F333615

General Info

Members Datasets Scaffolds Average Seq Length
221 170 207 184

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1341341|Ga0436363_1341341_456_1082
Length 208
Sequence LVSHQAAYCRENSFEQFLCLSFQQIGFMNIIPTKVSDVFITEPRVFEDERGFFYESYNEKAFAEKIGVDVHFVQDNHSRSTKNVLRGLHYQIQQPQGKLVRVVVGTIYDVAVDLRKSSPSFGQWISCLLSAENKRQFWIPPGFAHGFCVVSDVAEVLYKATDYYAPTHERCVLWNDSDLAIDWPVKDSPVISKKDQMGQPFKTAEVFP

Samples

Sample ID Description Type Environment
1 2511231020 Pseudomonas sp. GM74 Isolate Nodule
2 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
3 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
4 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
5 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
6 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543030 Massilia sp. GV097 Isolate Unclassified
11 2831426010 Nostoc sp. 106C Isolate Unclassified
12 2849660919 Nostoc sp. T09 Isolate Unclassified
13 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
14 2996893221 Rhizobium sp. R635 Isolate Nodule
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
109 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
110 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
156 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.95
Metatranscriptomes 2.71
Isolates 6.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 1.36
Rhizoplane 3.17
Rhizosphere 81.45
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10021300 3300003322 Bacteria 1030
2 rootH1_10042651 3300003323 Bacteria 2137
3 Ga0007410J51695_1099083 3300003574 Bacteria 1452
4 Ga0007409J51694_1022958 3300003575 Bacteria 8770
5 Ga0032354_1090781 3300003693 Bacteria 1482
6 Ga0055526_1000304 3300003771 Bacteria 41058
7 Ga0058692_1000468 3300003856 Bacteria 18161
8 Ga0065715_10178313 3300005293 Bacteria 1495
9 Ga0065707_10083774 3300005295 Bacteria 8273
10 Ga0070658_10043883 3300005327 Bacteria 3612
11 Ga0070658_10044214 3300005327 Bacteria 3599
12 Ga0070680_100031124 3300005336 Bacteria 4289
13 Ga0070714_100321585 3300005435 Bacteria 1447
14 Ga0070714_100379224 3300005435 Bacteria 1333
15 Ga0070681_10003694 3300005458 Bacteria 14358
16 Ga0070681_10173250 3300005458 Bacteria 2079
17 Ga0070681_10264904 3300005458 Bacteria 1630
18 Ga0070679_100264910 3300005530 Bacteria 1673
19 Ga0068853_100044659 3300005539 Bacteria 3793
20 Ga0068853_100196759 3300005539 Bacteria 1833
21 Ga0070695_100059083 3300005545 Bacteria 2481
22 Ga0070693_100128238 3300005547 Bacteria 1582
23 Ga0070704_100578929 3300005549 Bacteria 984
24 Ga0068855_100011559 3300005563 Bacteria 10662
25 Ga0068855_100151057 3300005563 Bacteria 2641
26 Ga0068857_100251701 3300005577 Bacteria 1620
27 Ga0068852_100248061 3300005616 Bacteria 1704
28 Ga0068852_101177525 3300005616 Bacteria 787
29 Ga0068861_100010865 3300005719 Bacteria 6328
30 Ga0068858_100237452 3300005842 Unclassified 1729
31 Ga0068860_100269435 3300005843 Bacteria 1661
32 Ga0068862_100660542 3300005844 Bacteria 1009
33 Ga0068862_100887381 3300005844 Bacteria 876
34 Ga0075364_10054135 3300006051 Bacteria 2623
35 Ga0075432_10004198 3300006058 Bacteria 4904
36 Ga0075366_10184074 3300006195 Bacteria 1269
37 Ga0097621_100352568 3300006237 Unclassified 1309
38 Ga0075430_100050841 3300006846 Bacteria 3493
39 Ga0075430_100076915 3300006846 Bacteria 2797
40 Ga0075430_100180991 3300006846 Bacteria 1753
41 Ga0075431_100048120 3300006847 Bacteria 4398
42 Ga0075431_100057574 3300006847 Bacteria 4009
43 Ga0075431_100166480 3300006847 Bacteria 2266
44 Ga0075429_100346378 3300006880 Bacteria 1301
45 Ga0075436_100036866 3300006914 Bacteria 3376
46 Ga0099826_10085905 3300006948 Bacteria 1941
47 Ga0105240_10093455 3300009093 Unclassified 3670
48 Ga0111539_10055120 3300009094 Bacteria 4726
49 Ga0105245_10187384 3300009098 Bacteria 1980
50 Ga0114129_10528475 3300009147 Bacteria 1537
51 Ga0105248_10536320 3300009177 Bacteria 1320
52 Ga0105238_10015780 3300009551 Bacteria 7646
53 Ga0105249_10963093 3300009553 Unclassified 921
54 Ga0105239_10487920 3300010375 Bacteria 1400
55 Ga0157373_10026815 3300013100 Bacteria 4158
56 Ga0157370_10049388 3300013104 Bacteria 4027
57 Ga0157369_10152716 3300013105 Bacteria 2440
58 Ga0157369_10175045 3300013105 Bacteria 2259
59 Ga0157374_10328934 3300013296 Bacteria 1516
60 Ga0157378_10076147 3300013297 Bacteria 3023
61 Ga0157372_10131353 3300013307 Bacteria 2881
62 Ga0157372_11641797 3300013307 Bacteria 740
63 Ga0157375_10158189 3300013308 Bacteria 2406
64 Ga0157375_10992932 3300013308 Bacteria 979
65 Ga0157380_10004092 3300014326 Bacteria 10076
66 Ga0163161_10298478 3300017792 Bacteria 1268
67 Ga0213872_10000093 3300021361 Bacteria 83513
68 Ga0213874_10000544 3300021377 Bacteria 7545
69 Ga0209564_1000084 3300025295 Bacteria 252729
70 Ga0209256_1045184 3300025299 Bacteria 1096
71 Ga0209257_1080693 3300025304 Bacteria 835
72 Ga0207705_10039212 3300025909 Bacteria 3394
73 Ga0207707_10000334 3300025912 Bacteria 49704
74 Ga0207707_10027466 3300025912 Bacteria 4977
75 Ga0207695_10000160 3300025913 Bacteria 200410
76 Ga0207660_10060505 3300025917 Bacteria 2723
77 Ga0207652_10003781 3300025921 Bacteria 12399
78 Ga0207694_10156762 3300025924 Bacteria 1837
79 Ga0207687_10220739 3300025927 Bacteria 1492
80 Ga0207661_10898524 3300025944 Unclassified 816
81 Ga0207667_10139473 3300025949 Bacteria 2496
82 Ga0207667_10206155 3300025949 Bacteria 2016
83 Ga0207667_10257831 3300025949 Bacteria 1783
84 Ga0207667_10515017 3300025949 Bacteria 1212
85 Ga0207658_10249369 3300025986 Bacteria 1508
86 Ga0207639_10055555 3300026041 Bacteria 3031
87 Ga0207639_10254313 3300026041 Bacteria 1533
88 Ga0207702_10391587 3300026078 Bacteria 1338
89 Ga0207674_10126592 3300026116 Bacteria 2520
90 Ga0207675_100019334 3300026118 Bacteria 6355
91 Ga0209371_1000002 3300027312 Bacteria 1551985
92 Ga0209371_1029298 3300027312 Bacteria 1218
93 Ga0209971_1009266 3300027682 Bacteria 2332
94 Ga0207428_10079123 3300027907 Bacteria 2571
95 Ga0268265_10367058 3300028380 Bacteria 1320
96 Ga0307515_10009616 3300028794 Bacteria 18663
97 Ga0268256_1000002 3300030500 Bacteria 1535763
98 Ga0268256_1015069 3300030500 Bacteria 2271
99 Ga0265330_10002236 3300031235 Bacteria 10664
100 Ga0265330_10071981 3300031235 Bacteria 1495
101 Ga0265328_10019983 3300031239 Bacteria 2567
102 Ga0265327_10045369 3300031251 Bacteria 2336
103 Ga0307408_100259133 3300031548 Bacteria 1438
104 Ga0316575_10006468 3300031665 Bacteria 4216
105 Ga0265342_10228436 3300031712 Bacteria 1000
106 Ga0316593_10019321 3300032168 Bacteria 2105
107 Ga0316593_10040638 3300032168 Bacteria 1546
108 Ga0316596_1000841 3300033541 Bacteria 5731
109 Ga0316582_0847300 3300036647 Bacteria 626
110 Ga0395899_0001947 3300037312 Bacteria 16986
111 Ga0395899_0004554 3300037312 Bacteria 10795
112 Ga0395900_0000060 3300037418 Bacteria 205509
113 Ga0395900_0267666 3300037418 Bacteria 1704
114 Ga0395900_0542445 3300037418 Bacteria 1109
115 Ga0395898_0111130 3300037466 Bacteria 2626
116 Ga0395905_0015074 3300037471 Bacteria 7362
117 Ga0436364_1547847 3300037853 Bacteria 535
118 Ga0395901_0010486 3300038443 Bacteria 9386
119 Ga0242422_00566 3300038699 Bacteria 2395
120 Ga0436363_1341341 3300039450 Bacteria 37469
121 Ga0439437_000267 3300042000 Bacteria 4798
122 Ga0450892_000687 3300042130 Bacteria 3821
123 Ga0450893_0014127 3300042532 Bacteria 1335
124 Ga0451577_0224184 3300042876 Bacteria 1699
125 Ga0453684_0217562 3300044712 Bacteria 2215
126 Ga0466957_0691057 3300044842 Bacteria 719
127 Ga0495590_0000212 3300046457 Bacteria 31582
128 Ga0495638_0017659 3300046460 Bacteria 4751
129 Ga0495605_0001228 3300046474 Bacteria 17058
130 Ga0495585_0279164 3300046492 Bacteria 826
131 Ga0495583_0003053 3300046506 Bacteria 13309
132 Ga0495583_0007370 3300046506 Bacteria 6930
133 Ga0495583_0034677 3300046506 Bacteria 2415
134 Ga0495606_0004700 3300046507 Bacteria 13482
135 Ga0495606_0027131 3300046507 Bacteria 4067
136 Ga0495606_0029744 3300046507 Bacteria 3828
137 Ga0495610_0003629 3300046512 Bacteria 11886
138 Ga0495637_0005363 3300046520 Bacteria 6548
139 Ga0495643_0010161 3300046522 Bacteria 5805
140 Ga0495643_0021855 3300046522 Bacteria 3662
141 Ga0495642_0000027 3300046528 Bacteria 89620
142 Ga0495642_0010280 3300046528 Bacteria 3584
143 Ga0495654_0007898 3300046530 Bacteria 5916
144 Ga0495654_0010547 3300046530 Bacteria 5027
145 Ga0495621_0054129 3300046539 Bacteria 1442
146 Ga0495597_0013886 3300046542 Bacteria 3850
147 Ga0495597_0016262 3300046542 Bacteria 3515
148 Ga0495597_0235853 3300046542 Bacteria 722
149 Ga0495633_0075937 3300046558 Bacteria 1565
150 Ga0495668_0032160 3300046616 Bacteria 2954
151 Ga0495668_0211651 3300046616 Bacteria 1061
152 Ga0495625_0006316 3300046660 Bacteria 10593
153 Ga0495625_0043133 3300046660 Bacteria 3273
154 Ga0495625_0077249 3300046660 Bacteria 2327
155 Ga0495625_0218799 3300046660 Bacteria 1249
156 Ga0495659_0000112 3300046664 Bacteria 36233
157 Ga0495661_0012087 3300046665 Bacteria 5838
158 Ga0495588_0003944 3300046674 Bacteria 6511
159 Ga0495599_0012734 3300046678 Bacteria 5188
160 Ga0495623_0232677 3300046679 Bacteria 1044
161 Ga0495669_0010250 3300046684 Bacteria 3959
162 Ga0495670_0195083 3300046691 Bacteria 1071
163 Ga0495671_0002287 3300046692 Bacteria 12170
164 Ga0495671_0361342 3300046692 Unclassified 696
165 Ga0495649_0001078 3300046694 Bacteria 21275
166 Ga0495589_0003208 3300046794 Bacteria 8929
167 Ga0495636_0005708 3300047318 Bacteria 4879
168 Ga0495636_0009270 3300047318 Bacteria 3875
169 Ga0495672_0000287 3300047320 Bacteria 69547
170 Ga0495672_0000952 3300047320 Bacteria 30191
171 Ga0495687_056673 3300047443 Bacteria 1633
172 Ga0495673_0047335 3300047469 Bacteria 1900
173 Ga0495681_0019728 3300047470 Bacteria 3672
174 Ga0495681_0093293 3300047470 Bacteria 1326
175 Ga0496102_0024199 3300048905 Bacteria 5397
176 Ga0496103_0196422 3300048906 Bacteria 1297
177 Ga0496114_0473396 3300048917 Bacteria 1108
178 Ga0496116_0009009 3300048919 Bacteria 8575
179 Ga0496121_0075072 3300048924 Bacteria 2702
180 Ga0496123_0305077 3300048926 Bacteria 758
181 Ga0501034_0292686 3300049571 Unclassified 1566
182 Ga0501038_0005541 3300049574 Bacteria 11723
183 Ga0501069_0443683 3300049585 Bacteria 771
184 Ga0501223_011619 3300049663 Bacteria 1768
185 Ga0501255_003501 3300049684 Bacteria 1461
186 Ga0501229_030800 3300049706 Bacteria 735
187 Ga0501080_0634735 3300049742 Bacteria 946
188 Ga0501081_0030719 3300049743 Bacteria 3638
189 nmdc:mga03683_6056_c1 3300050489 Bacteria 4123
190 nmdc:mga03683_9718_c1 3300050489 Bacteria 3431
191 nmdc:mga03n38_168294_c1 3300050490 Bacteria 1114
192 nmdc:mga00v17_21489_c1 3300050491 Bacteria 3710
193 nmdc:mga00v17_6369_c1 3300050491 Bacteria 6261
194 nmdc:mga05p37_192855_c1 3300050507 Bacteria 2472
195 nmdc:mga09592_116258_c1 3300050508 Bacteria 2295
196 nmdc:mga09592_198464_c1 3300050508 Bacteria 1737
197 nmdc:mga0qj67_32671_c1 3300050509 Bacteria 4060
198 nmdc:mga0qj67_38840_c1 3300050509 Bacteria 3736
199 nmdc:mga0qj67_71007_c1 3300050509 Bacteria 2778
200 nmdc:mga06r32_111800_c1 3300050510 Bacteria 2688
201 nmdc:mga06r32_28663_c1 3300050510 Bacteria 5213
202 nmdc:mga06r32_74054_c1 3300050510 Bacteria 3300
203 nmdc:mga08x19_28912_c1 3300050514 Bacteria 3475
204 nmdc:mga0sz30_2468_c1 3300050516 Bacteria 1600
205 Ga0500573_0044406 3300053140 Bacteria 2563
206 Ga0500637_0151830 3300053178 Unclassified 1338
207 Ga0501082_0369489 3300060353 Bacteria 1251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100578929 Ga0070704_1005789291 147
2 3300037853 Ga0436364_1547847 Ga0436364_1547847_16_525 169
3 3300006195 Ga0075366_10184074 Ga0075366_101840742 173
4 3300049663 Ga0501223_011619 Ga0501223_011619_295_846 173
5 3300049684 Ga0501255_003501 Ga0501255_003501_666_1217 173
6 3300049706 Ga0501229_030800 Ga0501229_030800_52_603 173
7 3300009551 Ga0105238_10015780 Ga0105238_100157806 176
8 3300025924 Ga0207694_10156762 Ga0207694_101567622 176
9 iso_pu_bacteria 2600255256 2601534815 176
10 iso_pu_bacteria 2600255257 2601539556 176
11 iso_pu_bacteria 2600255310 2601757906 176
12 iso_pu_bacteria 2600255311 2601764264 176
13 iso_pu_bacteria 2857537821 2857538005 176
14 iso_pu_bacteria 2511231020 2511349899 177
15 iso_pu_bacteria 2738541280 2738739116 177
16 iso_pu_bacteria 2738541300 2738846351 177
17 iso_pu_bacteria 2738543018 2739275000 177
18 iso_pu_bacteria 2738543030 2739344044 177
19 iso_pu_bacteria 2831426010 2831429294 177
20 iso_pu_bacteria 2849660919 2849665197 177
21 iso_pu_bacteria 2996893221 2996894846 177
22 3300005545 Ga0070695_100059083 Ga0070695_1000590832 178
23 3300049585 Ga0501069_0443683 Ga0501069_0443683_114_659 178
24 3300005327 Ga0070658_10043883 Ga0070658_100438833 179
25 3300005327 Ga0070658_10044214 Ga0070658_100442143 179
26 3300005336 Ga0070680_100031124 Ga0070680_1000311242 179
27 3300005435 Ga0070714_100321585 Ga0070714_1003215852 179
28 3300005435 Ga0070714_100379224 Ga0070714_1003792242 179
29 3300005458 Ga0070681_10003694 Ga0070681_100036949 179
30 3300005458 Ga0070681_10173250 Ga0070681_101732503 179
31 3300005458 Ga0070681_10264904 Ga0070681_102649042 179
32 3300005530 Ga0070679_100264910 Ga0070679_1002649102 179
33 3300005539 Ga0068853_100044659 Ga0068853_1000446592 179
34 3300005539 Ga0068853_100196759 Ga0068853_1001967592 179
35 3300005547 Ga0070693_100128238 Ga0070693_1001282382 179
36 3300005563 Ga0068855_100011559 Ga0068855_1000115593 179
37 3300005563 Ga0068855_100151057 Ga0068855_1001510573 179
38 3300005577 Ga0068857_100251701 Ga0068857_1002517012 179
39 3300005616 Ga0068852_100248061 Ga0068852_1002480612 179
40 3300005616 Ga0068852_101177525 Ga0068852_1011775252 179
41 3300005842 Ga0068858_100237452 Ga0068858_1002374522 179
42 3300005843 Ga0068860_100269435 Ga0068860_1002694352 179
43 3300005844 Ga0068862_100887381 Ga0068862_1008873812 179
44 3300006237 Ga0097621_100352568 Ga0097621_1003525682 179
45 3300006846 Ga0075430_100050841 Ga0075430_1000508415 179
46 3300006847 Ga0075431_100057574 Ga0075431_1000575744 179
47 3300006847 Ga0075431_100166480 Ga0075431_1001664803 179
48 3300006880 Ga0075429_100346378 Ga0075429_1003463781 179
49 3300009093 Ga0105240_10093455 Ga0105240_100934555 179
50 3300009098 Ga0105245_10187384 Ga0105245_101873842 179
51 3300009147 Ga0114129_10528475 Ga0114129_105284752 179
52 3300009177 Ga0105248_10536320 Ga0105248_105363202 179
53 3300009553 Ga0105249_10963093 Ga0105249_109630932 179
54 3300010375 Ga0105239_10487920 Ga0105239_104879202 179
55 3300013100 Ga0157373_10026815 Ga0157373_100268154 179
56 3300013104 Ga0157370_10049388 Ga0157370_100493883 179
57 3300013105 Ga0157369_10152716 Ga0157369_101527162 179
58 3300013105 Ga0157369_10175045 Ga0157369_101750453 179
59 3300013296 Ga0157374_10328934 Ga0157374_103289343 179
60 3300013297 Ga0157378_10076147 Ga0157378_100761472 179
61 3300013307 Ga0157372_10131353 Ga0157372_101313534 179
62 3300013307 Ga0157372_11641797 Ga0157372_116417971 179
63 3300013308 Ga0157375_10158189 Ga0157375_101581893 179
64 3300013308 Ga0157375_10992932 Ga0157375_109929321 179
65 3300025304 Ga0209257_1080693 Ga0209257_10806932 179
66 3300025909 Ga0207705_10039212 Ga0207705_100392123 179
67 3300025912 Ga0207707_10000334 Ga0207707_1000033414 179
68 3300025912 Ga0207707_10027466 Ga0207707_100274664 179
69 3300025913 Ga0207695_10000160 Ga0207695_10000160125 179
70 3300025917 Ga0207660_10060505 Ga0207660_100605053 179
71 3300025921 Ga0207652_10003781 Ga0207652_100037813 179
72 3300025927 Ga0207687_10220739 Ga0207687_102207392 179
73 3300025944 Ga0207661_10898524 Ga0207661_108985242 179
74 3300025949 Ga0207667_10139473 Ga0207667_101394731 179
75 3300025949 Ga0207667_10257831 Ga0207667_102578312 179
76 3300025949 Ga0207667_10515017 Ga0207667_105150172 179
77 3300025986 Ga0207658_10249369 Ga0207658_102493692 179
78 3300026041 Ga0207639_10055555 Ga0207639_100555553 179
79 3300026041 Ga0207639_10254313 Ga0207639_102543132 179
80 3300026078 Ga0207702_10391587 Ga0207702_103915872 179
81 3300026116 Ga0207674_10126592 Ga0207674_101265922 179
82 3300031235 Ga0265330_10002236 Ga0265330_100022363 179
83 3300031235 Ga0265330_10071981 Ga0265330_100719812 179
84 3300031239 Ga0265328_10019983 Ga0265328_100199832 179
85 3300037418 Ga0395900_0000060 Ga0395900_0000060_158991_159560 179
86 3300037418 Ga0395900_0542445 Ga0395900_0542445_107_661 179
87 3300037466 Ga0395898_0111130 Ga0395898_0111130_1270_1839 179
88 3300048926 Ga0496123_0305077 Ga0496123_0305077_148_705 179
89 3300049571 Ga0501034_0292686 Ga0501034_0292686_737_1312 179
90 3300049742 Ga0501080_0634735 Ga0501080_0634735_188_763 179
91 3300050507 nmdc:mga05p37_192855_c1 nmdc:mga05p37_192855_c1_482_1057 179
92 3300050508 nmdc:mga09592_116258_c1 nmdc:mga09592_116258_c1_1295_1870 179
93 3300050508 nmdc:mga09592_198464_c1 nmdc:mga09592_198464_c1_292_867 179
94 3300050509 nmdc:mga0qj67_32671_c1 nmdc:mga0qj67_32671_c1_1925_2500 179
95 3300050509 nmdc:mga0qj67_38840_c1 nmdc:mga0qj67_38840_c1_1310_1885 179
96 3300050510 nmdc:mga06r32_28663_c1 nmdc:mga06r32_28663_c1_1919_2494 179
97 3300050510 nmdc:mga06r32_74054_c1 nmdc:mga06r32_74054_c1_1251_1826 179
98 3300053140 Ga0500573_0044406 Ga0500573_0044406_1311_1865 179
99 3300053178 Ga0500637_0151830 Ga0500637_0151830_395_952 179
100 iso_pu_bacteria 2643221639 2644222735 179
101 3300003856 Ga0058692_1000468 Ga0058692_100046813 180
102 3300009094 Ga0111539_10055120 Ga0111539_100551204 180
103 3300027312 Ga0209371_1000002 Ga0209371_10000021311 180
104 3300027312 Ga0209371_1029298 Ga0209371_10292982 180
105 3300030500 Ga0268256_1000002 Ga0268256_1000002151 180
106 3300030500 Ga0268256_1015069 Ga0268256_10150693 180
107 3300031665 Ga0316575_10006468 Ga0316575_100064683 180
108 3300032168 Ga0316593_10019321 Ga0316593_100193212 180
109 3300032168 Ga0316593_10040638 Ga0316593_100406382 180
110 3300033541 Ga0316596_1000841 Ga0316596_10008413 180
111 3300048919 Ga0496116_0009009 Ga0496116_0009009_2346_2888 180
112 3300003574 Ga0007410J51695_1099083 Ga0007410J51695_10990832 181
113 3300003575 Ga0007409J51694_1022958 Ga0007409J51694_10229583 181
114 3300003693 Ga0032354_1090781 Ga0032354_10907812 181
115 3300003771 Ga0055526_1000304 Ga0055526_10003047 181
116 3300005293 Ga0065715_10178313 Ga0065715_101783132 181
117 3300005295 Ga0065707_10083774 Ga0065707_100837744 181
118 3300005719 Ga0068861_100010865 Ga0068861_1000108653 181
119 3300005844 Ga0068862_100660542 Ga0068862_1006605422 181
120 3300006051 Ga0075364_10054135 Ga0075364_100541353 181
121 3300006058 Ga0075432_10004198 Ga0075432_100041983 181
122 3300006846 Ga0075430_100076915 Ga0075430_1000769153 181
123 3300006846 Ga0075430_100180991 Ga0075430_1001809913 181
124 3300006847 Ga0075431_100048120 Ga0075431_1000481203 181
125 3300006914 Ga0075436_100036866 Ga0075436_1000368664 181
126 3300006948 Ga0099826_10085905 Ga0099826_100859052 181
127 3300014326 Ga0157380_10004092 Ga0157380_1000409213 181
128 3300017792 Ga0163161_10298478 Ga0163161_102984782 181
129 3300021377 Ga0213874_10000544 Ga0213874_100005442 181
130 3300025295 Ga0209564_1000084 Ga0209564_1000084171 181
131 3300025949 Ga0207667_10206155 Ga0207667_102061554 181
132 3300026118 Ga0207675_100019334 Ga0207675_1000193344 181
133 3300027682 Ga0209971_1009266 Ga0209971_10092662 181
134 3300027907 Ga0207428_10079123 Ga0207428_100791232 181
135 3300028380 Ga0268265_10367058 Ga0268265_103670582 181
136 3300031251 Ga0265327_10045369 Ga0265327_100453692 181
137 3300036647 Ga0316582_0847300 Ga0316582_0847300_20_568 181
138 3300037312 Ga0395899_0001947 Ga0395899_0001947_10195_10740 181
139 3300037312 Ga0395899_0004554 Ga0395899_0004554_1655_2200 181
140 3300037418 Ga0395900_0267666 Ga0395900_0267666_444_989 181
141 3300038443 Ga0395901_0010486 Ga0395901_0010486_8701_9246 181
142 3300038699 Ga0242422_00566 Ga0242422_00566_50_595 181
143 3300039450 Ga0436363_1341341 Ga0436363_1341341_456_1082 181
144 3300044842 Ga0466957_0691057 Ga0466957_0691057_132_680 181
145 3300046457 Ga0495590_0000212 Ga0495590_0000212_22973_23518 181
146 3300046460 Ga0495638_0017659 Ga0495638_0017659_2771_3319 181
147 3300046474 Ga0495605_0001228 Ga0495605_0001228_1182_1727 181
148 3300046492 Ga0495585_0279164 Ga0495585_0279164_117_662 181
149 3300046506 Ga0495583_0003053 Ga0495583_0003053_9769_10314 181
150 3300046506 Ga0495583_0007370 Ga0495583_0007370_991_1536 181
151 3300046506 Ga0495583_0034677 Ga0495583_0034677_802_1347 181
152 3300046507 Ga0495606_0004700 Ga0495606_0004700_10283_10828 181
153 3300046507 Ga0495606_0027131 Ga0495606_0027131_26_571 181
154 3300046507 Ga0495606_0029744 Ga0495606_0029744_3101_3646 181
155 3300046512 Ga0495610_0003629 Ga0495610_0003629_6149_6694 181
156 3300046520 Ga0495637_0005363 Ga0495637_0005363_1396_1941 181
157 3300046522 Ga0495643_0010161 Ga0495643_0010161_980_1525 181
158 3300046522 Ga0495643_0021855 Ga0495643_0021855_1470_2018 181
159 3300046528 Ga0495642_0000027 Ga0495642_0000027_29634_30179 181
160 3300046528 Ga0495642_0010280 Ga0495642_0010280_569_1114 181
161 3300046530 Ga0495654_0007898 Ga0495654_0007898_737_1282 181
162 3300046530 Ga0495654_0010547 Ga0495654_0010547_4467_5012 181
163 3300046539 Ga0495621_0054129 Ga0495621_0054129_872_1417 181
164 3300046542 Ga0495597_0013886 Ga0495597_0013886_645_1190 181
165 3300046542 Ga0495597_0016262 Ga0495597_0016262_2911_3456 181
166 3300046542 Ga0495597_0235853 Ga0495597_0235853_164_709 181
167 3300046558 Ga0495633_0075937 Ga0495633_0075937_856_1401 181
168 3300046616 Ga0495668_0032160 Ga0495668_0032160_1103_1648 181
169 3300046616 Ga0495668_0211651 Ga0495668_0211651_20_565 181
170 3300046660 Ga0495625_0006316 Ga0495625_0006316_4583_5131 181
171 3300046660 Ga0495625_0043133 Ga0495625_0043133_1793_2338 181
172 3300046660 Ga0495625_0077249 Ga0495625_0077249_1429_1974 181
173 3300046660 Ga0495625_0218799 Ga0495625_0218799_175_720 181
174 3300046664 Ga0495659_0000112 Ga0495659_0000112_29966_30511 181
175 3300046665 Ga0495661_0012087 Ga0495661_0012087_4402_4947 181
176 3300046674 Ga0495588_0003944 Ga0495588_0003944_74_619 181
177 3300046678 Ga0495599_0012734 Ga0495599_0012734_2328_2879 181
178 3300046679 Ga0495623_0232677 Ga0495623_0232677_347_898 181
179 3300046684 Ga0495669_0010250 Ga0495669_0010250_782_1327 181
180 3300046691 Ga0495670_0195083 Ga0495670_0195083_39_584 181
181 3300046692 Ga0495671_0002287 Ga0495671_0002287_1276_1821 181
182 3300046692 Ga0495671_0361342 Ga0495671_0361342_31_576 181
183 3300046694 Ga0495649_0001078 Ga0495649_0001078_1830_2375 181
184 3300046794 Ga0495589_0003208 Ga0495589_0003208_2502_3047 181
185 3300047318 Ga0495636_0005708 Ga0495636_0005708_2547_3092 181
186 3300047318 Ga0495636_0009270 Ga0495636_0009270_2510_3055 181
187 3300047320 Ga0495672_0000287 Ga0495672_0000287_263_808 181
188 3300047320 Ga0495672_0000952 Ga0495672_0000952_8666_9211 181
189 3300047443 Ga0495687_056673 Ga0495687_056673_196_741 181
190 3300047469 Ga0495673_0047335 Ga0495673_0047335_450_995 181
191 3300047470 Ga0495681_0019728 Ga0495681_0019728_2365_2910 181
192 3300047470 Ga0495681_0093293 Ga0495681_0093293_40_585 181
193 3300048905 Ga0496102_0024199 Ga0496102_0024199_908_1453 181
194 3300048906 Ga0496103_0196422 Ga0496103_0196422_723_1268 181
195 3300048917 Ga0496114_0473396 Ga0496114_0473396_13_564 181
196 3300048924 Ga0496121_0075072 Ga0496121_0075072_514_1062 181
197 3300049574 Ga0501038_0005541 Ga0501038_0005541_3361_3906 181
198 3300049743 Ga0501081_0030719 Ga0501081_0030719_617_1327 181
199 3300050489 nmdc:mga03683_6056_c1 nmdc:mga03683_6056_c1_2505_3050 181
200 3300050489 nmdc:mga03683_9718_c1 nmdc:mga03683_9718_c1_1017_1562 181
201 3300050490 nmdc:mga03n38_168294_c1 nmdc:mga03n38_168294_c1_439_984 181
202 3300050491 nmdc:mga00v17_21489_c1 nmdc:mga00v17_21489_c1_194_739 181
203 3300050491 nmdc:mga00v17_6369_c1 nmdc:mga00v17_6369_c1_4354_4899 181
204 3300050509 nmdc:mga0qj67_71007_c1 nmdc:mga0qj67_71007_c1_877_1425 181
205 3300050510 nmdc:mga06r32_111800_c1 nmdc:mga06r32_111800_c1_1190_1738 181
206 3300050514 nmdc:mga08x19_28912_c1 nmdc:mga08x19_28912_c1_998_1543 181
207 3300050516 nmdc:mga0sz30_2468_c1 nmdc:mga0sz30_2468_c1_884_1429 181
208 3300060353 Ga0501082_0369489 Ga0501082_0369489_185_856 181
209 3300031712 Ga0265342_10228436 Ga0265342_102284361 182
210 3300042876 Ga0451577_0224184 Ga0451577_0224184_528_1094 182
211 3300044712 Ga0453684_0217562 Ga0453684_0217562_1045_1611 182
212 3300003322 rootL2_10021300 rootL2_100213002 183
213 3300003323 rootH1_10042651 rootH1_100426512 183
214 3300021361 Ga0213872_10000093 Ga0213872_1000009335 183
215 3300025299 Ga0209256_1045184 Ga0209256_10451842 183
216 3300028794 Ga0307515_10009616 Ga0307515_100096164 183
217 3300031548 Ga0307408_100259133 Ga0307408_1002591332 183
218 3300037471 Ga0395905_0015074 Ga0395905_0015074_3335_3886 183
219 3300042000 Ga0439437_000267 Ga0439437_000267_56_610 183
220 3300042130 Ga0450892_000687 Ga0450892_000687_225_779 183
221 3300042532 Ga0450893_0014127 Ga0450893_0014127_768_1322 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

32

203

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9835 2 183
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.983 2 178
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9805 2 178
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9777 1 183
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.972 1 177
ID Description Score Start End Superfamily
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9706 1 177 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9677 2 183 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9674 1 178 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9652 2 178 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9561 2 175 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1V0BBX1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9947 1 182 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7M1L046-F1-model_v4 deleted 0.9933 1 183
AF-A0A0H4J2R4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9932 2 178 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A448KY50-F1-model_v4 deleted 0.9928 1 183
AF-A0A2S5TQ29-F1-model_v4 deleted 0.9926 43 182

Feature Viewer

pLDDT pTM Quality
96.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map