F330443

General Info

Members Datasets Scaffolds Average Seq Length
218 175 436 181

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0016189|Ga0501069_0016189_808_1422
Length 204
Sequence MIGDWRVTPREMIENPFRRRWAKMIESNHAAVVRLSRDTDVGRIADIYAYYVLHSPASFEVVPPDETEIARRRAMVRKCGLPHLVAEIDGAVVGYAYASPHRARAAYRYTLEDSVYVDRAHTRNGIGGLLLSEVIAASERAGYRQMVAVVGDSGNAASIGLHERLGFRRIGVMPAVGFKFGRWVDTVLLQRPLGAGDSSPAADT

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
153 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
158 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
159 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
160 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
161 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
162 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
174 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
175 2848858292 Azospirillum brasilense Az39 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.68
Nodule 0
Rhizoplane 2.75
Rhizosphere 77.52
Stem 0
Stem Tuber 0
Unclassified 16.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0016189 3300049585 Bacteria 4001
2 SwRhRL2b_contig_3700717 2162886007 Bacteria 1048
3 JGI25153J46596_10000193 3300003215 Bacteria 58625
4 Ga0065704_10151411 3300005289 Bacteria 1404
5 Ga0068869_100126947 3300005334 Bacteria 1957
6 Ga0070680_100285173 3300005336 Unclassified 1399
7 Ga0070682_100010575 3300005337 Bacteria 5239
8 Ga0070660_100276464 3300005339 Unclassified 1373
9 Ga0070691_10021338 3300005341 Bacteria 2996
10 Ga0070661_100903612 3300005344 Unclassified 729
11 Ga0070659_100588046 3300005366 Unclassified 956
12 Ga0070714_101131946 3300005435 Bacteria 763
13 Ga0070713_100315227 3300005436 Bacteria 1443
14 Ga0070705_100059689 3300005440 Bacteria 2259
15 Ga0070708_100080293 3300005445 Bacteria 2951
16 Ga0070678_100078098 3300005456 Unclassified 2500
17 Ga0070681_10326528 3300005458 Unclassified 1444
18 Ga0070706_100020590 3300005467 Bacteria 6078
19 Ga0070699_100010789 3300005518 Bacteria 7907
20 Ga0070679_100267325 3300005530 Bacteria 1665
21 Ga0068853_100240406 3300005539 Unclassified 1659
22 Ga0070695_100153434 3300005545 Unclassified 1610
23 Ga0070696_100059524 3300005546 Unclassified 2669
24 Ga0070693_100051669 3300005547 Bacteria 2354
25 Ga0070704_100296186 3300005549 Unclassified 1346
26 Ga0068857_100325452 3300005577 Unclassified 1420
27 Ga0068852_100767345 3300005616 Bacteria 977
28 Ga0068858_100048046 3300005842 Bacteria 3955
29 Ga0068860_100097740 3300005843 Unclassified 2799
30 Ga0075362_10321085 3300006177 Bacteria 771
31 Ga0097621_100345360 3300006237 Unclassified 1322
32 Ga0075428_100010831 3300006844 Bacteria 10137
33 Ga0075430_100536513 3300006846 Bacteria 965
34 Ga0075431_100384898 3300006847 Bacteria 1406
35 Ga0075431_101213153 3300006847 Bacteria 717
36 Ga0075429_100001839 3300006880 Bacteria 17561
37 Ga0068865_100358717 3300006881 Unclassified 1183
38 Ga0075436_100697198 3300006914 Unclassified 752
39 Ga0097620_100642873 3300006931 Bacteria 1153
40 Ga0099795_10001311 3300007788 Bacteria 5304
41 Ga0105247_10023068 3300009101 Unclassified 3748
42 Ga0114129_10001618 3300009147 Bacteria 30524
43 Ga0114129_10026762 3300009147 Bacteria 8169
44 Ga0105241_10102995 3300009174 Unclassified 2272
45 Ga0105237_10221929 3300009545 Unclassified 1890
46 Ga0105238_10030042 3300009551 Bacteria 5531
47 Ga0099796_10006608 3300010159 Bacteria 2981
48 Ga0105246_10002434 3300011119 Bacteria 11227
49 Ga0157370_10194055 3300013104 Bacteria 1885
50 Ga0157369_10282193 3300013105 Bacteria 1730
51 Ga0157374_10169698 3300013296 Unclassified 2128
52 Ga0157378_10043577 3300013297 Bacteria 3985
53 Ga0157379_10016911 3300014968 Bacteria 6418
54 Ga0157379_11226265 3300014968 Bacteria 722
55 Ga0157376_10521897 3300014969 Bacteria 1171
56 Ga0213875_10331696 3300021388 Bacteria 722
57 Ga0209758_1000005 3300025297 Bacteria 1368918
58 Ga0209257_1084070 3300025304 Bacteria 809
59 Ga0207653_10103192 3300025885 Unclassified 1011
60 Ga0207688_10015832 3300025901 Bacteria 4091
61 Ga0207647_10046751 3300025904 Bacteria 2695
62 Ga0207684_10051316 3300025910 Bacteria 3499
63 Ga0207707_10282216 3300025912 Unclassified 1438
64 Ga0207671_10196560 3300025914 Unclassified 1574
65 Ga0207660_10044305 3300025917 Bacteria 3130
66 Ga0207660_10147531 3300025917 Unclassified 1804
67 Ga0207662_10000131 3300025918 Bacteria 35953
68 Ga0207662_10122208 3300025918 Bacteria 1634
69 Ga0207657_10065314 3300025919 Unclassified 3102
70 Ga0207652_10004397 3300025921 Bacteria 11480
71 Ga0207652_10430138 3300025921 Bacteria 1190
72 Ga0207646_10106727 3300025922 Bacteria 2512
73 Ga0207694_10552773 3300025924 Unclassified 966
74 Ga0207687_10003702 3300025927 Bacteria 10287
75 Ga0207700_10330274 3300025928 Bacteria 1323
76 Ga0207700_10529742 3300025928 Bacteria 1044
77 Ga0207690_10355230 3300025932 Unclassified 1160
78 Ga0207670_10003537 3300025936 Bacteria 8289
79 Ga0207670_10334372 3300025936 Bacteria 1195
80 Ga0207704_10135118 3300025938 Bacteria 1715
81 Ga0207689_10002025 3300025942 Bacteria 19154
82 Ga0207689_10226341 3300025942 Unclassified 1546
83 Ga0207651_10017085 3300025960 Bacteria 4275
84 Ga0207640_10303325 3300025981 Bacteria 1264
85 Ga0207703_10208143 3300026035 Bacteria 1742
86 Ga0207703_10779174 3300026035 Bacteria 912
87 Ga0207703_10799679 3300026035 Unclassified 900
88 Ga0207639_10296495 3300026041 Bacteria 1428
89 Ga0207639_10663895 3300026041 Unclassified 965
90 Ga0207678_10625955 3300026067 Unclassified 944
91 Ga0207708_10000183 3300026075 Bacteria 49256
92 Ga0207702_10059926 3300026078 Bacteria 3244
93 Ga0207702_10210701 3300026078 Bacteria 1807
94 Ga0207648_10001400 3300026089 Bacteria 26519
95 Ga0207648_10719138 3300026089 Bacteria 926
96 Ga0207675_100000987 3300026118 Bacteria 28194
97 Ga0207683_10192110 3300026121 Bacteria 1854
98 Ga0207698_11134160 3300026142 Bacteria 795
99 Ga0209974_10029989 3300027876 Bacteria 1803
100 Ga0207428_10028904 3300027907 Bacteria 4601
101 Ga0268265_10004471 3300028380 Bacteria 9688
102 Ga0268265_10155279 3300028380 Bacteria 1935
103 Ga0268265_10166954 3300028380 Bacteria 1877
104 Ga0268264_10320138 3300028381 Unclassified 1466
105 Ga0268264_10463929 3300028381 Bacteria 1229
106 Ga0307517_10337297 3300028786 Bacteria 825
107 Ga0265338_10066576 3300028800 Bacteria 3117
108 Ga0307512_10104975 3300030522 Bacteria 1893
109 Ga0265330_10017616 3300031235 Bacteria 3287
110 Ga0265332_10004952 3300031238 Bacteria 6191
111 Ga0265332_10008388 3300031238 Bacteria 4644
112 Ga0265328_10006288 3300031239 Bacteria 5044
113 Ga0265328_10018947 3300031239 Bacteria 2648
114 Ga0265320_10002234 3300031240 Bacteria 13585
115 Ga0265325_10071402 3300031241 Bacteria 1743
116 Ga0265329_10020008 3300031242 Bacteria 2266
117 Ga0265329_10046382 3300031242 Bacteria 1388
118 Ga0265340_10012418 3300031247 Bacteria 4500
119 Ga0265339_10202900 3300031249 Unclassified 977
120 Ga0265331_10002953 3300031250 Bacteria 11208
121 Ga0265331_10007533 3300031250 Bacteria 6289
122 Ga0265316_10013591 3300031344 Bacteria 7223
123 Ga0265316_10031115 3300031344 Bacteria 4367
124 Ga0265316_10110804 3300031344 Bacteria 2078
125 Ga0307513_10552515 3300031456 Bacteria 864
126 Ga0307509_10000042 3300031507 Bacteria 178442
127 Ga0307508_10691145 3300031616 Bacteria 629
128 Ga0265314_10000675 3300031711 Bacteria 41616
129 Ga0307516_10019687 3300031730 Bacteria 6986
130 Ga0373944_0049586 3300035089 Bacteria 1320
131 Ga0373955_0231401 3300035172 Bacteria 1106
132 Ga0373935_0173974 3300035692 Bacteria 1474
133 Ga0373927_0022267 3300035695 Bacteria 4152
134 Ga0373927_0091174 3300035695 Bacteria 1979
135 Ga0373937_1424557 3300036401 Bacteria 641
136 Ga0373925_0675683 3300037068 Bacteria 851
137 Ga0451577_0010514 3300042876 Bacteria 8835
138 Ga0451577_0036141 3300042876 Bacteria 4448
139 Ga0453684_0202241 3300044712 Bacteria 2315
140 Ga0451576_0000937 3300045051 Bacteria 55001
141 Ga0451576_0064209 3300045051 Bacteria 3825
142 Ga0451576_1014664 3300045051 Bacteria 870
143 Ga0495638_0000739 3300046460 Bacteria 35077
144 Ga0495616_0277153 3300046513 Bacteria 713
145 Ga0495668_0006687 3300046616 Bacteria 7508
146 Ga0495625_0451737 3300046660 Bacteria 794
147 Ga0495686_0320017 3300047472 Bacteria 850
148 Ga0496100_0294078 3300048903 Unclassified 1214
149 Ga0496103_0023564 3300048906 Unclassified 3713
150 Ga0496105_0366705 3300048908 Unclassified 1148
151 Ga0496106_0144584 3300048909 Bacteria 1872
152 Ga0496107_0061534 3300048910 Bacteria 2718
153 Ga0496109_0476033 3300048912 Bacteria 1179
154 Ga0496126_0040623 3300048929 Bacteria 4312
155 Ga0495678_006225 3300049459 Bacteria 6377
156 Ga0501034_0541385 3300049571 Bacteria 1074
157 Ga0501037_0256117 3300049573 Bacteria 1224
158 Ga0501038_0061159 3300049574 Bacteria 3222
159 Ga0501047_0284028 3300049581 Bacteria 1499
160 Ga0501068_0162057 3300049584 Bacteria 1410
161 Ga0501070_0078797 3300049586 Bacteria 2726
162 Ga0501070_0119109 3300049586 Bacteria 2182
163 Ga0501070_0206871 3300049586 Unclassified 1611
164 Ga0501072_0666370 3300049588 Bacteria 819
165 Ga0501073_0097198 3300049589 Bacteria 2045
166 Ga0501073_0473156 3300049589 Bacteria 866
167 Ga0501074_0040915 3300049590 Bacteria 3356
168 Ga0501074_0435130 3300049590 Bacteria 930
169 Ga0501076_1182607 3300049592 Bacteria 629
170 Ga0501079_0284945 3300049741 Bacteria 1292
171 Ga0501080_0055602 3300049742 Bacteria 3687
172 Ga0501080_0135752 3300049742 Unclassified 2277
173 Ga0501083_0051604 3300049744 Bacteria 2765
174 Ga0501044_0038793 3300049823 Bacteria 4974
175 Ga0501044_0573735 3300049823 Bacteria 1023
176 nmdc:mga05p37_1084_c1 3300050507 Bacteria 31271
177 nmdc:mga05p37_2186_c1 3300050507 Bacteria 22803
178 nmdc:mga09592_64557_c1 3300050508 Bacteria 3100
179 nmdc:mga0qj67_476851_c1 3300050509 Bacteria 1004
180 nmdc:mga06r32_369833_c1 3300050510 Bacteria 1417
181 nmdc:mga08y16_1903_c1 3300050511 Bacteria 21275
182 nmdc:mga08y16_7974_c1 3300050511 Bacteria 11083
183 nmdc:mga0n895_223236_c1 3300050512 Bacteria 1913
184 nmdc:mga0rr50_6473_c1 3300050513 Bacteria 7133
185 nmdc:mga08x19_14213_c1 3300050514 Bacteria 4825
186 nmdc:mga0a205_5124_c1 3300050515 Bacteria 11783
187 Ga0500578_0000404 3300053086 Bacteria 53081
188 Ga0500578_0133698 3300053086 Bacteria 1554
189 Ga0500578_0344773 3300053086 Bacteria 872
190 Ga0500643_014721 3300053087 Bacteria 2707
191 Ga0500644_0056633 3300053088 Bacteria 1365
192 Ga0500651_0015275 3300053093 Bacteria 4711
193 Ga0500641_0003364 3300053096 Bacteria 5655
194 Ga0500641_0007900 3300053096 Bacteria 3794
195 Ga0500641_0008043 3300053096 Bacteria 3759
196 Ga0500650_0121793 3300053098 Bacteria 1216
197 Ga0500555_007052 3300053103 Bacteria 3195
198 Ga0500594_0000917 3300053118 Bacteria 6323
199 Ga0500594_0097263 3300053118 Bacteria 901
200 Ga0500595_000409 3300053119 Bacteria 27453
201 Ga0500595_064415 3300053119 Bacteria 1099
202 Ga0500642_0010411 3300053130 Bacteria 3276
203 Ga0500655_032273 3300053133 Bacteria 1011
204 Ga0500658_0401712 3300053134 Bacteria 627
205 Ga0500568_0069243 3300053139 Bacteria 1353
206 Ga0500577_0062090 3300053142 Bacteria 1440
207 Ga0500577_0102233 3300053142 Bacteria 1173
208 Ga0500588_0035932 3300053146 Bacteria 1461
209 Ga0500588_0044471 3300053146 Bacteria 1355
210 Ga0500604_0010867 3300053151 Bacteria 2439
211 Ga0500622_0121340 3300053156 Bacteria 1267
212 Ga0500636_0196582 3300053177 Bacteria 1070
213 Ga0500611_036678 3300053727 Bacteria 1051
214 Ga0500645_021434 3300053730 Bacteria 1994
215 Ga0501082_1092155 3300060353 Bacteria 697
216 2599101086 2597490356 Bacteria 7030811
217 2846954194 2846952575 Bacteria 6587527
218 2848859669 2848858292 Bacteria 7391279
219 Ga0501069_0016189
220 SwRhRL2b_contig_3700717
221 JGI25153J46596_10000193
222 Ga0065704_10151411
223 Ga0068869_100126947
224 Ga0070680_100285173
225 Ga0070682_100010575
226 Ga0070660_100276464
227 Ga0070691_10021338
228 Ga0070661_100903612
229 Ga0070659_100588046
230 Ga0070714_101131946
231 Ga0070713_100315227
232 Ga0070705_100059689
233 Ga0070708_100080293
234 Ga0070678_100078098
235 Ga0070681_10326528
236 Ga0070706_100020590
237 Ga0070699_100010789
238 Ga0070679_100267325
239 Ga0068853_100240406
240 Ga0070695_100153434
241 Ga0070696_100059524
242 Ga0070693_100051669
243 Ga0070704_100296186
244 Ga0068857_100325452
245 Ga0068852_100767345
246 Ga0068858_100048046
247 Ga0068860_100097740
248 Ga0075362_10321085
249 Ga0097621_100345360
250 Ga0075428_100010831
251 Ga0075430_100536513
252 Ga0075431_100384898
253 Ga0075431_101213153
254 Ga0075429_100001839
255 Ga0068865_100358717
256 Ga0075436_100697198
257 Ga0097620_100642873
258 Ga0099795_10001311
259 Ga0105247_10023068
260 Ga0114129_10001618
261 Ga0114129_10026762
262 Ga0105241_10102995
263 Ga0105237_10221929
264 Ga0105238_10030042
265 Ga0099796_10006608
266 Ga0105246_10002434
267 Ga0157370_10194055
268 Ga0157369_10282193
269 Ga0157374_10169698
270 Ga0157378_10043577
271 Ga0157379_10016911
272 Ga0157379_11226265
273 Ga0157376_10521897
274 Ga0213875_10331696
275 Ga0209758_1000005
276 Ga0209257_1084070
277 Ga0207653_10103192
278 Ga0207688_10015832
279 Ga0207647_10046751
280 Ga0207684_10051316
281 Ga0207707_10282216
282 Ga0207671_10196560
283 Ga0207660_10044305
284 Ga0207660_10147531
285 Ga0207662_10000131
286 Ga0207662_10122208
287 Ga0207657_10065314
288 Ga0207652_10004397
289 Ga0207652_10430138
290 Ga0207646_10106727
291 Ga0207694_10552773
292 Ga0207687_10003702
293 Ga0207700_10330274
294 Ga0207700_10529742
295 Ga0207690_10355230
296 Ga0207670_10003537
297 Ga0207670_10334372
298 Ga0207704_10135118
299 Ga0207689_10002025
300 Ga0207689_10226341
301 Ga0207651_10017085
302 Ga0207640_10303325
303 Ga0207703_10208143
304 Ga0207703_10779174
305 Ga0207703_10799679
306 Ga0207639_10296495
307 Ga0207639_10663895
308 Ga0207678_10625955
309 Ga0207708_10000183
310 Ga0207702_10059926
311 Ga0207702_10210701
312 Ga0207648_10001400
313 Ga0207648_10719138
314 Ga0207675_100000987
315 Ga0207683_10192110
316 Ga0207698_11134160
317 Ga0209974_10029989
318 Ga0207428_10028904
319 Ga0268265_10004471
320 Ga0268265_10155279
321 Ga0268265_10166954
322 Ga0268264_10320138
323 Ga0268264_10463929
324 Ga0307517_10337297
325 Ga0265338_10066576
326 Ga0307512_10104975
327 Ga0265330_10017616
328 Ga0265332_10004952
329 Ga0265332_10008388
330 Ga0265328_10006288
331 Ga0265328_10018947
332 Ga0265320_10002234
333 Ga0265325_10071402
334 Ga0265329_10020008
335 Ga0265329_10046382
336 Ga0265340_10012418
337 Ga0265339_10202900
338 Ga0265331_10002953
339 Ga0265331_10007533
340 Ga0265316_10013591
341 Ga0265316_10031115
342 Ga0265316_10110804
343 Ga0307513_10552515
344 Ga0307509_10000042
345 Ga0307508_10691145
346 Ga0265314_10000675
347 Ga0307516_10019687
348 Ga0373944_0049586
349 Ga0373955_0231401
350 Ga0373935_0173974
351 Ga0373927_0022267
352 Ga0373927_0091174
353 Ga0373937_1424557
354 Ga0373925_0675683
355 Ga0451577_0010514
356 Ga0451577_0036141
357 Ga0453684_0202241
358 Ga0451576_0000937
359 Ga0451576_0064209
360 Ga0451576_1014664
361 Ga0495638_0000739
362 Ga0495616_0277153
363 Ga0495668_0006687
364 Ga0495625_0451737
365 Ga0495686_0320017
366 Ga0496100_0294078
367 Ga0496103_0023564
368 Ga0496105_0366705
369 Ga0496106_0144584
370 Ga0496107_0061534
371 Ga0496109_0476033
372 Ga0496126_0040623
373 Ga0495678_006225
374 Ga0501034_0541385
375 Ga0501037_0256117
376 Ga0501038_0061159
377 Ga0501047_0284028
378 Ga0501068_0162057
379 Ga0501070_0078797
380 Ga0501070_0119109
381 Ga0501070_0206871
382 Ga0501072_0666370
383 Ga0501073_0097198
384 Ga0501073_0473156
385 Ga0501074_0040915
386 Ga0501074_0435130
387 Ga0501076_1182607
388 Ga0501079_0284945
389 Ga0501080_0055602
390 Ga0501080_0135752
391 Ga0501083_0051604
392 Ga0501044_0038793
393 Ga0501044_0573735
394 nmdc:mga05p37_1084_c1
395 nmdc:mga05p37_2186_c1
396 nmdc:mga09592_64557_c1
397 nmdc:mga0qj67_476851_c1
398 nmdc:mga06r32_369833_c1
399 nmdc:mga08y16_1903_c1
400 nmdc:mga08y16_7974_c1
401 nmdc:mga0n895_223236_c1
402 nmdc:mga0rr50_6473_c1
403 nmdc:mga08x19_14213_c1
404 nmdc:mga0a205_5124_c1
405 Ga0500578_0000404
406 Ga0500578_0133698
407 Ga0500578_0344773
408 Ga0500643_014721
409 Ga0500644_0056633
410 Ga0500651_0015275
411 Ga0500641_0003364
412 Ga0500641_0007900
413 Ga0500641_0008043
414 Ga0500650_0121793
415 Ga0500555_007052
416 Ga0500594_0000917
417 Ga0500594_0097263
418 Ga0500595_000409
419 Ga0500595_064415
420 Ga0500642_0010411
421 Ga0500655_032273
422 Ga0500658_0401712
423 Ga0500568_0069243
424 Ga0500577_0062090
425 Ga0500577_0102233
426 Ga0500588_0035932
427 Ga0500588_0044471
428 Ga0500604_0010867
429 Ga0500622_0121340
430 Ga0500636_0196582
431 Ga0500611_036678
432 Ga0500645_021434
433 Ga0501082_1092155
434 2599101086
435 2846954194
436 2848859669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

106

174

0.9

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

33

188

0.89

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

47

167

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

80

169

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9932 2 172
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9845 2 163
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9818 2 172
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.981 2 164
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9809 1 163
ID Description Score Start End Superfamily
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9912 2 172 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9802 2 164 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9798 2 172 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9743 2 164 3.40.630.30
3dr6B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.956 1 169 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4R3J6E5-F1-model_v4 Phosphinothricin acetyltransferase 1 2 171 GO:0016747
AF-A0A4R7XAS7-F1-model_v4 Phosphinothricin acetyltransferase 1 2 172 GO:0016747
AF-A0A381AKU7-F1-model_v4 deleted 1 1 172
AF-A0A521LYP4-F1-model_v4 N-acetyltransferase family protein 0.9997 1 171 GO:0016747
AF-A0A537T1M5-F1-model_v4 N-acetyltransferase family protein 0.9997 63 171 GO:0016747

Map