F329606
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 218 | 166 | 216 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_100075937|Ga0070668_1000759371 |
| Length | 151 |
| Sequence | VQRDKIYTIHVNLHLSTVDRMQPHLEIIGIILILLAAIHIAFPQYFNWKKELGSLRLINRQMMYVHTFFIAFTVFLMGLLCLTSAPELTLTPLGKKISLGLSLFWLTRLLFQFFGYSSLLWKGKNFETIVHITFTCLWIYFSIVFLMIFLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 111 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 123 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 124 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 125 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 128 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 145 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 147 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 149 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 150 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 151 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 152 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 153 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 154 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 155 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 156 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 157 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 158 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 159 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 160 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 161 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 162 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 163 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 164 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 165 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 166 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0 |
| Isolates | 0.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.01 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 86.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10028533 | 3300003316 | Unclassified | 2393 |
| 2 | rootH2_10008804 | 3300003320 | Bacteria | 29472 |
| 3 | Ga0055530_10032904 | 3300003791 | Bacteria | 1343 |
| 4 | Ga0065707_10495282 | 3300005295 | Unclassified | 762 |
| 5 | Ga0070658_10048307 | 3300005327 | Bacteria | 3445 |
| 6 | Ga0070670_100054117 | 3300005331 | Bacteria | 3445 |
| 7 | Ga0070670_100317585 | 3300005331 | Unclassified | 1364 |
| 8 | Ga0068869_100707680 | 3300005334 | Unclassified | 859 |
| 9 | Ga0070666_10133205 | 3300005335 | Bacteria | 1728 |
| 10 | Ga0070680_100268645 | 3300005336 | Bacteria | 1444 |
| 11 | Ga0068868_100163960 | 3300005338 | Bacteria | 1837 |
| 12 | Ga0070687_100024495 | 3300005343 | Bacteria | 2882 |
| 13 | Ga0070668_100075937 | 3300005347 | Bacteria | 2624 |
| 14 | Ga0070669_100320065 | 3300005353 | Bacteria | 1252 |
| 15 | Ga0070669_100336753 | 3300005353 | Bacteria | 1222 |
| 16 | Ga0070674_100021466 | 3300005356 | Bacteria | 4146 |
| 17 | Ga0070659_100326204 | 3300005366 | Bacteria | 1284 |
| 18 | Ga0070659_100569228 | 3300005366 | Bacteria | 971 |
| 19 | Ga0070667_100035166 | 3300005367 | Unclassified | 4196 |
| 20 | Ga0070700_100047150 | 3300005441 | Bacteria | 2666 |
| 21 | Ga0070663_100351004 | 3300005455 | Bacteria | 1194 |
| 22 | Ga0070678_100017833 | 3300005456 | Bacteria | 4582 |
| 23 | Ga0070662_100652336 | 3300005457 | Bacteria | 888 |
| 24 | Ga0070681_10127170 | 3300005458 | Bacteria | 2481 |
| 25 | Ga0068867_100007580 | 3300005459 | Bacteria | 7680 |
| 26 | Ga0070685_10328816 | 3300005466 | Bacteria | 1038 |
| 27 | Ga0070698_100001241 | 3300005471 | Bacteria | 28439 |
| 28 | Ga0070679_100065812 | 3300005530 | Bacteria | 3612 |
| 29 | Ga0070679_100639859 | 3300005530 | Bacteria | 1006 |
| 30 | Ga0070679_100724591 | 3300005530 | Bacteria | 937 |
| 31 | Ga0068853_100650116 | 3300005539 | Bacteria | 1003 |
| 32 | Ga0070665_100087096 | 3300005548 | Bacteria | 3128 |
| 33 | Ga0068855_100002670 | 3300005563 | Bacteria | 21981 |
| 34 | Ga0068855_101057352 | 3300005563 | Bacteria | 850 |
| 35 | Ga0070664_100221434 | 3300005564 | Bacteria | 1693 |
| 36 | Ga0068857_100278695 | 3300005577 | Bacteria | 1537 |
| 37 | Ga0068857_100584590 | 3300005577 | Bacteria | 1054 |
| 38 | Ga0068854_100065624 | 3300005578 | Bacteria | 2639 |
| 39 | Ga0068854_102110098 | 3300005578 | Bacteria | 520 |
| 40 | Ga0068856_100044953 | 3300005614 | Bacteria | 4347 |
| 41 | Ga0068856_100902718 | 3300005614 | Bacteria | 902 |
| 42 | Ga0068852_100016000 | 3300005616 | Bacteria | 5839 |
| 43 | Ga0068852_100111839 | 3300005616 | Bacteria | 2484 |
| 44 | Ga0068852_100170450 | 3300005616 | Bacteria | 2040 |
| 45 | Ga0068852_100516479 | 3300005616 | Bacteria | 1191 |
| 46 | Ga0068859_100276813 | 3300005617 | Bacteria | 1771 |
| 47 | Ga0068859_100456253 | 3300005617 | Bacteria | 1374 |
| 48 | Ga0068859_100596264 | 3300005617 | Bacteria | 1198 |
| 49 | Ga0068864_100565655 | 3300005618 | Bacteria | 1100 |
| 50 | Ga0068864_101489074 | 3300005618 | Bacteria | 680 |
| 51 | Ga0068866_10034619 | 3300005718 | Bacteria | 2461 |
| 52 | Ga0068861_100033187 | 3300005719 | Bacteria | 3806 |
| 53 | Ga0068851_10607096 | 3300005834 | Unclassified | 666 |
| 54 | Ga0068863_100669684 | 3300005841 | Bacteria | 1030 |
| 55 | Ga0068860_100047596 | 3300005843 | Bacteria | 4087 |
| 56 | Ga0068860_100102241 | 3300005843 | Bacteria | 2734 |
| 57 | Ga0097621_100030935 | 3300006237 | Bacteria | 4242 |
| 58 | Ga0068871_100453895 | 3300006358 | Bacteria | 1149 |
| 59 | Ga0075428_100114928 | 3300006844 | Bacteria | 2931 |
| 60 | Ga0068865_100001928 | 3300006881 | Bacteria | 12208 |
| 61 | Ga0097620_100276824 | 3300006931 | Bacteria | 1771 |
| 62 | Ga0097620_100456237 | 3300006931 | Bacteria | 1374 |
| 63 | Ga0097620_100596259 | 3300006931 | Bacteria | 1198 |
| 64 | Ga0105240_10005668 | 3300009093 | Bacteria | 18536 |
| 65 | Ga0105240_10033210 | 3300009093 | Bacteria | 6670 |
| 66 | Ga0105240_10616103 | 3300009093 | Bacteria | 1193 |
| 67 | Ga0111539_10006668 | 3300009094 | Bacteria | 14871 |
| 68 | Ga0105247_10001867 | 3300009101 | Bacteria | 14743 |
| 69 | Ga0114129_11770045 | 3300009147 | Bacteria | 752 |
| 70 | Ga0105241_10513190 | 3300009174 | Bacteria | 1071 |
| 71 | Ga0105241_10582714 | 3300009174 | Unclassified | 1008 |
| 72 | Ga0105242_10198232 | 3300009176 | Bacteria | 1782 |
| 73 | Ga0105237_10056040 | 3300009545 | Bacteria | 3947 |
| 74 | Ga0105237_10151730 | 3300009545 | Bacteria | 2314 |
| 75 | Ga0105238_10116790 | 3300009551 | Bacteria | 2648 |
| 76 | Ga0105249_10434343 | 3300009553 | Bacteria | 1349 |
| 77 | Ga0105239_10001335 | 3300010375 | Bacteria | 33242 |
| 78 | Ga0105246_10191882 | 3300011119 | Bacteria | 1582 |
| 79 | Ga0157373_10107176 | 3300013100 | Bacteria | 1964 |
| 80 | Ga0157371_10076643 | 3300013102 | Bacteria | 2368 |
| 81 | Ga0157371_10636812 | 3300013102 | Unclassified | 795 |
| 82 | Ga0157370_10001863 | 3300013104 | Bacteria | 26004 |
| 83 | Ga0157370_10992186 | 3300013104 | Bacteria | 760 |
| 84 | Ga0157374_10196937 | 3300013296 | Bacteria | 1972 |
| 85 | Ga0157378_10232048 | 3300013297 | Bacteria | 1759 |
| 86 | Ga0157372_10007327 | 3300013307 | Bacteria | 11744 |
| 87 | Ga0157372_10043231 | 3300013307 | Bacteria | 4987 |
| 88 | Ga0157372_10256041 | 3300013307 | Bacteria | 2032 |
| 89 | Ga0157372_11387683 | 3300013307 | Bacteria | 810 |
| 90 | Ga0157377_10030434 | 3300014745 | Bacteria | 2924 |
| 91 | Ga0163161_10134524 | 3300017792 | Bacteria | 1867 |
| 92 | Ga0209436_101646 | 3300025208 | Bacteria | 7453 |
| 93 | Ga0209130_1002204 | 3300025284 | Bacteria | 10237 |
| 94 | Ga0207426_1000164 | 3300025302 | Bacteria | 171465 |
| 95 | Ga0207647_10025336 | 3300025904 | Unclassified | 3899 |
| 96 | Ga0207645_10047615 | 3300025907 | Bacteria | 2738 |
| 97 | Ga0207643_10061552 | 3300025908 | Bacteria | 2144 |
| 98 | Ga0207705_10014025 | 3300025909 | Bacteria | 5775 |
| 99 | Ga0207654_10230033 | 3300025911 | Bacteria | 1234 |
| 100 | Ga0207707_10004456 | 3300025912 | Bacteria | 12335 |
| 101 | Ga0207707_11384388 | 3300025912 | Bacteria | 562 |
| 102 | Ga0207695_10016074 | 3300025913 | Bacteria | 8777 |
| 103 | Ga0207695_10172066 | 3300025913 | Bacteria | 2091 |
| 104 | Ga0207671_10045307 | 3300025914 | Bacteria | 3252 |
| 105 | Ga0207671_10090319 | 3300025914 | Bacteria | 2307 |
| 106 | Ga0207671_10100534 | 3300025914 | Bacteria | 2190 |
| 107 | Ga0207660_10014954 | 3300025917 | Bacteria | 5115 |
| 108 | Ga0207662_10192754 | 3300025918 | Bacteria | 1316 |
| 109 | Ga0207652_10014261 | 3300025921 | Bacteria | 6436 |
| 110 | Ga0207652_10510505 | 3300025921 | Bacteria | 1082 |
| 111 | Ga0207652_10593733 | 3300025921 | Bacteria | 993 |
| 112 | Ga0207681_10038724 | 3300025923 | Bacteria | 3161 |
| 113 | Ga0207694_10095116 | 3300025924 | Bacteria | 2355 |
| 114 | Ga0207659_10170021 | 3300025926 | Bacteria | 1719 |
| 115 | Ga0207690_10374083 | 3300025932 | Bacteria | 1131 |
| 116 | Ga0207690_10422801 | 3300025932 | Bacteria | 1066 |
| 117 | Ga0207706_10388923 | 3300025933 | Bacteria | 1210 |
| 118 | Ga0207686_10051638 | 3300025934 | Bacteria | 2562 |
| 119 | Ga0207669_10097857 | 3300025937 | Bacteria | 1931 |
| 120 | Ga0207704_10017837 | 3300025938 | Bacteria | 3692 |
| 121 | Ga0207704_11765149 | 3300025938 | Bacteria | 532 |
| 122 | Ga0207691_10004759 | 3300025940 | Bacteria | 13125 |
| 123 | Ga0207689_10051446 | 3300025942 | Bacteria | 3396 |
| 124 | Ga0207689_10198826 | 3300025942 | Unclassified | 1654 |
| 125 | Ga0207679_10534864 | 3300025945 | Unclassified | 1050 |
| 126 | Ga0207667_10000478 | 3300025949 | Bacteria | 53228 |
| 127 | Ga0207667_10000598 | 3300025949 | Bacteria | 46822 |
| 128 | Ga0207667_11389672 | 3300025949 | Bacteria | 676 |
| 129 | Ga0207712_10364743 | 3300025961 | Bacteria | 1204 |
| 130 | Ga0207668_10061141 | 3300025972 | Bacteria | 2647 |
| 131 | Ga0207658_10068454 | 3300025986 | Unclassified | 2679 |
| 132 | Ga0207677_11713750 | 3300026023 | Bacteria | 583 |
| 133 | Ga0207639_10742886 | 3300026041 | Bacteria | 912 |
| 134 | Ga0207678_10285163 | 3300026067 | Bacteria | 1418 |
| 135 | Ga0207708_10152715 | 3300026075 | Bacteria | 1819 |
| 136 | Ga0207702_10356748 | 3300026078 | Bacteria | 1400 |
| 137 | Ga0207702_10735185 | 3300026078 | Bacteria | 974 |
| 138 | Ga0207641_10586385 | 3300026088 | Bacteria | 1090 |
| 139 | Ga0207648_10018048 | 3300026089 | Bacteria | 6394 |
| 140 | Ga0207676_10650457 | 3300026095 | Bacteria | 1017 |
| 141 | Ga0207674_10021335 | 3300026116 | Bacteria | 6978 |
| 142 | Ga0207674_10162753 | 3300026116 | Bacteria | 2186 |
| 143 | Ga0207674_10351813 | 3300026116 | Unclassified | 1424 |
| 144 | Ga0207674_10844958 | 3300026116 | Bacteria | 883 |
| 145 | Ga0207675_100082732 | 3300026118 | Bacteria | 3011 |
| 146 | Ga0207683_10000943 | 3300026121 | Bacteria | 26669 |
| 147 | Ga0207698_10050369 | 3300026142 | Bacteria | 3176 |
| 148 | Ga0207698_10208859 | 3300026142 | Bacteria | 1755 |
| 149 | Ga0207698_10317351 | 3300026142 | Bacteria | 1458 |
| 150 | Ga0207698_10434618 | 3300026142 | Bacteria | 1263 |
| 151 | Ga0268266_10268332 | 3300028379 | Bacteria | 1583 |
| 152 | Ga0268264_10063632 | 3300028381 | Bacteria | 3102 |
| 153 | Ga0307515_10000135 | 3300028794 | Bacteria | 175323 |
| 154 | Ga0265331_10158137 | 3300031250 | Unclassified | 1028 |
| 155 | Ga0265327_10000051 | 3300031251 | Bacteria | 257963 |
| 156 | Ga0265327_10015851 | 3300031251 | Bacteria | 4832 |
| 157 | Ga0265327_10306413 | 3300031251 | Bacteria | 698 |
| 158 | Ga0307513_10360055 | 3300031456 | Bacteria | 1200 |
| 159 | Ga0307414_10090037 | 3300032004 | Bacteria | 2276 |
| 160 | Ga0307414_11037813 | 3300032004 | Bacteria | 756 |
| 161 | Ga0307411_10004604 | 3300032005 | Bacteria | 6637 |
| 162 | Ga0373925_1394680 | 3300037068 | Bacteria | 574 |
| 163 | Ga0395899_0027898 | 3300037312 | Bacteria | 4252 |
| 164 | Ga0395900_0124341 | 3300037418 | Bacteria | 2645 |
| 165 | Ga0395900_0135172 | 3300037418 | Bacteria | 2526 |
| 166 | Ga0395898_0048128 | 3300037466 | Bacteria | 4182 |
| 167 | Ga0395905_0103476 | 3300037471 | Bacteria | 2673 |
| 168 | Ga0395905_0107833 | 3300037471 | Bacteria | 2615 |
| 169 | Ga0395901_0053613 | 3300038443 | Bacteria | 4190 |
| 170 | Ga0439431_0180302 | 3300041997 | Unclassified | 610 |
| 171 | Ga0466969_0123802 | 3300044656 | Unclassified | 1202 |
| 172 | Ga0466966_0569780 | 3300044684 | Unclassified | 681 |
| 173 | Ga0466961_0218376 | 3300044693 | Unclassified | 1175 |
| 174 | Ga0453684_0502073 | 3300044712 | Bacteria | 1343 |
| 175 | Ga0466971_0104268 | 3300044719 | Unclassified | 1305 |
| 176 | Ga0466959_0141999 | 3300045049 | Bacteria | 1696 |
| 177 | Ga0495638_0000004 | 3300046460 | Bacteria | 700795 |
| 178 | Ga0495650_0024282 | 3300046471 | Bacteria | 2865 |
| 179 | Ga0495585_0022128 | 3300046492 | Bacteria | 3649 |
| 180 | Ga0495583_0219806 | 3300046506 | Bacteria | 768 |
| 181 | Ga0495610_0302475 | 3300046512 | Unclassified | 616 |
| 182 | Ga0495648_0009760 | 3300046524 | Bacteria | 7393 |
| 183 | Ga0495609_0010455 | 3300046538 | Bacteria | 4448 |
| 184 | Ga0495622_0086827 | 3300046557 | Bacteria | 1438 |
| 185 | Ga0495633_0000025 | 3300046558 | Bacteria | 218627 |
| 186 | Ga0495668_0001354 | 3300046616 | Bacteria | 24058 |
| 187 | Ga0495625_0002493 | 3300046660 | Bacteria | 19845 |
| 188 | Ga0495658_0415601 | 3300046683 | Bacteria | 858 |
| 189 | Ga0495600_0119087 | 3300046809 | Bacteria | 1717 |
| 190 | Ga0495614_0033349 | 3300048089 | Bacteria | 2215 |
| 191 | Ga0495682_0138299 | 3300049460 | Bacteria | 870 |
| 192 | Ga0501238_003774 | 3300049671 | Unclassified | 1873 |
| 193 | Ga0501259_040619 | 3300049688 | Bacteria | 913 |
| 194 | nmdc:mga0k408_28930_c1 | 3300050493 | Bacteria | 3152 |
| 195 | nmdc:mga09592_644132_c1 | 3300050508 | Bacteria | 905 |
| 196 | Ga0500644_0301897 | 3300053088 | Unclassified | 685 |
| 197 | Ga0500651_0386523 | 3300053093 | Bacteria | 788 |
| 198 | Ga0500650_0227740 | 3300053098 | Unclassified | 842 |
| 199 | Ga0500569_082656 | 3300053109 | Bacteria | 1029 |
| 200 | Ga0500608_008211 | 3300053122 | Bacteria | 4374 |
| 201 | Ga0500614_019284 | 3300053123 | Bacteria | 1562 |
| 202 | Ga0500618_007302 | 3300053125 | Bacteria | 3164 |
| 203 | Ga0500652_203132 | 3300053131 | Bacteria | 803 |
| 204 | Ga0500658_0142031 | 3300053134 | Bacteria | 1077 |
| 205 | Ga0500559_0072959 | 3300053136 | Unclassified | 1548 |
| 206 | Ga0500561_0039042 | 3300053137 | Bacteria | 1244 |
| 207 | Ga0500577_0001002 | 3300053142 | Bacteria | 7277 |
| 208 | Ga0500590_315631 | 3300053148 | Bacteria | 579 |
| 209 | Ga0500616_0039838 | 3300053153 | Bacteria | 2530 |
| 210 | Ga0500622_0018897 | 3300053156 | Bacteria | 3662 |
| 211 | Ga0500633_0056242 | 3300053160 | Unclassified | 1372 |
| 212 | Ga0500633_0230774 | 3300053160 | Bacteria | 690 |
| 213 | Ga0500634_0046798 | 3300053161 | Bacteria | 2336 |
| 214 | Ga0500636_0101600 | 3300053177 | Unclassified | 1634 |
| 215 | Ga0466962_0191693 | 3300061719 | Bacteria | 997 |
| 216 | Ga0466962_0508984 | 3300061719 | Bacteria | 610 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053136 | Ga0500559_0072959 | Ga0500559_0072959_555_956 | 128 |
| 2 | 3300053148 | Ga0500590_315631 | Ga0500590_315631_81_482 | 128 |
| 3 | 3300053177 | Ga0500636_0101600 | Ga0500636_0101600_1152_1553 | 128 |
| 4 | iso_pu_bacteria | 2818991444 | 2819589141 | 128 |
| 5 | iso_pu_bacteria | 2914759650 | 2914760495 | 128 |
| 6 | 3300005458 | Ga0070681_10127170 | Ga0070681_101271703 | 130 |
| 7 | 3300005530 | Ga0070679_100724591 | Ga0070679_1007245911 | 130 |
| 8 | 3300005577 | Ga0068857_100584590 | Ga0068857_1005845902 | 130 |
| 9 | 3300005578 | Ga0068854_102110098 | Ga0068854_1021100981 | 130 |
| 10 | 3300025912 | Ga0207707_10004456 | Ga0207707_100044563 | 130 |
| 11 | 3300025921 | Ga0207652_10593733 | Ga0207652_105937332 | 130 |
| 12 | 3300026116 | Ga0207674_10162753 | Ga0207674_101627533 | 130 |
| 13 | 3300005327 | Ga0070658_10048307 | Ga0070658_100483071 | 131 |
| 14 | 3300005331 | Ga0070670_100054117 | Ga0070670_1000541172 | 131 |
| 15 | 3300005334 | Ga0068869_100707680 | Ga0068869_1007076802 | 131 |
| 16 | 3300005335 | Ga0070666_10133205 | Ga0070666_101332053 | 131 |
| 17 | 3300005336 | Ga0070680_100268645 | Ga0070680_1002686451 | 131 |
| 18 | 3300005343 | Ga0070687_100024495 | Ga0070687_1000244955 | 131 |
| 19 | 3300005347 | Ga0070668_100075937 | Ga0070668_1000759371 | 131 |
| 20 | 3300005353 | Ga0070669_100320065 | Ga0070669_1003200652 | 131 |
| 21 | 3300005353 | Ga0070669_100336753 | Ga0070669_1003367531 | 131 |
| 22 | 3300005356 | Ga0070674_100021466 | Ga0070674_1000214662 | 131 |
| 23 | 3300005366 | Ga0070659_100326204 | Ga0070659_1003262042 | 131 |
| 24 | 3300005441 | Ga0070700_100047150 | Ga0070700_1000471503 | 131 |
| 25 | 3300005455 | Ga0070663_100351004 | Ga0070663_1003510042 | 131 |
| 26 | 3300005456 | Ga0070678_100017833 | Ga0070678_1000178335 | 131 |
| 27 | 3300005459 | Ga0068867_100007580 | Ga0068867_1000075806 | 131 |
| 28 | 3300005466 | Ga0070685_10328816 | Ga0070685_103288161 | 131 |
| 29 | 3300005471 | Ga0070698_100001241 | Ga0070698_10000124124 | 131 |
| 30 | 3300005530 | Ga0070679_100065812 | Ga0070679_1000658125 | 131 |
| 31 | 3300005548 | Ga0070665_100087096 | Ga0070665_1000870962 | 131 |
| 32 | 3300005563 | Ga0068855_100002670 | Ga0068855_10000267016 | 131 |
| 33 | 3300005564 | Ga0070664_100221434 | Ga0070664_1002214343 | 131 |
| 34 | 3300005578 | Ga0068854_100065624 | Ga0068854_1000656244 | 131 |
| 35 | 3300005614 | Ga0068856_100902718 | Ga0068856_1009027181 | 131 |
| 36 | 3300005616 | Ga0068852_100170450 | Ga0068852_1001704503 | 131 |
| 37 | 3300005617 | Ga0068859_100276813 | Ga0068859_1002768133 | 131 |
| 38 | 3300005617 | Ga0068859_100456253 | Ga0068859_1004562532 | 131 |
| 39 | 3300005617 | Ga0068859_100596264 | Ga0068859_1005962642 | 131 |
| 40 | 3300005719 | Ga0068861_100033187 | Ga0068861_1000331874 | 131 |
| 41 | 3300005834 | Ga0068851_10607096 | Ga0068851_106070961 | 131 |
| 42 | 3300005841 | Ga0068863_100669684 | Ga0068863_1006696842 | 131 |
| 43 | 3300005843 | Ga0068860_100102241 | Ga0068860_1001022412 | 131 |
| 44 | 3300006237 | Ga0097621_100030935 | Ga0097621_1000309354 | 131 |
| 45 | 3300006844 | Ga0075428_100114928 | Ga0075428_1001149285 | 131 |
| 46 | 3300006881 | Ga0068865_100001928 | Ga0068865_1000019285 | 131 |
| 47 | 3300006931 | Ga0097620_100276824 | Ga0097620_1002768243 | 131 |
| 48 | 3300006931 | Ga0097620_100456237 | Ga0097620_1004562372 | 131 |
| 49 | 3300006931 | Ga0097620_100596259 | Ga0097620_1005962592 | 131 |
| 50 | 3300009093 | Ga0105240_10616103 | Ga0105240_106161032 | 131 |
| 51 | 3300009101 | Ga0105247_10001867 | Ga0105247_1000186714 | 131 |
| 52 | 3300009176 | Ga0105242_10198232 | Ga0105242_101982322 | 131 |
| 53 | 3300009553 | Ga0105249_10434343 | Ga0105249_104343432 | 131 |
| 54 | 3300011119 | Ga0105246_10191882 | Ga0105246_101918822 | 131 |
| 55 | 3300013102 | Ga0157371_10076643 | Ga0157371_100766434 | 131 |
| 56 | 3300013296 | Ga0157374_10196937 | Ga0157374_101969373 | 131 |
| 57 | 3300013307 | Ga0157372_10043231 | Ga0157372_100432317 | 131 |
| 58 | 3300013307 | Ga0157372_10256041 | Ga0157372_102560413 | 131 |
| 59 | 3300013307 | Ga0157372_11387683 | Ga0157372_113876831 | 131 |
| 60 | 3300025907 | Ga0207645_10047615 | Ga0207645_100476155 | 131 |
| 61 | 3300025909 | Ga0207705_10014025 | Ga0207705_100140255 | 131 |
| 62 | 3300025912 | Ga0207707_11384388 | Ga0207707_113843881 | 131 |
| 63 | 3300025914 | Ga0207671_10045307 | Ga0207671_100453075 | 131 |
| 64 | 3300025917 | Ga0207660_10014954 | Ga0207660_100149545 | 131 |
| 65 | 3300025918 | Ga0207662_10192754 | Ga0207662_101927543 | 131 |
| 66 | 3300025921 | Ga0207652_10014261 | Ga0207652_100142615 | 131 |
| 67 | 3300025923 | Ga0207681_10038724 | Ga0207681_100387244 | 131 |
| 68 | 3300025932 | Ga0207690_10374083 | Ga0207690_103740831 | 131 |
| 69 | 3300025933 | Ga0207706_10388923 | Ga0207706_103889231 | 131 |
| 70 | 3300025934 | Ga0207686_10051638 | Ga0207686_100516382 | 131 |
| 71 | 3300025938 | Ga0207704_10017837 | Ga0207704_100178375 | 131 |
| 72 | 3300025940 | Ga0207691_10004759 | Ga0207691_1000475912 | 131 |
| 73 | 3300025942 | Ga0207689_10051446 | Ga0207689_100514462 | 131 |
| 74 | 3300025942 | Ga0207689_10198826 | Ga0207689_101988262 | 131 |
| 75 | 3300025945 | Ga0207679_10534864 | Ga0207679_105348642 | 131 |
| 76 | 3300025949 | Ga0207667_10000478 | Ga0207667_1000047828 | 131 |
| 77 | 3300025961 | Ga0207712_10364743 | Ga0207712_103647432 | 131 |
| 78 | 3300025972 | Ga0207668_10061141 | Ga0207668_100611415 | 131 |
| 79 | 3300026023 | Ga0207677_11713750 | Ga0207677_117137501 | 131 |
| 80 | 3300026067 | Ga0207678_10285163 | Ga0207678_102851632 | 131 |
| 81 | 3300026075 | Ga0207708_10152715 | Ga0207708_101527152 | 131 |
| 82 | 3300026078 | Ga0207702_10735185 | Ga0207702_107351851 | 131 |
| 83 | 3300026088 | Ga0207641_10586385 | Ga0207641_105863852 | 131 |
| 84 | 3300026089 | Ga0207648_10018048 | Ga0207648_100180484 | 131 |
| 85 | 3300026116 | Ga0207674_10351813 | Ga0207674_103518132 | 131 |
| 86 | 3300026116 | Ga0207674_10844958 | Ga0207674_108449582 | 131 |
| 87 | 3300026118 | Ga0207675_100082732 | Ga0207675_1000827323 | 131 |
| 88 | 3300026121 | Ga0207683_10000943 | Ga0207683_100009437 | 131 |
| 89 | 3300026142 | Ga0207698_10208859 | Ga0207698_102088592 | 131 |
| 90 | 3300026142 | Ga0207698_10317351 | Ga0207698_103173513 | 131 |
| 91 | 3300028379 | Ga0268266_10268332 | Ga0268266_102683322 | 131 |
| 92 | 3300028794 | Ga0307515_10000135 | Ga0307515_10000135110 | 131 |
| 93 | 3300032004 | Ga0307414_11037813 | Ga0307414_110378131 | 131 |
| 94 | 3300032005 | Ga0307411_10004604 | Ga0307411_100046047 | 131 |
| 95 | 3300037312 | Ga0395899_0027898 | Ga0395899_0027898_274_669 | 131 |
| 96 | 3300037418 | Ga0395900_0124341 | Ga0395900_0124341_1969_2364 | 131 |
| 97 | 3300037466 | Ga0395898_0048128 | Ga0395898_0048128_176_571 | 131 |
| 98 | 3300037471 | Ga0395905_0103476 | Ga0395905_0103476_1961_2356 | 131 |
| 99 | 3300037471 | Ga0395905_0107833 | Ga0395905_0107833_1599_1994 | 131 |
| 100 | 3300038443 | Ga0395901_0053613 | Ga0395901_0053613_3601_3996 | 131 |
| 101 | 3300041997 | Ga0439431_0180302 | Ga0439431_0180302_57_452 | 131 |
| 102 | 3300044712 | Ga0453684_0502073 | Ga0453684_0502073_656_1051 | 131 |
| 103 | 3300049671 | Ga0501238_003774 | Ga0501238_003774_32_427 | 131 |
| 104 | 3300049688 | Ga0501259_040619 | Ga0501259_040619_395_790 | 131 |
| 105 | 3300050508 | nmdc:mga09592_644132_c1 | nmdc:mga09592_644132_c1_343_738 | 131 |
| 106 | 3300053088 | Ga0500644_0301897 | Ga0500644_0301897_272_667 | 131 |
| 107 | 3300053125 | Ga0500618_007302 | Ga0500618_007302_150_545 | 131 |
| 108 | 3300005295 | Ga0065707_10495282 | Ga0065707_104952821 | 132 |
| 109 | 3300005331 | Ga0070670_100317585 | Ga0070670_1003175852 | 132 |
| 110 | 3300005457 | Ga0070662_100652336 | Ga0070662_1006523361 | 132 |
| 111 | 3300005618 | Ga0068864_101489074 | Ga0068864_1014890741 | 132 |
| 112 | 3300009094 | Ga0111539_10006668 | Ga0111539_1000666815 | 132 |
| 113 | 3300009147 | Ga0114129_11770045 | Ga0114129_117700452 | 132 |
| 114 | 3300013104 | Ga0157370_10992186 | Ga0157370_109921862 | 132 |
| 115 | 3300013297 | Ga0157378_10232048 | Ga0157378_102320483 | 132 |
| 116 | 3300014745 | Ga0157377_10030434 | Ga0157377_100304343 | 132 |
| 117 | 3300017792 | Ga0163161_10134524 | Ga0163161_101345243 | 132 |
| 118 | 3300025208 | Ga0209436_101646 | Ga0209436_1016469 | 132 |
| 119 | 3300025284 | Ga0209130_1002204 | Ga0209130_10022044 | 132 |
| 120 | 3300025302 | Ga0207426_1000164 | Ga0207426_1000164105 | 132 |
| 121 | 3300025908 | Ga0207643_10061552 | Ga0207643_100615522 | 132 |
| 122 | 3300025926 | Ga0207659_10170021 | Ga0207659_101700212 | 132 |
| 123 | 3300025937 | Ga0207669_10097857 | Ga0207669_100978572 | 132 |
| 124 | 3300025938 | Ga0207704_11765149 | Ga0207704_117651491 | 132 |
| 125 | 3300032004 | Ga0307414_10090037 | Ga0307414_100900372 | 132 |
| 126 | 3300037068 | Ga0373925_1394680 | Ga0373925_1394680_77_475 | 132 |
| 127 | 3300044656 | Ga0466969_0123802 | Ga0466969_0123802_61_459 | 132 |
| 128 | 3300044684 | Ga0466966_0569780 | Ga0466966_0569780_45_443 | 132 |
| 129 | 3300044693 | Ga0466961_0218376 | Ga0466961_0218376_110_508 | 132 |
| 130 | 3300044719 | Ga0466971_0104268 | Ga0466971_0104268_148_546 | 132 |
| 131 | 3300045049 | Ga0466959_0141999 | Ga0466959_0141999_382_780 | 132 |
| 132 | 3300046471 | Ga0495650_0024282 | Ga0495650_0024282_1714_2112 | 132 |
| 133 | 3300046492 | Ga0495585_0022128 | Ga0495585_0022128_135_533 | 132 |
| 134 | 3300046506 | Ga0495583_0219806 | Ga0495583_0219806_15_413 | 132 |
| 135 | 3300046512 | Ga0495610_0302475 | Ga0495610_0302475_70_468 | 132 |
| 136 | 3300046524 | Ga0495648_0009760 | Ga0495648_0009760_3155_3553 | 132 |
| 137 | 3300046538 | Ga0495609_0010455 | Ga0495609_0010455_1383_1781 | 132 |
| 138 | 3300046557 | Ga0495622_0086827 | Ga0495622_0086827_254_652 | 132 |
| 139 | 3300046558 | Ga0495633_0000025 | Ga0495633_0000025_153076_153474 | 132 |
| 140 | 3300046616 | Ga0495668_0001354 | Ga0495668_0001354_19367_19765 | 132 |
| 141 | 3300046660 | Ga0495625_0002493 | Ga0495625_0002493_750_1148 | 132 |
| 142 | 3300046683 | Ga0495658_0415601 | Ga0495658_0415601_118_516 | 132 |
| 143 | 3300046809 | Ga0495600_0119087 | Ga0495600_0119087_819_1217 | 132 |
| 144 | 3300048089 | Ga0495614_0033349 | Ga0495614_0033349_315_713 | 132 |
| 145 | 3300049460 | Ga0495682_0138299 | Ga0495682_0138299_35_433 | 132 |
| 146 | 3300050493 | nmdc:mga0k408_28930_c1 | nmdc:mga0k408_28930_c1_238_636 | 132 |
| 147 | 3300053093 | Ga0500651_0386523 | Ga0500651_0386523_309_707 | 132 |
| 148 | 3300053109 | Ga0500569_082656 | Ga0500569_082656_533_931 | 132 |
| 149 | 3300053122 | Ga0500608_008211 | Ga0500608_008211_1300_1698 | 132 |
| 150 | 3300053123 | Ga0500614_019284 | Ga0500614_019284_874_1272 | 132 |
| 151 | 3300053134 | Ga0500658_0142031 | Ga0500658_0142031_355_753 | 132 |
| 152 | 3300053142 | Ga0500577_0001002 | Ga0500577_0001002_6720_7118 | 132 |
| 153 | 3300053153 | Ga0500616_0039838 | Ga0500616_0039838_1623_2021 | 132 |
| 154 | 3300053156 | Ga0500622_0018897 | Ga0500622_0018897_2569_2967 | 132 |
| 155 | 3300053160 | Ga0500633_0230774 | Ga0500633_0230774_273_671 | 132 |
| 156 | 3300061719 | Ga0466962_0191693 | Ga0466962_0191693_453_851 | 132 |
| 157 | 3300003316 | rootH1_10028533 | rootH1_100285333 | 133 |
| 158 | 3300003320 | rootH2_10008804 | rootH2_1000880423 | 133 |
| 159 | 3300003791 | Ga0055530_10032904 | Ga0055530_100329041 | 133 |
| 160 | 3300005338 | Ga0068868_100163960 | Ga0068868_1001639602 | 133 |
| 161 | 3300005366 | Ga0070659_100569228 | Ga0070659_1005692282 | 133 |
| 162 | 3300005367 | Ga0070667_100035166 | Ga0070667_1000351663 | 133 |
| 163 | 3300005530 | Ga0070679_100639859 | Ga0070679_1006398591 | 133 |
| 164 | 3300005539 | Ga0068853_100650116 | Ga0068853_1006501161 | 133 |
| 165 | 3300005563 | Ga0068855_101057352 | Ga0068855_1010573522 | 133 |
| 166 | 3300005577 | Ga0068857_100278695 | Ga0068857_1002786952 | 133 |
| 167 | 3300005614 | Ga0068856_100044953 | Ga0068856_1000449532 | 133 |
| 168 | 3300005616 | Ga0068852_100016000 | Ga0068852_1000160003 | 133 |
| 169 | 3300005616 | Ga0068852_100111839 | Ga0068852_1001118392 | 133 |
| 170 | 3300005616 | Ga0068852_100516479 | Ga0068852_1005164792 | 133 |
| 171 | 3300005618 | Ga0068864_100565655 | Ga0068864_1005656552 | 133 |
| 172 | 3300005718 | Ga0068866_10034619 | Ga0068866_100346193 | 133 |
| 173 | 3300005843 | Ga0068860_100047596 | Ga0068860_1000475963 | 133 |
| 174 | 3300006358 | Ga0068871_100453895 | Ga0068871_1004538953 | 133 |
| 175 | 3300009093 | Ga0105240_10005668 | Ga0105240_100056687 | 133 |
| 176 | 3300009093 | Ga0105240_10033210 | Ga0105240_100332109 | 133 |
| 177 | 3300009174 | Ga0105241_10513190 | Ga0105241_105131902 | 133 |
| 178 | 3300009174 | Ga0105241_10582714 | Ga0105241_105827142 | 133 |
| 179 | 3300009545 | Ga0105237_10056040 | Ga0105237_100560403 | 133 |
| 180 | 3300009545 | Ga0105237_10151730 | Ga0105237_101517303 | 133 |
| 181 | 3300009551 | Ga0105238_10116790 | Ga0105238_101167903 | 133 |
| 182 | 3300010375 | Ga0105239_10001335 | Ga0105239_100013355 | 133 |
| 183 | 3300013100 | Ga0157373_10107176 | Ga0157373_101071761 | 133 |
| 184 | 3300013102 | Ga0157371_10636812 | Ga0157371_106368122 | 133 |
| 185 | 3300013104 | Ga0157370_10001863 | Ga0157370_1000186312 | 133 |
| 186 | 3300013307 | Ga0157372_10007327 | Ga0157372_1000732715 | 133 |
| 187 | 3300025904 | Ga0207647_10025336 | Ga0207647_100253362 | 133 |
| 188 | 3300025911 | Ga0207654_10230033 | Ga0207654_102300332 | 133 |
| 189 | 3300025913 | Ga0207695_10016074 | Ga0207695_100160746 | 133 |
| 190 | 3300025913 | Ga0207695_10172066 | Ga0207695_101720663 | 133 |
| 191 | 3300025914 | Ga0207671_10090319 | Ga0207671_100903192 | 133 |
| 192 | 3300025914 | Ga0207671_10100534 | Ga0207671_101005342 | 133 |
| 193 | 3300025921 | Ga0207652_10510505 | Ga0207652_105105052 | 133 |
| 194 | 3300025924 | Ga0207694_10095116 | Ga0207694_100951165 | 133 |
| 195 | 3300025932 | Ga0207690_10422801 | Ga0207690_104228011 | 133 |
| 196 | 3300025949 | Ga0207667_10000598 | Ga0207667_1000059835 | 133 |
| 197 | 3300025949 | Ga0207667_11389672 | Ga0207667_113896722 | 133 |
| 198 | 3300025986 | Ga0207658_10068454 | Ga0207658_100684545 | 133 |
| 199 | 3300026041 | Ga0207639_10742886 | Ga0207639_107428861 | 133 |
| 200 | 3300026078 | Ga0207702_10356748 | Ga0207702_103567482 | 133 |
| 201 | 3300026095 | Ga0207676_10650457 | Ga0207676_106504572 | 133 |
| 202 | 3300026116 | Ga0207674_10021335 | Ga0207674_100213355 | 133 |
| 203 | 3300026142 | Ga0207698_10050369 | Ga0207698_100503692 | 133 |
| 204 | 3300026142 | Ga0207698_10434618 | Ga0207698_104346182 | 133 |
| 205 | 3300028381 | Ga0268264_10063632 | Ga0268264_100636323 | 133 |
| 206 | 3300031250 | Ga0265331_10158137 | Ga0265331_101581372 | 133 |
| 207 | 3300031251 | Ga0265327_10000051 | Ga0265327_1000005198 | 133 |
| 208 | 3300031251 | Ga0265327_10015851 | Ga0265327_100158513 | 133 |
| 209 | 3300031251 | Ga0265327_10306413 | Ga0265327_103064131 | 133 |
| 210 | 3300031456 | Ga0307513_10360055 | Ga0307513_103600552 | 133 |
| 211 | 3300037418 | Ga0395900_0135172 | Ga0395900_0135172_1426_1842 | 133 |
| 212 | 3300046460 | Ga0495638_0000004 | Ga0495638_0000004_188850_189251 | 133 |
| 213 | 3300053098 | Ga0500650_0227740 | Ga0500650_0227740_164_565 | 133 |
| 214 | 3300053131 | Ga0500652_203132 | Ga0500652_203132_295_696 | 133 |
| 215 | 3300053137 | Ga0500561_0039042 | Ga0500561_0039042_824_1225 | 133 |
| 216 | 3300053160 | Ga0500633_0056242 | Ga0500633_0056242_68_469 | 133 |
| 217 | 3300053161 | Ga0500634_0046798 | Ga0500634_0046798_969_1370 | 133 |
| 218 | 3300061719 | Ga0466962_0508984 | Ga0466962_0508984_179_589 | 133 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a3k-assembly1.cif.gz_UNK | x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 | 0.5569 | 2 | 129 |
| 8a3k-assembly1.cif.gz_UNK | x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 | 0.5196 | 2 | 129 |
| 7y66-assembly1.cif.gz_D | cryo-em structure of bm213-bound c5ar1 in complex with gi protein | 0.3129 | 2 | 131 |
| 8hqc-assembly1.cif.gz_A | structure of a gpcr-g protein in complex with a natural peptide agonist | 0.3121 | 2 | 133 |
| 8hqc-assembly1.cif.gz_A | structure of a gpcr-g protein in complex with a natural peptide agonist | 0.3085 | 2 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q33BF9_12_488_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6948 | 68 | 129 | 1.20.1250.20 |
| af_M9NEY2_1_155_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6775 | 2 | 129 | 1.20.140.150 |
| af_M9NEY2_1_155_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6141 | 2 | 129 | 1.20.140.150 |
| af_Q95QL5_1_155_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5946 | 2 | 133 | 1.20.140.150 |
| af_Q95QL5_1_155_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5879 | 2 | 133 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T5RV34-F1-model_v4 | deleted | 0.9877 | 43 | 129 |
|
| AF-A0A2M8HPP4-F1-model_v4 | Uncharacterized protein | 0.9793 | 59 | 130 |
GO:0016020
|
| AF-A0A4Q3EKJ7-F1-model_v4 | Uncharacterized protein | 0.9789 | 1 | 129 |
GO:0016020
|
| AF-A0A0E9MXR5-F1-model_v4 | Uncharacterized protein | 0.9785 | 2 | 129 |
GO:0016020
|
| AF-A0A519VNH4-F1-model_v4 | Cytochrome B | 0.9775 | 1 | 120 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar