F331903

General Info

Members Datasets Scaffolds Average Seq Length
220 150 206 216

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100003231|Ga0070659_1000032317
Length 235
Sequence MEFITFLIDFILHVDVHLAHFVATYGTWVYALLFLIIFVETGLVVMPFLPGDSLLFVVGALCGAGLMSLPVSIGLLIAAAILGDQTNYQIGRFFGPKVFQWENSRFFNKQAFNQAHAFYEKYGGATVIAARFMPFLRTFAPFVAGVASMTRSKFTMFNVAGAVLWAGGITITGYLFGNIPWVKSNLDKIIWAIILIPGLLVLFGAWKAKKSGPPVASLLPPGGDPGSAGKAGPRG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
9 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
12 2643221660 Methylibium sp. Root1272 Isolate Unclassified
13 2738541337 Pelomonas sp. BT06 Isolate Unclassified
14 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
95 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
96 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
97 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
98 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
103 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
104 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
105 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
106 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
107 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
108 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
109 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
133 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
138 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
139 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
140 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
143 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
147 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
148 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
149 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.64
Metatranscriptomes 0
Isolates 6.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.64
Nodule 0.91
Rhizoplane 3.18
Rhizosphere 43.64
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004336 3300001979 Bacteria 6113
2 JGI25152J39213_1001898 3300002773 Bacteria 8373
3 JGI25150J39212_1029525 3300002774 Bacteria 769
4 JGI25153J46596_10001824 3300003215 Bacteria 12628
5 JGI25153J46596_10012182 3300003215 Bacteria 3736
6 Ga0055526_1005419 3300003771 Bacteria 7344
7 Ga0055524_1000080 3300003775 Bacteria 120203
8 Ga0055530_10003095 3300003791 Bacteria 9867
9 Ga0055530_10028582 3300003791 Bacteria 1502
10 Ga0055540_1000002 3300003792 Bacteria 436954
11 Ga0055540_1001667 3300003792 Bacteria 12862
12 Ga0055531_10002623 3300003794 Bacteria 11910
13 Ga0055531_10011344 3300003794 Bacteria 4312
14 Ga0065165_1002051 3300005262 Bacteria 18667
15 Ga0068868_100048027 3300005338 Bacteria 3347
16 Ga0070659_100003231 3300005366 Bacteria 11600
17 Ga0070699_100111249 3300005518 Bacteria 2405
18 Ga0070679_100252510 3300005530 Bacteria 1719
19 Ga0070665_100032576 3300005548 Bacteria 5245
20 Ga0068855_100035152 3300005563 Bacteria 5969
21 Ga0070664_100009716 3300005564 Bacteria 7800
22 Ga0068857_100310114 3300005577 Bacteria 1456
23 Ga0068864_100218560 3300005618 Bacteria 1757
24 Ga0068863_100074457 3300005841 Bacteria 3212
25 Ga0068863_100203037 3300005841 Bacteria 1907
26 Ga0068860_100360747 3300005843 Bacteria 1432
27 Ga0075365_10066231 3300006038 Bacteria 2423
28 Ga0075368_10029418 3300006042 Bacteria 2124
29 Ga0075368_10133451 3300006042 Bacteria 1032
30 Ga0075363_100144765 3300006048 Bacteria 1340
31 Ga0075367_10095757 3300006178 Bacteria 1810
32 Ga0075369_10167540 3300006186 Bacteria 1008
33 Ga0075366_10017237 3300006195 Bacteria 4155
34 Ga0075366_10027302 3300006195 Bacteria 3348
35 Ga0075366_10038355 3300006195 Bacteria 2829
36 Ga0075366_10064497 3300006195 Bacteria 2178
37 Ga0075366_10078818 3300006195 Bacteria 1966
38 Ga0075366_10192274 3300006195 Bacteria 1240
39 Ga0075366_10358466 3300006195 Bacteria 896
40 Ga0075370_10006030 3300006353 Bacteria 6071
41 Ga0075370_10010457 3300006353 Bacteria 4853
42 Ga0075429_100002345 3300006880 Bacteria 15923
43 Ga0079104_1000017 3300006946 Bacteria 313784
44 Ga0105245_10020380 3300009098 Bacteria 5816
45 Ga0105245_10390494 3300009098 Bacteria 1388
46 Ga0157347_1002302 3300012502 Bacteria 1623
47 Ga0157374_10876927 3300013296 Bacteria 915
48 Ga0157378_10323668 3300013297 Bacteria 1498
49 Ga0157375_10170773 3300013308 Bacteria 2322
50 Ga0207425_1000131 3300025245 Bacteria 68511
51 Ga0209129_1000075 3300025258 Bacteria 201273
52 Ga0209673_1020017 3300025273 Bacteria 2383
53 Ga0209673_1027031 3300025273 Bacteria 1873
54 Ga0209564_1000046 3300025295 Bacteria 373787
55 Ga0209758_1000045 3300025297 Bacteria 369174
56 Ga0209758_1000052 3300025297 Bacteria 338962
57 Ga0209758_1056289 3300025297 Bacteria 1329
58 Ga0209050_1000457 3300025298 Bacteria 73281
59 Ga0209050_1002349 3300025298 Bacteria 16527
60 Ga0209050_1043329 3300025298 Bacteria 1217
61 Ga0209256_1000011 3300025299 Bacteria 865309
62 Ga0209256_1034078 3300025299 Bacteria 1360
63 Ga0209051_1000024 3300025303 Bacteria 437007
64 Ga0209051_1000320 3300025303 Bacteria 72764
65 Ga0209257_1000079 3300025304 Bacteria 316420
66 Ga0209257_1000161 3300025304 Bacteria 176089
67 Ga0209257_1013414 3300025304 Bacteria 3647
68 Ga0207705_10387104 3300025909 Bacteria 1080
69 Ga0207684_10001393 3300025910 Bacteria 26281
70 Ga0207657_10647117 3300025919 Bacteria 823
71 Ga0207652_10220280 3300025921 Bacteria 1710
72 Ga0207687_10081720 3300025927 Bacteria 2336
73 Ga0207690_10223154 3300025932 Bacteria 1443
74 Ga0207711_10228148 3300025941 Bacteria 1705
75 Ga0207679_10000536 3300025945 Bacteria 25661
76 Ga0207667_10086957 3300025949 Bacteria 3234
77 Ga0207677_10102120 3300026023 Bacteria 2113
78 Ga0207641_10025146 3300026088 Bacteria 4909
79 Ga0207641_10067121 3300026088 Bacteria 3072
80 Ga0207676_10005025 3300026095 Bacteria 9364
81 Ga0207676_10133650 3300026095 Bacteria 2113
82 Ga0207674_10416005 3300026116 Bacteria 1299
83 Ga0207698_10018603 3300026142 Bacteria 4739
84 Ga0209281_1000042 3300027111 Bacteria 344748
85 Ga0209813_10078205 3300027866 Bacteria 1088
86 Ga0209974_10007660 3300027876 Bacteria 3714
87 Ga0268266_10055246 3300028379 Bacteria 3413
88 Ga0268264_10295377 3300028381 Bacteria 1523
89 Ga0307517_10186414 3300028786 Bacteria 1327
90 Ga0307515_10000902 3300028794 Bacteria 68371
91 Ga0307515_10000991 3300028794 Bacteria 64898
92 Ga0307515_10001283 3300028794 Bacteria 57022
93 Ga0307515_10021169 3300028794 Bacteria 11547
94 Ga0307515_10088380 3300028794 Bacteria 3917
95 Ga0307512_10055762 3300030522 Bacteria 3112
96 Ga0307513_10000004 3300031456 Bacteria 558931
97 Ga0307513_10001123 3300031456 Bacteria 38793
98 Ga0307513_10007193 3300031456 Bacteria 14457
99 Ga0307513_10180078 3300031456 Bacteria 1978
100 Ga0307513_10677750 3300031456 Bacteria 737
101 Ga0307508_10000007 3300031616 Bacteria 268359
102 Ga0307514_10001428 3300031649 Bacteria 29364
103 Ga0307514_10001840 3300031649 Bacteria 23499
104 Ga0307516_10018786 3300031730 Bacteria 7177
105 Ga0307516_10083591 3300031730 Bacteria 3033
106 Ga0307412_10044091 3300031911 Bacteria 2909
107 Ga0307414_10319075 3300032004 Bacteria 1322
108 Ga0307507_10181520 3300033179 Bacteria 1503
109 Ga0307510_10292872 3300033180 Bacteria 1093
110 Ga0395899_0046620 3300037312 Bacteria 3228
111 Ga0395899_0086318 3300037312 Bacteria 2279
112 Ga0395900_0045394 3300037418 Bacteria 4526
113 Ga0395900_0047809 3300037418 Bacteria 4407
114 Ga0395898_0023197 3300037466 Bacteria 6272
115 Ga0395898_0039686 3300037466 Bacteria 4658
116 Ga0395905_0036567 3300037471 Bacteria 4611
117 Ga0395905_0163081 3300037471 Bacteria 2094
118 Ga0395905_0330452 3300037471 Bacteria 1415
119 Ga0395905_0611751 3300037471 Bacteria 991
120 Ga0395901_0041887 3300038443 Bacteria 4746
121 Ga0395901_0046626 3300038443 Bacteria 4502
122 Ga0395901_0226353 3300038443 Bacteria 1953
123 Ga0395901_0289521 3300038443 Bacteria 1700
124 Ga0451789_0856576 3300041443 Bacteria 1825
125 Ga0451791_1664427 3300041451 Bacteria 950
126 Ga0451795_1335111 3300041456 Bacteria 2433
127 Ga0451800_1535833 3300041459 Bacteria 769
128 Ga0451804_0773246 3300041463 Bacteria 1610
129 Ga0451807_1002314 3300041486 Bacteria 1454
130 Ga0451833_0192505 3300041491 Bacteria 954
131 Ga0451853_3144704 3300041512 Bacteria 1302
132 Ga0439437_000357 3300042000 Bacteria 4366
133 Ga0439437_007657 3300042000 Bacteria 1208
134 Ga0450888_001131 3300042126 Bacteria 2541
135 Ga0450890_006023 3300042127 Bacteria 1558
136 Ga0450891_000535 3300042129 Bacteria 3948
137 Ga0450892_000213 3300042130 Bacteria 6912
138 Ga0450903_001486 3300042138 Bacteria 4369
139 Ga0450903_003467 3300042138 Bacteria 2730
140 Ga0450889_000593 3300042144 Bacteria 4028
141 Ga0450918_001403 3300042531 Bacteria 4791
142 Ga0451577_0422143 3300042876 Bacteria 1211
143 Ga0453684_0039949 3300044712 Bacteria 6381
144 Ga0453684_0089828 3300044712 Bacteria 3797
145 Ga0453684_1497978 3300044712 Bacteria 696
146 Ga0466957_0126861 3300044842 Bacteria 1631
147 Ga0495610_0033560 3300046512 Bacteria 2652
148 Ga0495632_0003999 3300046519 Bacteria 10200
149 Ga0495632_0099272 3300046519 Bacteria 1373
150 Ga0495643_0123965 3300046522 Bacteria 1303
151 Ga0495643_0214473 3300046522 Bacteria 917
152 Ga0495654_0012331 3300046530 Bacteria 4594
153 Ga0495597_0016208 3300046542 Bacteria 3522
154 Ga0495625_0005663 3300046660 Bacteria 11316
155 Ga0495625_0017597 3300046660 Bacteria 5593
156 Ga0495671_0289884 3300046692 Bacteria 788
157 Ga0495687_000259 3300047443 Bacteria 71307
158 Ga0495687_024358 3300047443 Bacteria 2877
159 Ga0495687_025934 3300047443 Bacteria 2763
160 Ga0495686_0168089 3300047472 Bacteria 1277
161 Ga0495686_0175275 3300047472 Bacteria 1245
162 Ga0495626_0037892 3300048091 Bacteria 2289
163 Ga0495626_0089465 3300048091 Bacteria 1356
164 Ga0496114_0003842 3300048917 Bacteria 11583
165 Ga0501033_0013119 3300049570 Bacteria 6314
166 Ga0501035_0107952 3300049822 Bacteria 2440
167 nmdc:mga03n38_130967_c1 3300050490 Bacteria 1243
168 nmdc:mga0yw44_23353_c1 3300050492 Bacteria 3483
169 nmdc:mga0k408_149463_c1 3300050493 Bacteria 1391
170 nmdc:mga0k408_17239_c1 3300050493 Bacteria 4021
171 nmdc:mga0k408_18670_c1 3300050493 Bacteria 3874
172 nmdc:mga0k408_46868_c1 3300050493 Bacteria 2497
173 nmdc:mga0k408_65265_c1 3300050493 Bacteria 2119
174 nmdc:mga0k408_73191_c1 3300050493 Bacteria 2001
175 nmdc:mga0k408_8455_c1 3300050493 Bacteria 5527
176 nmdc:mga0k408_89968_c1 3300050493 Bacteria 1803
177 nmdc:mga04h51_93217_c1 3300050495 Bacteria 1087
178 nmdc:mga07m45_111078_c1 3300050496 Bacteria 1579
179 nmdc:mga07m45_12321_c1 3300050496 Bacteria 4517
180 nmdc:mga07m45_129_c1 3300050496 Bacteria 29894
181 nmdc:mga07m45_46800_c1 3300050496 Bacteria 2431
182 nmdc:mga09592_3289_c1 3300050508 Bacteria 13083
183 nmdc:mga0sz30_5457_c1 3300050516 Bacteria 4665
184 Ga0500578_0002424 3300053086 Bacteria 15617
185 Ga0500644_0033658 3300053088 Bacteria 1647
186 Ga0500646_0003500 3300053090 Bacteria 4026
187 Ga0500651_0024295 3300053093 Bacteria 3799
188 Ga0500593_000341 3300053117 Bacteria 18764
189 Ga0500642_0013532 3300053130 Bacteria 3003
190 Ga0500652_000537 3300053131 Bacteria 13345
191 Ga0500658_0005729 3300053134 Bacteria 4626
192 Ga0500658_0046067 3300053134 Bacteria 1765
193 Ga0500568_0038962 3300053139 Bacteria 1921
194 Ga0500568_0042893 3300053139 Bacteria 1810
195 Ga0500577_0015315 3300053142 Bacteria 2392
196 Ga0500604_0008245 3300053151 Bacteria 2762
197 Ga0500604_0011372 3300053151 Bacteria 2389
198 Ga0500616_0038624 3300053153 Bacteria 2578
199 Ga0500616_0181920 3300053153 Bacteria 946
200 Ga0500619_000180 3300053154 Bacteria 15135
201 Ga0500622_0000202 3300053156 Bacteria 63233
202 Ga0500570_051674 3300053724 Bacteria 2062
203 Ga0500570_055100 3300053724 Bacteria 1968
204 Ga0500584_163226 3300053726 Bacteria 810
205 Ga0500587_010259 3300053739 Bacteria 1188
206 Ga0466962_0200103 3300061719 Bacteria 976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003791 Ga0055530_10003095 Ga0055530_100030958 189
2 3300003792 Ga0055540_1000002 Ga0055540_1000002235 189
3 3300003794 Ga0055531_10011344 Ga0055531_100113442 189
4 3300025298 Ga0209050_1000457 Ga0209050_100045765 189
5 3300025303 Ga0209051_1000024 Ga0209051_1000024236 189
6 3300025304 Ga0209257_1000079 Ga0209257_1000079236 189
7 3300042531 Ga0450918_001403 Ga0450918_001403_586_1239 191
8 3300005530 Ga0070679_100252510 Ga0070679_1002525101 193
9 3300025921 Ga0207652_10220280 Ga0207652_102202801 193
10 3300028794 Ga0307515_10088380 Ga0307515_100883801 198
11 3300030522 Ga0307512_10055762 Ga0307512_100557622 198
12 3300031616 Ga0307508_10000007 Ga0307508_1000000748 198
13 3300033179 Ga0307507_10181520 Ga0307507_101815202 198
14 3300041451 Ga0451791_1664427 Ga0451791_1664427_169_819 198
15 3300046519 Ga0495632_0099272 Ga0495632_0099272_645_1268 198
16 3300028794 Ga0307515_10000902 Ga0307515_100009023 199
17 3300005548 Ga0070665_100032576 Ga0070665_1000325764 203
18 3300013297 Ga0157378_10323668 Ga0157378_103236682 203
19 3300028379 Ga0268266_10055246 Ga0268266_100552462 203
20 3300031456 Ga0307513_10000004 Ga0307513_10000004457 203
21 3300003215 JGI25153J46596_10012182 JGI25153J46596_100121824 206
22 3300012502 Ga0157347_1002302 Ga0157347_10023023 206
23 3300025297 Ga0209758_1000045 Ga0209758_1000045246 206
24 3300031730 Ga0307516_10083591 Ga0307516_100835913 207
25 3300041491 Ga0451833_0192505 Ga0451833_0192505_204_854 207
26 3300041512 Ga0451853_3144704 Ga0451853_3144704_567_1217 207
27 3300050496 nmdc:mga07m45_46800_c1 nmdc:mga07m45_46800_c1_1615_2265 207
28 3300006195 Ga0075366_10358466 Ga0075366_103584661 208
29 3300041459 Ga0451800_1535833 Ga0451800_1535833_87_749 208
30 3300044842 Ga0466957_0126861 Ga0466957_0126861_358_984 208
31 3300006195 Ga0075366_10027302 Ga0075366_100273022 210
32 3300025909 Ga0207705_10387104 Ga0207705_103871042 210
33 3300025932 Ga0207690_10223154 Ga0207690_102231542 210
34 iso_pu_bacteria 2585428057 2587730033 210
35 iso_pu_bacteria 2588253510 2588293150 210
36 iso_pu_bacteria 2643221592 2643968374 210
37 iso_pu_bacteria 2643221648 2644272496 210
38 iso_pu_bacteria 2643221544 2643746529 211
39 iso_pu_bacteria 2643221639 2644220913 211
40 iso_pu_bacteria 2643221646 2644259757 211
41 iso_pu_bacteria 2738541337 2739057341 211
42 iso_pu_bacteria 2585428062 2587755582 212
43 3300042876 Ga0451577_0422143 Ga0451577_0422143_323_964 213
44 3300044712 Ga0453684_0039949 Ga0453684_0039949_4031_4684 213
45 3300044712 Ga0453684_1497978 Ga0453684_1497978_16_657 213
46 3300053139 Ga0500568_0042893 Ga0500568_0042893_178_819 213
47 iso_pu_bacteria 2585428058 2587734905 213
48 iso_pu_bacteria 2643221644 2644247795 213
49 iso_pu_bacteria 2643221654 2644304139 213
50 iso_pu_bacteria 2643221660 2644337587 213
51 3300002773 JGI25152J39213_1001898 JGI25152J39213_10018982 214
52 3300002774 JGI25150J39212_1029525 JGI25150J39212_10295251 214
53 3300003215 JGI25153J46596_10001824 JGI25153J46596_100018249 214
54 3300003771 Ga0055526_1005419 Ga0055526_10054192 214
55 3300003791 Ga0055530_10028582 Ga0055530_100285821 214
56 3300005262 Ga0065165_1002051 Ga0065165_10020517 214
57 3300006195 Ga0075366_10078818 Ga0075366_100788182 214
58 3300006880 Ga0075429_100002345 Ga0075429_1000023458 214
59 3300025245 Ga0207425_1000131 Ga0207425_100013113 214
60 3300025258 Ga0209129_1000075 Ga0209129_100007587 214
61 3300025295 Ga0209564_1000046 Ga0209564_1000046251 214
62 3300025297 Ga0209758_1000052 Ga0209758_1000052212 214
63 3300025298 Ga0209050_1002349 Ga0209050_10023493 214
64 3300025304 Ga0209257_1013414 Ga0209257_10134144 214
65 3300028786 Ga0307517_10186414 Ga0307517_101864142 214
66 3300028794 Ga0307515_10001283 Ga0307515_100012834 214
67 3300031456 Ga0307513_10180078 Ga0307513_101800782 214
68 3300031649 Ga0307514_10001428 Ga0307514_1000142823 214
69 3300031649 Ga0307514_10001840 Ga0307514_1000184023 214
70 3300033180 Ga0307510_10292872 Ga0307510_102928722 214
71 3300037312 Ga0395899_0086318 Ga0395899_0086318_1349_1993 214
72 3300038443 Ga0395901_0041887 Ga0395901_0041887_3816_4460 214
73 3300041443 Ga0451789_0856576 Ga0451789_0856576_763_1407 214
74 3300041456 Ga0451795_1335111 Ga0451795_1335111_1051_1695 214
75 3300041463 Ga0451804_0773246 Ga0451804_0773246_478_1122 214
76 3300041486 Ga0451807_1002314 Ga0451807_1002314_360_1004 214
77 3300044712 Ga0453684_0089828 Ga0453684_0089828_1618_2262 214
78 3300046519 Ga0495632_0003999 Ga0495632_0003999_9134_9778 214
79 3300046530 Ga0495654_0012331 Ga0495654_0012331_3888_4532 214
80 3300049570 Ga0501033_0013119 Ga0501033_0013119_3699_4349 214
81 3300049822 Ga0501035_0107952 Ga0501035_0107952_1595_2245 214
82 3300050493 nmdc:mga0k408_149463_c1 nmdc:mga0k408_149463_c1_566_1210 214
83 3300050493 nmdc:mga0k408_73191_c1 nmdc:mga0k408_73191_c1_234_878 214
84 3300050508 nmdc:mga09592_3289_c1 nmdc:mga09592_3289_c1_5620_6264 214
85 3300053086 Ga0500578_0002424 Ga0500578_0002424_7266_7910 214
86 3300053088 Ga0500644_0033658 Ga0500644_0033658_573_1217 214
87 3300053090 Ga0500646_0003500 Ga0500646_0003500_875_1519 214
88 3300053093 Ga0500651_0024295 Ga0500651_0024295_85_729 214
89 3300053130 Ga0500642_0013532 Ga0500642_0013532_617_1261 214
90 3300053131 Ga0500652_000537 Ga0500652_000537_2770_3414 214
91 3300053139 Ga0500568_0038962 Ga0500568_0038962_1019_1663 214
92 3300053142 Ga0500577_0015315 Ga0500577_0015315_1330_1974 214
93 3300053151 Ga0500604_0008245 Ga0500604_0008245_57_701 214
94 3300053151 Ga0500604_0011372 Ga0500604_0011372_1669_2313 214
95 3300053156 Ga0500622_0000202 Ga0500622_0000202_20165_20809 214
96 3300053724 Ga0500570_051674 Ga0500570_051674_658_1302 214
97 3300053726 Ga0500584_163226 Ga0500584_163226_150_794 214
98 3300005338 Ga0068868_100048027 Ga0068868_1000480274 215
99 3300005618 Ga0068864_100218560 Ga0068864_1002185602 215
100 3300005841 Ga0068863_100074457 Ga0068863_1000744572 215
101 3300005843 Ga0068860_100360747 Ga0068860_1003607472 215
102 3300009098 Ga0105245_10020380 Ga0105245_100203803 215
103 3300009098 Ga0105245_10390494 Ga0105245_103904942 215
104 3300013296 Ga0157374_10876927 Ga0157374_108769271 215
105 3300013308 Ga0157375_10170773 Ga0157375_101707731 215
106 3300025927 Ga0207687_10081720 Ga0207687_100817203 215
107 3300026023 Ga0207677_10102120 Ga0207677_101021203 215
108 3300026088 Ga0207641_10025146 Ga0207641_100251463 215
109 3300026095 Ga0207676_10133650 Ga0207676_101336503 215
110 3300028381 Ga0268264_10295377 Ga0268264_102953772 215
111 3300028794 Ga0307515_10021169 Ga0307515_100211692 215
112 3300031456 Ga0307513_10677750 Ga0307513_106777501 215
113 3300031911 Ga0307412_10044091 Ga0307412_100440912 215
114 3300037312 Ga0395899_0046620 Ga0395899_0046620_2188_2835 215
115 3300037418 Ga0395900_0045394 Ga0395900_0045394_2188_2835 215
116 3300037466 Ga0395898_0039686 Ga0395898_0039686_3265_3912 215
117 3300037471 Ga0395905_0163081 Ga0395905_0163081_1414_2061 215
118 3300037471 Ga0395905_0330452 Ga0395905_0330452_492_1139 215
119 3300038443 Ga0395901_0046626 Ga0395901_0046626_712_1359 215
120 3300042000 Ga0439437_000357 Ga0439437_000357_1579_2226 215
121 3300042126 Ga0450888_001131 Ga0450888_001131_398_1045 215
122 3300042127 Ga0450890_006023 Ga0450890_006023_96_743 215
123 3300042129 Ga0450891_000535 Ga0450891_000535_2843_3490 215
124 3300042130 Ga0450892_000213 Ga0450892_000213_380_1027 215
125 3300042138 Ga0450903_001486 Ga0450903_001486_3010_3657 215
126 3300042144 Ga0450889_000593 Ga0450889_000593_1439_2086 215
127 iso_pu_bacteria 2939631187 2939632810 215
128 3300006038 Ga0075365_10066231 Ga0075365_100662312 216
129 3300006186 Ga0075369_10167540 Ga0075369_101675401 216
130 3300028794 Ga0307515_10000991 Ga0307515_1000099144 216
131 3300031456 Ga0307513_10001123 Ga0307513_1000112321 216
132 3300031730 Ga0307516_10018786 Ga0307516_100187865 216
133 3300032004 Ga0307414_10319075 Ga0307414_103190752 216
134 3300046512 Ga0495610_0033560 Ga0495610_0033560_795_1445 216
135 3300046522 Ga0495643_0123965 Ga0495643_0123965_363_1013 216
136 3300046660 Ga0495625_0005663 Ga0495625_0005663_3980_4630 216
137 3300046692 Ga0495671_0289884 Ga0495671_0289884_66_716 216
138 3300047472 Ga0495686_0175275 Ga0495686_0175275_319_969 216
139 3300050492 nmdc:mga0yw44_23353_c1 nmdc:mga0yw44_23353_c1_1262_1912 216
140 3300053134 Ga0500658_0046067 Ga0500658_0046067_677_1327 216
141 3300053154 Ga0500619_000180 Ga0500619_000180_12084_12743 216
142 3300053724 Ga0500570_055100 Ga0500570_055100_268_918 216
143 3300053739 Ga0500587_010259 Ga0500587_010259_369_1019 216
144 3300003792 Ga0055540_1001667 Ga0055540_100166718 217
145 3300003794 Ga0055531_10002623 Ga0055531_100026238 217
146 3300005841 Ga0068863_100203037 Ga0068863_1002030372 217
147 3300006195 Ga0075366_10192274 Ga0075366_101922742 217
148 3300025273 Ga0209673_1020017 Ga0209673_10200173 217
149 3300025273 Ga0209673_1027031 Ga0209673_10270312 217
150 3300025297 Ga0209758_1056289 Ga0209758_10562892 217
151 3300025299 Ga0209256_1034078 Ga0209256_10340782 217
152 3300025303 Ga0209051_1000320 Ga0209051_100032014 217
153 3300025304 Ga0209257_1000161 Ga0209257_1000161121 217
154 3300025941 Ga0207711_10228148 Ga0207711_102281483 217
155 3300026088 Ga0207641_10067121 Ga0207641_100671212 217
156 3300026095 Ga0207676_10005025 Ga0207676_100050259 217
157 3300027876 Ga0209974_10007660 Ga0209974_100076602 217
158 3300037466 Ga0395898_0023197 Ga0395898_0023197_5089_5742 217
159 3300037471 Ga0395905_0611751 Ga0395905_0611751_282_935 217
160 3300038443 Ga0395901_0226353 Ga0395901_0226353_864_1517 217
161 3300042000 Ga0439437_007657 Ga0439437_007657_459_1112 217
162 3300042138 Ga0450903_003467 Ga0450903_003467_1913_2566 217
163 3300003775 Ga0055524_1000080 Ga0055524_100008084 218
164 3300005366 Ga0070659_100003231 Ga0070659_1000032317 218
165 3300005564 Ga0070664_100009716 Ga0070664_1000097165 218
166 3300006946 Ga0079104_1000017 Ga0079104_1000017218 218
167 3300025298 Ga0209050_1043329 Ga0209050_10433291 218
168 3300025299 Ga0209256_1000011 Ga0209256_1000011651 218
169 3300025919 Ga0207657_10647117 Ga0207657_106471171 218
170 3300025945 Ga0207679_10000536 Ga0207679_1000053615 218
171 3300027111 Ga0209281_1000042 Ga0209281_1000042131 218
172 3300037418 Ga0395900_0047809 Ga0395900_0047809_2344_3006 218
173 3300037471 Ga0395905_0036567 Ga0395905_0036567_1021_1683 218
174 3300038443 Ga0395901_0289521 Ga0395901_0289521_467_1129 218
175 3300047472 Ga0495686_0168089 Ga0495686_0168089_290_949 218
176 3300048917 Ga0496114_0003842 Ga0496114_0003842_4850_5512 218
177 3300053117 Ga0500593_000341 Ga0500593_000341_2002_2664 218
178 3300053153 Ga0500616_0181920 Ga0500616_0181920_113_772 218
179 3300061719 Ga0466962_0200103 Ga0466962_0200103_265_921 218
180 3300005577 Ga0068857_100310114 Ga0068857_1003101142 219
181 3300006048 Ga0075363_100144765 Ga0075363_1001447652 219
182 3300006195 Ga0075366_10064497 Ga0075366_100644971 219
183 3300006353 Ga0075370_10010457 Ga0075370_100104575 219
184 3300026116 Ga0207674_10416005 Ga0207674_104160052 219
185 3300031456 Ga0307513_10007193 Ga0307513_100071939 219
186 3300050490 nmdc:mga03n38_130967_c1 nmdc:mga03n38_130967_c1_289_960 219
187 3300050493 nmdc:mga0k408_17239_c1 nmdc:mga0k408_17239_c1_124_795 219
188 3300050493 nmdc:mga0k408_65265_c1 nmdc:mga0k408_65265_c1_48_719 219
189 3300050493 nmdc:mga0k408_89968_c1 nmdc:mga0k408_89968_c1_713_1384 219
190 3300050496 nmdc:mga07m45_111078_c1 nmdc:mga07m45_111078_c1_705_1376 219
191 3300050496 nmdc:mga07m45_129_c1 nmdc:mga07m45_129_c1_28098_28769 219
192 3300050516 nmdc:mga0sz30_5457_c1 nmdc:mga0sz30_5457_c1_880_1551 219
193 3300053153 Ga0500616_0038624 Ga0500616_0038624_1362_2021 219
194 3300001979 JGI24740J21852_10004336 JGI24740J21852_100043365 220
195 3300005518 Ga0070699_100111249 Ga0070699_1001112493 220
196 3300005563 Ga0068855_100035152 Ga0068855_1000351523 220
197 3300006042 Ga0075368_10029418 Ga0075368_100294183 220
198 3300006042 Ga0075368_10133451 Ga0075368_101334512 220
199 3300006178 Ga0075367_10095757 Ga0075367_100957572 220
200 3300006195 Ga0075366_10017237 Ga0075366_100172371 220
201 3300006195 Ga0075366_10038355 Ga0075366_100383553 220
202 3300006353 Ga0075370_10006030 Ga0075370_100060302 220
203 3300025910 Ga0207684_10001393 Ga0207684_1000139315 220
204 3300025949 Ga0207667_10086957 Ga0207667_100869573 220
205 3300026142 Ga0207698_10018603 Ga0207698_100186034 220
206 3300027866 Ga0209813_10078205 Ga0209813_100782052 220
207 3300046522 Ga0495643_0214473 Ga0495643_0214473_99_773 220
208 3300046542 Ga0495597_0016208 Ga0495597_0016208_2414_3085 220
209 3300046660 Ga0495625_0017597 Ga0495625_0017597_434_1108 220
210 3300047443 Ga0495687_000259 Ga0495687_000259_30781_31452 220
211 3300047443 Ga0495687_024358 Ga0495687_024358_581_1255 220
212 3300047443 Ga0495687_025934 Ga0495687_025934_1509_2183 220
213 3300048091 Ga0495626_0037892 Ga0495626_0037892_1212_1883 220
214 3300048091 Ga0495626_0089465 Ga0495626_0089465_286_960 220
215 3300050493 nmdc:mga0k408_18670_c1 nmdc:mga0k408_18670_c1_1323_1997 220
216 3300050493 nmdc:mga0k408_46868_c1 nmdc:mga0k408_46868_c1_1501_2181 220
217 3300050493 nmdc:mga0k408_8455_c1 nmdc:mga0k408_8455_c1_1533_2207 220
218 3300050495 nmdc:mga04h51_93217_c1 nmdc:mga04h51_93217_c1_210_890 220
219 3300050496 nmdc:mga07m45_12321_c1 nmdc:mga07m45_12321_c1_1151_1831 220
220 3300053134 Ga0500658_0005729 Ga0500658_0005729_2922_3596 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

49

175

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e26-assembly1.cif.gz_D structure of pffnt in apo state 0.3035 52 215
6xz3-assembly1.cif.gz_A-2 crystal structure of tlnrd1 4-helix bundle 0.2977 52 170
6s3s-assembly1.cif.gz_E structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.2886 52 219
6xz3-assembly1.cif.gz_A-2 crystal structure of tlnrd1 4-helix bundle 0.2765 52 170
6s3s-assembly1.cif.gz_E structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.2655 52 219
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7193 49 173 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7088 49 173 1.10.1760.20
af_Q58886_1_127_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4159 25 179 1.20.140.150
af_Q58886_1_127_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4093 25 179 1.20.140.150
af_K7M4K2_231_354_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3927 34 105 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A7K1FRZ7-F1-model_v4 DedA family protein 0.8718 23 219 GO:0005886
AF-A0A521XNQ1-F1-model_v4 DedA family protein 0.8631 22 210 GO:0005886
AF-A0A376LSR2-F1-model_v4 deleted 0.8625 28 185
AF-A0A1W6DUH9-F1-model_v4 VTT domain-containing protein 0.8544 20 216 GO:0005886
AF-A0A7S0W0E0-F1-model_v4 VTT domain-containing protein 0.8527 8 208 GO:0005886

Feature Viewer

pLDDT pTM Quality
73.94 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map