325_10344984
294 Ga0265331_10387551
295 Ga0265327_10012107
296 Ga0307513_10027098
297 Ga0307513_10877517
298 Ga0316575_10191627
299 Ga0307516_10509727
300 Ga0316214_1012555
301 Ga0373934_0082080
302 Ga0373945_0313288
303 Ga0373954_0012646
304 Ga0373935_0611378
305 Ga0373927_0011415
306 Ga0373947_0050973
307 Ga0373947_0856983
308 Ga0373937_0028928
309 Ga0373925_0000328
310 Ga0373925_0149140
311 Ga0395900_0416632
312 Ga0395898_0042216
313 Ga0436364_0865551
314 Ga0436364_1477097
315 Ga0400484_13127
316 Ga0400488_19372
317 Ga0400489_79181
318 Ga0400487_05774
319 Ga0400487_08426
320 Ga0436365_0048989
321 Ga0436365_0965775
322 Ga0436365_1349633
323 Ga0436365_1712420
324 Ga0436365_1814822
325 Ga0436360_1131157
326 Ga0436361_0057378
327 Ga0436361_0890967
328 Ga0436361_0979536
329 Ga0436361_1080946
330 Ga0436363_0410179
331 Ga0436363_1667662
332 Ga0436362_0044149
333 Ga0436362_1073045
334 Ga0439465_0033912
335 Ga0451807_1174013
336 Ga0439452_000001
337 Ga0451577_0003566
338 Ga0451577_1975672
339 Ga0466969_0030793
340 Ga0466961_0064979
341 Ga0466963_0923275
342 Ga0453684_0066659
343 Ga0453684_0083158
344 Ga0453684_1083645
345 Ga0453684_2046378
346 Ga0451576_0000295
347 Ga0451576_1963636
348 Ga0495627_011139
349 Ga0495603_0094994
350 Ga0495591_009431
351 Ga0495650_0000265
352 Ga0495650_0006499
353 Ga0495580_0016927
354 Ga0495605_0000221
355 Ga0495583_0000368
356 Ga0495606_0001030
357 Ga0495610_0070811
358 Ga0495610_0074079
359 Ga0495616_0284278
360 Ga0495620_0000191
361 Ga0495630_0936582
362 Ga0495637_0006483
363 Ga0495648_0005853
364 Ga0495642_0046537
365 Ga0495654_0002455
366 Ga0495654_0109874
367 Ga0495609_0111509
368 Ga0495661_0000568
369 Ga0495670_0039050
370 Ga0495671_0054146
371 Ga0495649_0100191
372 Ga0495589_0004098
373 Ga0495660_0017776
374 Ga0495672_0000001
375 Ga0495683_0000147
376 Ga0495679_003095
377 Ga0495673_0002032
378 Ga0495684_0281099
379 Ga0495684_0613739
380 Ga0496101_0014024
381 Ga0496116_0000929
382 Ga0496117_0001735
383 Ga0496117_0119787
384 Ga0496118_0011209
385 Ga0496118_0196819
386 Ga0496119_0138262
387 Ga0496120_0135279
388 Ga0496122_0006527
389 Ga0496122_0026472
390 Ga0496123_0003051
391 Ga0496123_0059105
392 Ga0496123_0061978
393 Ga0496124_0014449
394 Ga0496124_0169115
395 Ga0496125_0032209
396 Ga0496125_0308689
397 Ga0495678_000254
398 Ga0501033_0912545
399 Ga0501036_1471673
400 Ga0501038_0431724
401 Ga0501038_0488172
402 Ga0501039_0015677
403 Ga0501039_1517459
404 Ga0501041_0274619
405 Ga0501042_0600351
406 Ga0501048_0970447
407 Ga0501068_0024559
408 Ga0501071_0259172
409 Ga0501072_0000464
410 Ga0501074_0418489
411 Ga0501074_1287692
412 Ga0501075_0073266
413 Ga0501076_0063207
414 Ga0501079_0027479
415 Ga0501080_0450225
416 Ga0501081_0211836
417 nmdc:mga0qj67_835238_c1
418 Ga0495601_0006191
419 Ga0495595_0022228
420 Ga0500644_0259839
421 Ga0501084_0000096
422 Ga0501084_0170267
423 Ga0501084_0498275
424 Ga0501084_1083604
425 Ga0530510_0082622
426 2599926180
427 2609909938
428 2637224336
429 2650899699
430 2686353833
431 2739352241
432 2844534954
433 2847799301
434 2852104055
435 2904514755
436 2908673820
437 2969081380
438 2978978893
439 2984497140
440 2984563842
441 2984596575
442 2990261096
443 8016735266
444 8019501256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

14

121

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xe3-assembly1.cif.gz_B endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.9067 11 121
5xe2-assembly1.cif.gz_A-2 endoribonuclease from mycobacterial species 0.9048 14 121
7bye-assembly2.cif.gz_E toxin-antitoxin complex from klebsiella pneumoniae 0.904 14 122
5xe3-assembly1.cif.gz_A endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.9012 14 121
5cqx-assembly1.cif.gz_A e. coli mazf mutant e24a in complex with maze residues 68-82 form i 0.9005 12 120
ID Description Score Start End Superfamily
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9054 12 121 2.30.30.110
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.8966 14 120 2.30.30.110
1m1fB00 Mainly Beta;Roll;SH3 type barrels.; 0.8828 13 122 2.30.30.110
1m1fB00 Mainly Beta;Roll;SH3 type barrels.; 0.8748 13 122 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.856 12 121 2.30.30.110
ID Description Score Start End GO Terms
AF-C4XQU9-F1-model_v4 Putative PemK protein 0.9604 38 122 GO:0003677
AF-D6CVX6-F1-model_v4 Protein pemK (Kid toxin protein) 0.9552 41 122 GO:0003677
AF-A0A4R4K328-F1-model_v4 Toxin ChpB 0.94 53 122 GO:0003677
AF-F8FUF8-F1-model_v4 deleted 0.9398 55 122
AF-C4XQU9-F1-model_v4 Putative PemK protein 0.9388 38 122 GO:0003677

Map