F329606

General Info

Members Datasets Scaffolds Average Seq Length
218 166 216 133

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100075937|Ga0070668_1000759371
Length 151
Sequence VQRDKIYTIHVNLHLSTVDRMQPHLEIIGIILILLAAIHIAFPQYFNWKKELGSLRLINRQMMYVHTFFIAFTVFLMGLLCLTSAPELTLTPLGKKISLGLSLFWLTRLLFQFFGYSSLLWKGKNFETIVHITFTCLWIYFSIVFLMIFLT

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
144 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
145 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
154 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
155 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
157 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
158 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
164 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
165 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.01
Nodule 0
Rhizoplane 0
Rhizosphere 86.7
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10028533 3300003316 Unclassified 2393
2 rootH2_10008804 3300003320 Bacteria 29472
3 Ga0055530_10032904 3300003791 Bacteria 1343
4 Ga0065707_10495282 3300005295 Unclassified 762
5 Ga0070658_10048307 3300005327 Bacteria 3445
6 Ga0070670_100054117 3300005331 Bacteria 3445
7 Ga0070670_100317585 3300005331 Unclassified 1364
8 Ga0068869_100707680 3300005334 Unclassified 859
9 Ga0070666_10133205 3300005335 Bacteria 1728
10 Ga0070680_100268645 3300005336 Bacteria 1444
11 Ga0068868_100163960 3300005338 Bacteria 1837
12 Ga0070687_100024495 3300005343 Bacteria 2882
13 Ga0070668_100075937 3300005347 Bacteria 2624
14 Ga0070669_100320065 3300005353 Bacteria 1252
15 Ga0070669_100336753 3300005353 Bacteria 1222
16 Ga0070674_100021466 3300005356 Bacteria 4146
17 Ga0070659_100326204 3300005366 Bacteria 1284
18 Ga0070659_100569228 3300005366 Bacteria 971
19 Ga0070667_100035166 3300005367 Unclassified 4196
20 Ga0070700_100047150 3300005441 Bacteria 2666
21 Ga0070663_100351004 3300005455 Bacteria 1194
22 Ga0070678_100017833 3300005456 Bacteria 4582
23 Ga0070662_100652336 3300005457 Bacteria 888
24 Ga0070681_10127170 3300005458 Bacteria 2481
25 Ga0068867_100007580 3300005459 Bacteria 7680
26 Ga0070685_10328816 3300005466 Bacteria 1038
27 Ga0070698_100001241 3300005471 Bacteria 28439
28 Ga0070679_100065812 3300005530 Bacteria 3612
29 Ga0070679_100639859 3300005530 Bacteria 1006
30 Ga0070679_100724591 3300005530 Bacteria 937
31 Ga0068853_100650116 3300005539 Bacteria 1003
32 Ga0070665_100087096 3300005548 Bacteria 3128
33 Ga0068855_100002670 3300005563 Bacteria 21981
34 Ga0068855_101057352 3300005563 Bacteria 850
35 Ga0070664_100221434 3300005564 Bacteria 1693
36 Ga0068857_100278695 3300005577 Bacteria 1537
37 Ga0068857_100584590 3300005577 Bacteria 1054
38 Ga0068854_100065624 3300005578 Bacteria 2639
39 Ga0068854_102110098 3300005578 Bacteria 520
40 Ga0068856_100044953 3300005614 Bacteria 4347
41 Ga0068856_100902718 3300005614 Bacteria 902
42 Ga0068852_100016000 3300005616 Bacteria 5839
43 Ga0068852_100111839 3300005616 Bacteria 2484
44 Ga0068852_100170450 3300005616 Bacteria 2040
45 Ga0068852_100516479 3300005616 Bacteria 1191
46 Ga0068859_100276813 3300005617 Bacteria 1771
47 Ga0068859_100456253 3300005617 Bacteria 1374
48 Ga0068859_100596264 3300005617 Bacteria 1198
49 Ga0068864_100565655 3300005618 Bacteria 1100
50 Ga0068864_101489074 3300005618 Bacteria 680
51 Ga0068866_10034619 3300005718 Bacteria 2461
52 Ga0068861_100033187 3300005719 Bacteria 3806
53 Ga0068851_10607096 3300005834 Unclassified 666
54 Ga0068863_100669684 3300005841 Bacteria 1030
55 Ga0068860_100047596 3300005843 Bacteria 4087
56 Ga0068860_100102241 3300005843 Bacteria 2734
57 Ga0097621_100030935 3300006237 Bacteria 4242
58 Ga0068871_100453895 3300006358 Bacteria 1149
59 Ga0075428_100114928 3300006844 Bacteria 2931
60 Ga0068865_100001928 3300006881 Bacteria 12208
61 Ga0097620_100276824 3300006931 Bacteria 1771
62 Ga0097620_100456237 3300006931 Bacteria 1374
63 Ga0097620_100596259 3300006931 Bacteria 1198
64 Ga0105240_10005668 3300009093 Bacteria 18536
65 Ga0105240_10033210 3300009093 Bacteria 6670
66 Ga0105240_10616103 3300009093 Bacteria 1193
67 Ga0111539_10006668 3300009094 Bacteria 14871
68 Ga0105247_10001867 3300009101 Bacteria 14743
69 Ga0114129_11770045 3300009147 Bacteria 752
70 Ga0105241_10513190 3300009174 Bacteria 1071
71 Ga0105241_10582714 3300009174 Unclassified 1008
72 Ga0105242_10198232 3300009176 Bacteria 1782
73 Ga0105237_10056040 3300009545 Bacteria 3947
74 Ga0105237_10151730 3300009545 Bacteria 2314
75 Ga0105238_10116790 3300009551 Bacteria 2648
76 Ga0105249_10434343 3300009553 Bacteria 1349
77 Ga0105239_10001335 3300010375 Bacteria 33242
78 Ga0105246_10191882 3300011119 Bacteria 1582
79 Ga0157373_10107176 3300013100 Bacteria 1964
80 Ga0157371_10076643 3300013102 Bacteria 2368
81 Ga0157371_10636812 3300013102 Unclassified 795
82 Ga0157370_10001863 3300013104 Bacteria 26004
83 Ga0157370_10992186 3300013104 Bacteria 760
84 Ga0157374_10196937 3300013296 Bacteria 1972
85 Ga0157378_10232048 3300013297 Bacteria 1759
86 Ga0157372_10007327 3300013307 Bacteria 11744
87 Ga0157372_10043231 3300013307 Bacteria 4987
88 Ga0157372_10256041 3300013307 Bacteria 2032
89 Ga0157372_11387683 3300013307 Bacteria 810
90 Ga0157377_10030434 3300014745 Bacteria 2924
91 Ga0163161_10134524 3300017792 Bacteria 1867
92 Ga0209436_101646 3300025208 Bacteria 7453
93 Ga0209130_1002204 3300025284 Bacteria 10237
94 Ga0207426_1000164 3300025302 Bacteria 171465
95 Ga0207647_10025336 3300025904 Unclassified 3899
96 Ga0207645_10047615 3300025907 Bacteria 2738
97 Ga0207643_10061552 3300025908 Bacteria 2144
98 Ga0207705_10014025 3300025909 Bacteria 5775
99 Ga0207654_10230033 3300025911 Bacteria 1234
100 Ga0207707_10004456 3300025912 Bacteria 12335
101 Ga0207707_11384388 3300025912 Bacteria 562
102 Ga0207695_10016074 3300025913 Bacteria 8777
103 Ga0207695_10172066 3300025913 Bacteria 2091
104 Ga0207671_10045307 3300025914 Bacteria 3252
105 Ga0207671_10090319 3300025914 Bacteria 2307
106 Ga0207671_10100534 3300025914 Bacteria 2190
107 Ga0207660_10014954 3300025917 Bacteria 5115
108 Ga0207662_10192754 3300025918 Bacteria 1316
109 Ga0207652_10014261 3300025921 Bacteria 6436
110 Ga0207652_10510505 3300025921 Bacteria 1082
111 Ga0207652_10593733 3300025921 Bacteria 993
112 Ga0207681_10038724 3300025923 Bacteria 3161
113 Ga0207694_10095116 3300025924 Bacteria 2355
114 Ga0207659_10170021 3300025926 Bacteria 1719
115 Ga0207690_10374083 3300025932 Bacteria 1131
116 Ga0207690_10422801 3300025932 Bacteria 1066
117 Ga0207706_10388923 3300025933 Bacteria 1210
118 Ga0207686_10051638 3300025934 Bacteria 2562
119 Ga0207669_10097857 3300025937 Bacteria 1931
120 Ga0207704_10017837 3300025938 Bacteria 3692
121 Ga0207704_11765149 3300025938 Bacteria 532
122 Ga0207691_10004759 3300025940 Bacteria 13125
123 Ga0207689_10051446 3300025942 Bacteria 3396
124 Ga0207689_10198826 3300025942 Unclassified 1654
125 Ga0207679_10534864 3300025945 Unclassified 1050
126 Ga0207667_10000478 3300025949 Bacteria 53228
127 Ga0207667_10000598 3300025949 Bacteria 46822
128 Ga0207667_11389672 3300025949 Bacteria 676
129 Ga0207712_10364743 3300025961 Bacteria 1204
130 Ga0207668_10061141 3300025972 Bacteria 2647
131 Ga0207658_10068454 3300025986 Unclassified 2679
132 Ga0207677_11713750 3300026023 Bacteria 583
133 Ga0207639_10742886 3300026041 Bacteria 912
134 Ga0207678_10285163 3300026067 Bacteria 1418
135 Ga0207708_10152715 3300026075 Bacteria 1819
136 Ga0207702_10356748 3300026078 Bacteria 1400
137 Ga0207702_10735185 3300026078 Bacteria 974
138 Ga0207641_10586385 3300026088 Bacteria 1090
139 Ga0207648_10018048 3300026089 Bacteria 6394
140 Ga0207676_10650457 3300026095 Bacteria 1017
141 Ga0207674_10021335 3300026116 Bacteria 6978
142 Ga0207674_10162753 3300026116 Bacteria 2186
143 Ga0207674_10351813 3300026116 Unclassified 1424
144 Ga0207674_10844958 3300026116 Bacteria 883
145 Ga0207675_100082732 3300026118 Bacteria 3011
146 Ga0207683_10000943 3300026121 Bacteria 26669
147 Ga0207698_10050369 3300026142 Bacteria 3176
148 Ga0207698_10208859 3300026142 Bacteria 1755
149 Ga0207698_10317351 3300026142 Bacteria 1458
150 Ga0207698_10434618 3300026142 Bacteria 1263
151 Ga0268266_10268332 3300028379 Bacteria 1583
152 Ga0268264_10063632 3300028381 Bacteria 3102
153 Ga0307515_10000135 3300028794 Bacteria 175323
154 Ga0265331_10158137 3300031250 Unclassified 1028
155 Ga0265327_10000051 3300031251 Bacteria 257963
156 Ga0265327_10015851 3300031251 Bacteria 4832
157 Ga0265327_10306413 3300031251 Bacteria 698
158 Ga0307513_10360055 3300031456 Bacteria 1200
159 Ga0307414_10090037 3300032004 Bacteria 2276
160 Ga0307414_11037813 3300032004 Bacteria 756
161 Ga0307411_10004604 3300032005 Bacteria 6637
162 Ga0373925_1394680 3300037068 Bacteria 574
163 Ga0395899_0027898 3300037312 Bacteria 4252
164 Ga0395900_0124341 3300037418 Bacteria 2645
165 Ga0395900_0135172 3300037418 Bacteria 2526
166 Ga0395898_0048128 3300037466 Bacteria 4182
167 Ga0395905_0103476 3300037471 Bacteria 2673
168 Ga0395905_0107833 3300037471 Bacteria 2615
169 Ga0395901_0053613 3300038443 Bacteria 4190
170 Ga0439431_0180302 3300041997 Unclassified 610
171 Ga0466969_0123802 3300044656 Unclassified 1202
172 Ga0466966_0569780 3300044684 Unclassified 681
173 Ga0466961_0218376 3300044693 Unclassified 1175
174 Ga0453684_0502073 3300044712 Bacteria 1343
175 Ga0466971_0104268 3300044719 Unclassified 1305
176 Ga0466959_0141999 3300045049 Bacteria 1696
177 Ga0495638_0000004 3300046460 Bacteria 700795
178 Ga0495650_0024282 3300046471 Bacteria 2865
179 Ga0495585_0022128 3300046492 Bacteria 3649
180 Ga0495583_0219806 3300046506 Bacteria 768
181 Ga0495610_0302475 3300046512 Unclassified 616
182 Ga0495648_0009760 3300046524 Bacteria 7393
183 Ga0495609_0010455 3300046538 Bacteria 4448
184 Ga0495622_0086827 3300046557 Bacteria 1438
185 Ga0495633_0000025 3300046558 Bacteria 218627
186 Ga0495668_0001354 3300046616 Bacteria 24058
187 Ga0495625_0002493 3300046660 Bacteria 19845
188 Ga0495658_0415601 3300046683 Bacteria 858
189 Ga0495600_0119087 3300046809 Bacteria 1717
190 Ga0495614_0033349 3300048089 Bacteria 2215
191 Ga0495682_0138299 3300049460 Bacteria 870
192 Ga0501238_003774 3300049671 Unclassified 1873
193 Ga0501259_040619 3300049688 Bacteria 913
194 nmdc:mga0k408_28930_c1 3300050493 Bacteria 3152
195 nmdc:mga09592_644132_c1 3300050508 Bacteria 905
196 Ga0500644_0301897 3300053088 Unclassified 685
197 Ga0500651_0386523 3300053093 Bacteria 788
198 Ga0500650_0227740 3300053098 Unclassified 842
199 Ga0500569_082656 3300053109 Bacteria 1029
200 Ga0500608_008211 3300053122 Bacteria 4374
201 Ga0500614_019284 3300053123 Bacteria 1562
202 Ga0500618_007302 3300053125 Bacteria 3164
203 Ga0500652_203132 3300053131 Bacteria 803
204 Ga0500658_0142031 3300053134 Bacteria 1077
205 Ga0500559_0072959 3300053136 Unclassified 1548
206 Ga0500561_0039042 3300053137 Bacteria 1244
207 Ga0500577_0001002 3300053142 Bacteria 7277
208 Ga0500590_315631 3300053148 Bacteria 579
209 Ga0500616_0039838 3300053153 Bacteria 2530
210 Ga0500622_0018897 3300053156 Bacteria 3662
211 Ga0500633_0056242 3300053160 Unclassified 1372
212 Ga0500633_0230774 3300053160 Bacteria 690
213 Ga0500634_0046798 3300053161 Bacteria 2336
214 Ga0500636_0101600 3300053177 Unclassified 1634
215 Ga0466962_0191693 3300061719 Bacteria 997
216 Ga0466962_0508984 3300061719 Bacteria 610

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0072959 Ga0500559_0072959_555_956 128
2 3300053148 Ga0500590_315631 Ga0500590_315631_81_482 128
3 3300053177 Ga0500636_0101600 Ga0500636_0101600_1152_1553 128
4 iso_pu_bacteria 2818991444 2819589141 128
5 iso_pu_bacteria 2914759650 2914760495 128
6 3300005458 Ga0070681_10127170 Ga0070681_101271703 130
7 3300005530 Ga0070679_100724591 Ga0070679_1007245911 130
8 3300005577 Ga0068857_100584590 Ga0068857_1005845902 130
9 3300005578 Ga0068854_102110098 Ga0068854_1021100981 130
10 3300025912 Ga0207707_10004456 Ga0207707_100044563 130
11 3300025921 Ga0207652_10593733 Ga0207652_105937332 130
12 3300026116 Ga0207674_10162753 Ga0207674_101627533 130
13 3300005327 Ga0070658_10048307 Ga0070658_100483071 131
14 3300005331 Ga0070670_100054117 Ga0070670_1000541172 131
15 3300005334 Ga0068869_100707680 Ga0068869_1007076802 131
16 3300005335 Ga0070666_10133205 Ga0070666_101332053 131
17 3300005336 Ga0070680_100268645 Ga0070680_1002686451 131
18 3300005343 Ga0070687_100024495 Ga0070687_1000244955 131
19 3300005347 Ga0070668_100075937 Ga0070668_1000759371 131
20 3300005353 Ga0070669_100320065 Ga0070669_1003200652 131
21 3300005353 Ga0070669_100336753 Ga0070669_1003367531 131
22 3300005356 Ga0070674_100021466 Ga0070674_1000214662 131
23 3300005366 Ga0070659_100326204 Ga0070659_1003262042 131
24 3300005441 Ga0070700_100047150 Ga0070700_1000471503 131
25 3300005455 Ga0070663_100351004 Ga0070663_1003510042 131
26 3300005456 Ga0070678_100017833 Ga0070678_1000178335 131
27 3300005459 Ga0068867_100007580 Ga0068867_1000075806 131
28 3300005466 Ga0070685_10328816 Ga0070685_103288161 131
29 3300005471 Ga0070698_100001241 Ga0070698_10000124124 131
30 3300005530 Ga0070679_100065812 Ga0070679_1000658125 131
31 3300005548 Ga0070665_100087096 Ga0070665_1000870962 131
32 3300005563 Ga0068855_100002670 Ga0068855_10000267016 131
33 3300005564 Ga0070664_100221434 Ga0070664_1002214343 131
34 3300005578 Ga0068854_100065624 Ga0068854_1000656244 131
35 3300005614 Ga0068856_100902718 Ga0068856_1009027181 131
36 3300005616 Ga0068852_100170450 Ga0068852_1001704503 131
37 3300005617 Ga0068859_100276813 Ga0068859_1002768133 131
38 3300005617 Ga0068859_100456253 Ga0068859_1004562532 131
39 3300005617 Ga0068859_100596264 Ga0068859_1005962642 131
40 3300005719 Ga0068861_100033187 Ga0068861_1000331874 131
41 3300005834 Ga0068851_10607096 Ga0068851_106070961 131
42 3300005841 Ga0068863_100669684 Ga0068863_1006696842 131
43 3300005843 Ga0068860_100102241 Ga0068860_1001022412 131
44 3300006237 Ga0097621_100030935 Ga0097621_1000309354 131
45 3300006844 Ga0075428_100114928 Ga0075428_1001149285 131
46 3300006881 Ga0068865_100001928 Ga0068865_1000019285 131
47 3300006931 Ga0097620_100276824 Ga0097620_1002768243 131
48 3300006931 Ga0097620_100456237 Ga0097620_1004562372 131
49 3300006931 Ga0097620_100596259 Ga0097620_1005962592 131
50 3300009093 Ga0105240_10616103 Ga0105240_106161032 131
51 3300009101 Ga0105247_10001867 Ga0105247_1000186714 131
52 3300009176 Ga0105242_10198232 Ga0105242_101982322 131
53 3300009553 Ga0105249_10434343 Ga0105249_104343432 131
54 3300011119 Ga0105246_10191882 Ga0105246_101918822 131
55 3300013102 Ga0157371_10076643 Ga0157371_100766434 131
56 3300013296 Ga0157374_10196937 Ga0157374_101969373 131
57 3300013307 Ga0157372_10043231 Ga0157372_100432317 131
58 3300013307 Ga0157372_10256041 Ga0157372_102560413 131
59 3300013307 Ga0157372_11387683 Ga0157372_113876831 131
60 3300025907 Ga0207645_10047615 Ga0207645_100476155 131
61 3300025909 Ga0207705_10014025 Ga0207705_100140255 131
62 3300025912 Ga0207707_11384388 Ga0207707_113843881 131
63 3300025914 Ga0207671_10045307 Ga0207671_100453075 131
64 3300025917 Ga0207660_10014954 Ga0207660_100149545 131
65 3300025918 Ga0207662_10192754 Ga0207662_101927543 131
66 3300025921 Ga0207652_10014261 Ga0207652_100142615 131
67 3300025923 Ga0207681_10038724 Ga0207681_100387244 131
68 3300025932 Ga0207690_10374083 Ga0207690_103740831 131
69 3300025933 Ga0207706_10388923 Ga0207706_103889231 131
70 3300025934 Ga0207686_10051638 Ga0207686_100516382 131
71 3300025938 Ga0207704_10017837 Ga0207704_100178375 131
72 3300025940 Ga0207691_10004759 Ga0207691_1000475912 131
73 3300025942 Ga0207689_10051446 Ga0207689_100514462 131
74 3300025942 Ga0207689_10198826 Ga0207689_101988262 131
75 3300025945 Ga0207679_10534864 Ga0207679_105348642 131
76 3300025949 Ga0207667_10000478 Ga0207667_1000047828 131
77 3300025961 Ga0207712_10364743 Ga0207712_103647432 131
78 3300025972 Ga0207668_10061141 Ga0207668_100611415 131
79 3300026023 Ga0207677_11713750 Ga0207677_117137501 131
80 3300026067 Ga0207678_10285163 Ga0207678_102851632 131
81 3300026075 Ga0207708_10152715 Ga0207708_101527152 131
82 3300026078 Ga0207702_10735185 Ga0207702_107351851 131
83 3300026088 Ga0207641_10586385 Ga0207641_105863852 131
84 3300026089 Ga0207648_10018048 Ga0207648_100180484 131
85 3300026116 Ga0207674_10351813 Ga0207674_103518132 131
86 3300026116 Ga0207674_10844958 Ga0207674_108449582 131
87 3300026118 Ga0207675_100082732 Ga0207675_1000827323 131
88 3300026121 Ga0207683_10000943 Ga0207683_100009437 131
89 3300026142 Ga0207698_10208859 Ga0207698_102088592 131
90 3300026142 Ga0207698_10317351 Ga0207698_103173513 131
91 3300028379 Ga0268266_10268332 Ga0268266_102683322 131
92 3300028794 Ga0307515_10000135 Ga0307515_10000135110 131
93 3300032004 Ga0307414_11037813 Ga0307414_110378131 131
94 3300032005 Ga0307411_10004604 Ga0307411_100046047 131
95 3300037312 Ga0395899_0027898 Ga0395899_0027898_274_669 131
96 3300037418 Ga0395900_0124341 Ga0395900_0124341_1969_2364 131
97 3300037466 Ga0395898_0048128 Ga0395898_0048128_176_571 131
98 3300037471 Ga0395905_0103476 Ga0395905_0103476_1961_2356 131
99 3300037471 Ga0395905_0107833 Ga0395905_0107833_1599_1994 131
100 3300038443 Ga0395901_0053613 Ga0395901_0053613_3601_3996 131
101 3300041997 Ga0439431_0180302 Ga0439431_0180302_57_452 131
102 3300044712 Ga0453684_0502073 Ga0453684_0502073_656_1051 131
103 3300049671 Ga0501238_003774 Ga0501238_003774_32_427 131
104 3300049688 Ga0501259_040619 Ga0501259_040619_395_790 131
105 3300050508 nmdc:mga09592_644132_c1 nmdc:mga09592_644132_c1_343_738 131
106 3300053088 Ga0500644_0301897 Ga0500644_0301897_272_667 131
107 3300053125 Ga0500618_007302 Ga0500618_007302_150_545 131
108 3300005295 Ga0065707_10495282 Ga0065707_104952821 132
109 3300005331 Ga0070670_100317585 Ga0070670_1003175852 132
110 3300005457 Ga0070662_100652336 Ga0070662_1006523361 132
111 3300005618 Ga0068864_101489074 Ga0068864_1014890741 132
112 3300009094 Ga0111539_10006668 Ga0111539_1000666815 132
113 3300009147 Ga0114129_11770045 Ga0114129_117700452 132
114 3300013104 Ga0157370_10992186 Ga0157370_109921862 132
115 3300013297 Ga0157378_10232048 Ga0157378_102320483 132
116 3300014745 Ga0157377_10030434 Ga0157377_100304343 132
117 3300017792 Ga0163161_10134524 Ga0163161_101345243 132
118 3300025208 Ga0209436_101646 Ga0209436_1016469 132
119 3300025284 Ga0209130_1002204 Ga0209130_10022044 132
120 3300025302 Ga0207426_1000164 Ga0207426_1000164105 132
121 3300025908 Ga0207643_10061552 Ga0207643_100615522 132
122 3300025926 Ga0207659_10170021 Ga0207659_101700212 132
123 3300025937 Ga0207669_10097857 Ga0207669_100978572 132
124 3300025938 Ga0207704_11765149 Ga0207704_117651491 132
125 3300032004 Ga0307414_10090037 Ga0307414_100900372 132
126 3300037068 Ga0373925_1394680 Ga0373925_1394680_77_475 132
127 3300044656 Ga0466969_0123802 Ga0466969_0123802_61_459 132
128 3300044684 Ga0466966_0569780 Ga0466966_0569780_45_443 132
129 3300044693 Ga0466961_0218376 Ga0466961_0218376_110_508 132
130 3300044719 Ga0466971_0104268 Ga0466971_0104268_148_546 132
131 3300045049 Ga0466959_0141999 Ga0466959_0141999_382_780 132
132 3300046471 Ga0495650_0024282 Ga0495650_0024282_1714_2112 132
133 3300046492 Ga0495585_0022128 Ga0495585_0022128_135_533 132
134 3300046506 Ga0495583_0219806 Ga0495583_0219806_15_413 132
135 3300046512 Ga0495610_0302475 Ga0495610_0302475_70_468 132
136 3300046524 Ga0495648_0009760 Ga0495648_0009760_3155_3553 132
137 3300046538 Ga0495609_0010455 Ga0495609_0010455_1383_1781 132
138 3300046557 Ga0495622_0086827 Ga0495622_0086827_254_652 132
139 3300046558 Ga0495633_0000025 Ga0495633_0000025_153076_153474 132
140 3300046616 Ga0495668_0001354 Ga0495668_0001354_19367_19765 132
141 3300046660 Ga0495625_0002493 Ga0495625_0002493_750_1148 132
142 3300046683 Ga0495658_0415601 Ga0495658_0415601_118_516 132
143 3300046809 Ga0495600_0119087 Ga0495600_0119087_819_1217 132
144 3300048089 Ga0495614_0033349 Ga0495614_0033349_315_713 132
145 3300049460 Ga0495682_0138299 Ga0495682_0138299_35_433 132
146 3300050493 nmdc:mga0k408_28930_c1 nmdc:mga0k408_28930_c1_238_636 132
147 3300053093 Ga0500651_0386523 Ga0500651_0386523_309_707 132
148 3300053109 Ga0500569_082656 Ga0500569_082656_533_931 132
149 3300053122 Ga0500608_008211 Ga0500608_008211_1300_1698 132
150 3300053123 Ga0500614_019284 Ga0500614_019284_874_1272 132
151 3300053134 Ga0500658_0142031 Ga0500658_0142031_355_753 132
152 3300053142 Ga0500577_0001002 Ga0500577_0001002_6720_7118 132
153 3300053153 Ga0500616_0039838 Ga0500616_0039838_1623_2021 132
154 3300053156 Ga0500622_0018897 Ga0500622_0018897_2569_2967 132
155 3300053160 Ga0500633_0230774 Ga0500633_0230774_273_671 132
156 3300061719 Ga0466962_0191693 Ga0466962_0191693_453_851 132
157 3300003316 rootH1_10028533 rootH1_100285333 133
158 3300003320 rootH2_10008804 rootH2_1000880423 133
159 3300003791 Ga0055530_10032904 Ga0055530_100329041 133
160 3300005338 Ga0068868_100163960 Ga0068868_1001639602 133
161 3300005366 Ga0070659_100569228 Ga0070659_1005692282 133
162 3300005367 Ga0070667_100035166 Ga0070667_1000351663 133
163 3300005530 Ga0070679_100639859 Ga0070679_1006398591 133
164 3300005539 Ga0068853_100650116 Ga0068853_1006501161 133
165 3300005563 Ga0068855_101057352 Ga0068855_1010573522 133
166 3300005577 Ga0068857_100278695 Ga0068857_1002786952 133
167 3300005614 Ga0068856_100044953 Ga0068856_1000449532 133
168 3300005616 Ga0068852_100016000 Ga0068852_1000160003 133
169 3300005616 Ga0068852_100111839 Ga0068852_1001118392 133
170 3300005616 Ga0068852_100516479 Ga0068852_1005164792 133
171 3300005618 Ga0068864_100565655 Ga0068864_1005656552 133
172 3300005718 Ga0068866_10034619 Ga0068866_100346193 133
173 3300005843 Ga0068860_100047596 Ga0068860_1000475963 133
174 3300006358 Ga0068871_100453895 Ga0068871_1004538953 133
175 3300009093 Ga0105240_10005668 Ga0105240_100056687 133
176 3300009093 Ga0105240_10033210 Ga0105240_100332109 133
177 3300009174 Ga0105241_10513190 Ga0105241_105131902 133
178 3300009174 Ga0105241_10582714 Ga0105241_105827142 133
179 3300009545 Ga0105237_10056040 Ga0105237_100560403 133
180 3300009545 Ga0105237_10151730 Ga0105237_101517303 133
181 3300009551 Ga0105238_10116790 Ga0105238_101167903 133
182 3300010375 Ga0105239_10001335 Ga0105239_100013355 133
183 3300013100 Ga0157373_10107176 Ga0157373_101071761 133
184 3300013102 Ga0157371_10636812 Ga0157371_106368122 133
185 3300013104 Ga0157370_10001863 Ga0157370_1000186312 133
186 3300013307 Ga0157372_10007327 Ga0157372_1000732715 133
187 3300025904 Ga0207647_10025336 Ga0207647_100253362 133
188 3300025911 Ga0207654_10230033 Ga0207654_102300332 133
189 3300025913 Ga0207695_10016074 Ga0207695_100160746 133
190 3300025913 Ga0207695_10172066 Ga0207695_101720663 133
191 3300025914 Ga0207671_10090319 Ga0207671_100903192 133
192 3300025914 Ga0207671_10100534 Ga0207671_101005342 133
193 3300025921 Ga0207652_10510505 Ga0207652_105105052 133
194 3300025924 Ga0207694_10095116 Ga0207694_100951165 133
195 3300025932 Ga0207690_10422801 Ga0207690_104228011 133
196 3300025949 Ga0207667_10000598 Ga0207667_1000059835 133
197 3300025949 Ga0207667_11389672 Ga0207667_113896722 133
198 3300025986 Ga0207658_10068454 Ga0207658_100684545 133
199 3300026041 Ga0207639_10742886 Ga0207639_107428861 133
200 3300026078 Ga0207702_10356748 Ga0207702_103567482 133
201 3300026095 Ga0207676_10650457 Ga0207676_106504572 133
202 3300026116 Ga0207674_10021335 Ga0207674_100213355 133
203 3300026142 Ga0207698_10050369 Ga0207698_100503692 133
204 3300026142 Ga0207698_10434618 Ga0207698_104346182 133
205 3300028381 Ga0268264_10063632 Ga0268264_100636323 133
206 3300031250 Ga0265331_10158137 Ga0265331_101581372 133
207 3300031251 Ga0265327_10000051 Ga0265327_1000005198 133
208 3300031251 Ga0265327_10015851 Ga0265327_100158513 133
209 3300031251 Ga0265327_10306413 Ga0265327_103064131 133
210 3300031456 Ga0307513_10360055 Ga0307513_103600552 133
211 3300037418 Ga0395900_0135172 Ga0395900_0135172_1426_1842 133
212 3300046460 Ga0495638_0000004 Ga0495638_0000004_188850_189251 133
213 3300053098 Ga0500650_0227740 Ga0500650_0227740_164_565 133
214 3300053131 Ga0500652_203132 Ga0500652_203132_295_696 133
215 3300053137 Ga0500561_0039042 Ga0500561_0039042_824_1225 133
216 3300053160 Ga0500633_0056242 Ga0500633_0056242_68_469 133
217 3300053161 Ga0500634_0046798 Ga0500634_0046798_969_1370 133
218 3300061719 Ga0466962_0508984 Ga0466962_0508984_179_589 133

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.5569 2 129
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.5196 2 129
7y66-assembly1.cif.gz_D cryo-em structure of bm213-bound c5ar1 in complex with gi protein 0.3129 2 131
8hqc-assembly1.cif.gz_A structure of a gpcr-g protein in complex with a natural peptide agonist 0.3121 2 133
8hqc-assembly1.cif.gz_A structure of a gpcr-g protein in complex with a natural peptide agonist 0.3085 2 133
ID Description Score Start End Superfamily
af_Q33BF9_12_488_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6948 68 129 1.20.1250.20
af_M9NEY2_1_155_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6775 2 129 1.20.140.150
af_M9NEY2_1_155_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6141 2 129 1.20.140.150
af_Q95QL5_1_155_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5946 2 133 1.20.140.150
af_Q95QL5_1_155_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5879 2 133 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2T5RV34-F1-model_v4 deleted 0.9877 43 129
AF-A0A2M8HPP4-F1-model_v4 Uncharacterized protein 0.9793 59 130 GO:0016020
AF-A0A4Q3EKJ7-F1-model_v4 Uncharacterized protein 0.9789 1 129 GO:0016020
AF-A0A0E9MXR5-F1-model_v4 Uncharacterized protein 0.9785 2 129 GO:0016020
AF-A0A519VNH4-F1-model_v4 Cytochrome B 0.9775 1 120 GO:0016020

Feature Viewer

pLDDT pTM Quality
94.47 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map