F328627

General Info

Members Datasets Scaffolds Average Seq Length
217 137 434 188

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10075572|Ga0075362_100755722
Length 214
Sequence MAEGKKEKQGKASSDDGGIAVADRPGRGADFANYMPAYKTKYREEILPAMTKKFGYKNPNEVPRLVKIVVNMGVGEAARDAKLIEVAEKELSVIAGQKPKRTLAKKSISAFKLREGLPVGCFVTLRGNRMYEFLERLINVSIPRIRDFRGFPTRSFDGRGNHSLGIREHLIFMELDFNKVTAVKGMNITTVTTAKTDEEALELLRLFGFPFREK

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
137 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.31
Metatranscriptomes 3.23
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 0
Rhizoplane 0
Rhizosphere 80.18
Stem 0
Stem Tuber 0
Unclassified 10.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10075572 3300006177 Bacteria 1545
2 Ga0006770J48903_1049079 3300003305 Bacteria 1937
3 rootH1_10294972 3300003323 Bacteria 2289
4 JGI25405J52794_10002603 3300003911 Bacteria 3121
5 Ga0058860_12235955 3300004801 Bacteria 17046
6 Ga0065714_10066951 3300005288 Bacteria 6061
7 Ga0065704_10223520 3300005289 Bacteria 1066
8 Ga0065704_10405049 3300005289 Unclassified 747
9 Ga0065707_10006155 3300005295 Bacteria 2996
10 Ga0070692_10313351 3300005345 Bacteria 962
11 Ga0070669_100067957 3300005353 Unclassified 2630
12 Ga0070671_100254364 3300005355 Bacteria 1492
13 Ga0070709_10169400 3300005434 Bacteria 1525
14 Ga0070694_100018421 3300005444 Bacteria 4431
15 Ga0068867_100130571 3300005459 Bacteria 1952
16 Ga0070706_100002525 3300005467 Bacteria 18405
17 Ga0070706_100048145 3300005467 Unclassified 3935
18 Ga0070706_100060377 3300005467 Bacteria 3500
19 Ga0070706_100374460 3300005467 Bacteria 1326
20 Ga0070707_100275673 3300005468 Bacteria 1635
21 Ga0070698_100004976 3300005471 Bacteria 14561
22 Ga0070698_100038613 3300005471 Bacteria 4919
23 Ga0070699_100462216 3300005518 Bacteria 1151
24 Ga0070697_100073385 3300005536 Bacteria 2809
25 Ga0070686_100043371 3300005544 Bacteria 2822
26 Ga0070686_100323586 3300005544 Bacteria 1150
27 Ga0070686_101107208 3300005544 Unclassified 654
28 Ga0068859_100467477 3300005617 Bacteria 1357
29 Ga0068861_100012082 3300005719 Bacteria 6018
30 Ga0068861_100454137 3300005719 Bacteria 1149
31 Ga0081455_10000608 3300005937 Bacteria 46340
32 Ga0081455_10076109 3300005937 Bacteria 2765
33 Ga0081538_10001299 3300005981 Bacteria 25836
34 Ga0081540_1002521 3300005983 Bacteria 14871
35 Ga0081539_10013385 3300005985 Bacteria 6185
36 Ga0075363_100295147 3300006048 Bacteria 940
37 Ga0075364_10000412 3300006051 Bacteria 21394
38 Ga0075364_10311961 3300006051 Bacteria 1071
39 Ga0070715_10081280 3300006163 Bacteria 1471
40 Ga0070712_100478279 3300006175 Unclassified 1041
41 Ga0075362_10000037 3300006177 Bacteria 48807
42 Ga0075362_10004435 3300006177 Bacteria 5044
43 Ga0075362_10022849 3300006177 Bacteria 2639
44 Ga0075367_10025329 3300006178 Bacteria 3355
45 Ga0075367_10100875 3300006178 Bacteria 1765
46 Ga0075367_10138794 3300006178 Bacteria 1505
47 Ga0075427_10004776 3300006194 Bacteria 1911
48 Ga0075366_10001400 3300006195 Bacteria 12079
49 Ga0075366_10069683 3300006195 Bacteria 2093
50 Ga0075366_10098136 3300006195 Bacteria 1757
51 Ga0075370_10036024 3300006353 Bacteria 2778
52 Ga0075428_100002976 3300006844 Bacteria 18459
53 Ga0075428_100090740 3300006844 Bacteria 3333
54 Ga0075428_100515440 3300006844 Bacteria 1279
55 Ga0075430_100002410 3300006846 Bacteria 15562
56 Ga0075430_100096708 3300006846 Bacteria 2468
57 Ga0075431_100003027 3300006847 Bacteria 16266
58 Ga0075431_100646407 3300006847 Bacteria 1038
59 Ga0075433_10065602 3300006852 Bacteria 3184
60 Ga0075434_100594627 3300006871 Unclassified 1125
61 Ga0075429_100008584 3300006880 Bacteria 8889
62 Ga0075429_100053109 3300006880 Bacteria 3526
63 Ga0075429_100389297 3300006880 Bacteria 1221
64 Ga0097620_100467490 3300006931 Bacteria 1357
65 Ga0105244_10009211 3300009036 Bacteria 6094
66 Ga0105250_10063409 3300009092 Bacteria 1487
67 Ga0105240_10484283 3300009093 Bacteria 1378
68 Ga0111539_10012786 3300009094 Bacteria 10503
69 Ga0111539_10713001 3300009094 Bacteria 1168
70 Ga0114129_10002852 3300009147 Bacteria 24170
71 Ga0114129_10177970 3300009147 Bacteria 2896
72 Ga0114129_10328104 3300009147 Unclassified 2033
73 Ga0114129_10380811 3300009147 Bacteria 1863
74 Ga0114129_10810125 3300009147 Unclassified 1194
75 Ga0105242_10080321 3300009176 Bacteria 2725
76 Ga0105237_11612763 3300009545 Bacteria 656
77 Ga0105249_10008730 3300009553 Bacteria 8840
78 Ga0105249_10643212 3300009553 Unclassified 1118
79 Ga0099796_10070734 3300010159 Unclassified 1259
80 Ga0163162_10074171 3300013306 Unclassified 3460
81 Ga0157375_11948531 3300013308 Unclassified 698
82 Ga0157380_10833684 3300014326 Bacteria 942
83 Ga0157379_10033490 3300014968 Bacteria 4582
84 Ga0213873_10008032 3300021358 Bacteria 2139
85 Ga0213872_10033668 3300021361 Bacteria 2348
86 Ga0213872_10096222 3300021361 Bacteria 1322
87 Ga0213872_10163914 3300021361 Bacteria 966
88 Ga0213872_10171582 3300021361 Bacteria 940
89 Ga0213876_10000361 3300021384 Bacteria 38897
90 Ga0213871_10029353 3300021441 Bacteria 1425
91 Ga0213871_10070555 3300021441 Bacteria 986
92 Ga0207692_10197628 3300025898 Bacteria 1180
93 Ga0207684_10000420 3300025910 Bacteria 56576
94 Ga0207695_10758627 3300025913 Bacteria 850
95 Ga0207693_10417623 3300025915 Unclassified 1049
96 Ga0207646_10441079 3300025922 Bacteria 1175
97 Ga0207686_10115917 3300025934 Bacteria 1815
98 Ga0207712_10332480 3300025961 Bacteria 1257
99 Ga0207668_10697571 3300025972 Unclassified 892
100 Ga0207639_11350587 3300026041 Bacteria 669
101 Ga0207648_10144328 3300026089 Bacteria 2099
102 Ga0207675_100002645 3300026118 Bacteria 17685
103 Ga0207675_100490612 3300026118 Bacteria 1222
104 Ga0207675_101053608 3300026118 Bacteria 832
105 Ga0207428_10242550 3300027907 Bacteria 1346
106 Ga0265337_1006282 3300028556 Bacteria 4606
107 Ga0265319_1000335 3300028563 Bacteria 34634
108 Ga0265319_1019758 3300028563 Bacteria 2509
109 Ga0265334_10023100 3300028573 Bacteria 2531
110 Ga0265334_10030709 3300028573 Bacteria 2150
111 Ga0265318_10001647 3300028577 Bacteria 12876
112 Ga0265322_10021838 3300028654 Unclassified 1833
113 Ga0265336_10019312 3300028666 Bacteria 2200
114 Ga0265336_10022219 3300028666 Unclassified 2021
115 Ga0265338_10013017 3300028800 Bacteria 9435
116 Ga0265338_10020435 3300028800 Bacteria 6964
117 Ga0265320_10102144 3300031240 Bacteria 1319
118 Ga0265320_10202131 3300031240 Bacteria 887
119 Ga0265314_10078795 3300031711 Bacteria 2180
120 Ga0316576_10020212 3300031727 Bacteria 4577
121 Ga0316576_10099669 3300031727 Bacteria 2170
122 Ga0316576_10296953 3300031727 Bacteria 1208
123 Ga0316576_10470020 3300031727 Bacteria 927
124 Ga0316577_10152787 3300031733 Bacteria 1301
125 Ga0316593_10000071 3300032168 Bacteria 12266
126 Ga0316593_10009458 3300032168 Bacteria 2753
127 Ga0316593_10073809 3300032168 Unclassified 1182
128 Ga0316593_10149711 3300032168 Bacteria 848
129 Ga0373930_0137543 3300034816 Bacteria 605
130 Ga0316574_0000634 3300035398 Bacteria 14719
131 Ga0316574_0001182 3300035398 Bacteria 12095
132 Ga0373931_0014782 3300035691 Bacteria 3821
133 Ga0316582_0060937 3300036647 Bacteria 2420
134 Ga0316584_0218887 3300036712 Bacteria 1400
135 Ga0316584_0397590 3300036712 Bacteria 982
136 Ga0373925_0017511 3300037068 Bacteria 5195
137 Ga0373925_0218926 3300037068 Bacteria 1519
138 Ga0436365_1383407 3300039437 Bacteria 77328
139 Ga0436360_0111982 3300039438 Bacteria 10219
140 Ga0436360_0277075 3300039438 Bacteria 2144
141 Ga0436360_0668031 3300039438 Bacteria 1260
142 Ga0436361_0042883 3300039447 Bacteria 3340
143 Ga0436361_0088096 3300039447 Bacteria 12647
144 Ga0436361_0355425 3300039447 Bacteria 4700
145 Ga0436361_0363848 3300039447 Bacteria 21994
146 Ga0436361_0717160 3300039447 Bacteria 2107
147 Ga0436363_0444084 3300039450 Unclassified 1279
148 Ga0436363_0484836 3300039450 Bacteria 14282
149 Ga0436362_0704226 3300039453 Bacteria 1318
150 Ga0436362_0971524 3300039453 Bacteria 7471
151 Ga0453683_0014786 3300044673 Bacteria 5065
152 Ga0453683_0016427 3300044673 Bacteria 4774
153 Ga0453683_0425477 3300044673 Bacteria 857
154 Ga0453684_0001588 3300044712 Bacteria 62596
155 Ga0453684_0016252 3300044712 Bacteria 11656
156 Ga0453684_0234073 3300044712 Bacteria 2118
157 Ga0451576_0030114 3300045051 Bacteria 5804
158 Ga0451576_0032358 3300045051 Bacteria 5570
159 Ga0451576_0097653 3300045051 Bacteria 3055
160 Ga0451576_0779169 3300045051 Bacteria 1004
161 Ga0495580_0000918 3300046472 Bacteria 25709
162 Ga0495582_0000743 3300046473 Bacteria 18023
163 Ga0495594_0000167 3300046499 Bacteria 31361
164 Ga0495666_0114218 3300046526 Bacteria 1267
165 Ga0495622_0044065 3300046557 Bacteria 2074
166 Ga0495658_0242911 3300046683 Bacteria 1131
167 Ga0496116_0008945 3300048919 Bacteria 8614
168 Ga0496117_0029303 3300048920 Bacteria 4247
169 Ga0496121_0081711 3300048924 Bacteria 2557
170 Ga0496126_0034324 3300048929 Unclassified 4765
171 Ga0496126_0333041 3300048929 Bacteria 1245
172 Ga0501034_0237684 3300049571 Bacteria 1769
173 Ga0501036_0221021 3300049572 Bacteria 1591
174 Ga0501040_0596858 3300049576 Bacteria 798
175 Ga0501072_0134905 3300049588 Bacteria 1968
176 Ga0501072_0140535 3300049588 Bacteria 1925
177 Ga0501075_0498709 3300049591 Bacteria 929
178 Ga0501076_0375707 3300049592 Bacteria 1168
179 Ga0501079_0183286 3300049741 Bacteria 1634
180 Ga0501080_0243291 3300049742 Bacteria 1642
181 Ga0501045_0689808 3300049824 Bacteria 754
182 nmdc:mga03683_244179_c1 3300050489 Unclassified 833
183 nmdc:mga03683_281_c1 3300050489 Bacteria 15224
184 nmdc:mga03683_29_c1 3300050489 Bacteria 74308
185 nmdc:mga03683_35553_c1 3300050489 Bacteria 1480
186 nmdc:mga03n38_400288_c1 3300050490 Bacteria 756
187 nmdc:mga00v17_531_c1 3300050491 Bacteria 21403
188 nmdc:mga00v17_65260_c1 3300050491 Bacteria 2245
189 nmdc:mga0k408_23945_c1 3300050493 Bacteria 3448
190 nmdc:mga0k408_60779_c1 3300050493 Bacteria 2196
191 nmdc:mga06z11_20297_c1 3300050494 Bacteria 3069
192 nmdc:mga06z11_293028_c1 3300050494 Unclassified 966
193 nmdc:mga07m45_35497_c1 3300050496 Bacteria 2773
194 nmdc:mga05p37_30263_c1 3300050507 Bacteria 6605
195 nmdc:mga05p37_43119_c2 3300050507 Bacteria 3382
196 nmdc:mga05p37_5571_c1 3300050507 Bacteria 14805
197 nmdc:mga05p37_584156_c1 3300050507 Bacteria 1264
198 nmdc:mga05p37_837345_c1 3300050507 Bacteria 1001
199 nmdc:mga05p37_9081_c1 3300050507 Bacteria 11748
200 nmdc:mga09592_325926_c1 3300050508 Bacteria 1330
201 nmdc:mga09592_7449_c1 3300050508 Bacteria 8894
202 nmdc:mga0qj67_100642_c1 3300050509 Bacteria 2330
203 nmdc:mga0qj67_17912_c1 3300050509 Bacteria 5392
204 nmdc:mga06r32_434347_c1 3300050510 Bacteria 1294
205 nmdc:mga06r32_600_c2 3300050510 Bacteria 13291
206 nmdc:mga08y16_73581_c1 3300050511 Bacteria 3561
207 nmdc:mga0n895_308699_c1 3300050512 Unclassified 1603
208 nmdc:mga0a205_34611_c1 3300050515 Bacteria 4846
209 Ga0500555_000055 3300053103 Bacteria 58298
210 Ga0500556_0000420 3300053104 Bacteria 30531
211 Ga0500595_000008 3300053119 Bacteria 284388
212 Ga0500642_0050103 3300053130 Bacteria 1839
213 Ga0500658_0050632 3300053134 Bacteria 1696
214 Ga0587079_018331 3300059647 Bacteria 1226
215 Ga0501082_0137141 3300060353 Bacteria 2123
216 Ga0530510_0159029 3300061734 Bacteria 1671
217 2919501554 2919497567 Bacteria 4408621
218 Ga0075362_10075572
219 Ga0006770J48903_1049079
220 rootH1_10294972
221 JGI25405J52794_10002603
222 Ga0058860_12235955
223 Ga0065714_10066951
224 Ga0065704_10223520
225 Ga0065704_10405049
226 Ga0065707_10006155
227 Ga0070692_10313351
228 Ga0070669_100067957
229 Ga0070671_100254364
230 Ga0070709_10169400
231 Ga0070694_100018421
232 Ga0068867_100130571
233 Ga0070706_100002525
234 Ga0070706_100048145
235 Ga0070706_100060377
236 Ga0070706_100374460
237 Ga0070707_100275673
238 Ga0070698_100004976
239 Ga0070698_100038613
240 Ga0070699_100462216
241 Ga0070697_100073385
242 Ga0070686_100043371
243 Ga0070686_100323586
244 Ga0070686_101107208
245 Ga0068859_100467477
246 Ga0068861_100012082
247 Ga0068861_100454137
248 Ga0081455_10000608
249 Ga0081455_10076109
250 Ga0081538_10001299
251 Ga0081540_1002521
252 Ga0081539_10013385
253 Ga0075363_100295147
254 Ga0075364_10000412
255 Ga0075364_10311961
256 Ga0070715_10081280
257 Ga0070712_100478279
258 Ga0075362_10000037
259 Ga0075362_10004435
260 Ga0075362_10022849
261 Ga0075367_10025329
262 Ga0075367_10100875
263 Ga0075367_10138794
264 Ga0075427_10004776
265 Ga0075366_10001400
266 Ga0075366_10069683
267 Ga0075366_10098136
268 Ga0075370_10036024
269 Ga0075428_100002976
270 Ga0075428_100090740
271 Ga0075428_100515440
272 Ga0075430_100002410
273 Ga0075430_100096708
274 Ga0075431_100003027
275 Ga0075431_100646407
276 Ga0075433_10065602
277 Ga0075434_100594627
278 Ga0075429_100008584
279 Ga0075429_100053109
280 Ga0075429_100389297
281 Ga0097620_100467490
282 Ga0105244_10009211
283 Ga0105250_10063409
284 Ga0105240_10484283
285 Ga0111539_10012786
286 Ga0111539_10713001
287 Ga0114129_10002852
288 Ga0114129_10177970
289 Ga0114129_10328104
290 Ga0114129_10380811
291 Ga0114129_10810125
292 Ga0105242_10080321
293 Ga0105237_11612763
294 Ga0105249_10008730
295 Ga0105249_10643212
296 Ga0099796_10070734
297 Ga0163162_10074171
298 Ga0157375_11948531
299 Ga0157380_10833684
300 Ga0157379_10033490
301 Ga0213873_10008032
302 Ga0213872_10033668
303 Ga0213872_10096222
304 Ga0213872_10163914
305 Ga0213872_10171582
306 Ga0213876_10000361
307 Ga0213871_10029353
308 Ga0213871_10070555
309 Ga0207692_10197628
310 Ga0207684_10000420
311 Ga0207695_10758627
312 Ga0207693_10417623
313 Ga0207646_10441079
314 Ga0207686_10115917
315 Ga0207712_10332480
316 Ga0207668_10697571
317 Ga0207639_11350587
318 Ga0207648_10144328
319 Ga0207675_100002645
320 Ga0207675_100490612
321 Ga0207675_101053608
322 Ga0207428_10242550
323 Ga0265337_1006282
324 Ga0265319_1000335
325 Ga0265319_1019758
326 Ga0265334_10023100
327 Ga0265334_10030709
328 Ga0265318_10001647
329 Ga0265322_10021838
330 Ga0265336_10019312
331 Ga0265336_10022219
332 Ga0265338_10013017
333 Ga0265338_10020435
334 Ga0265320_10102144
335 Ga0265320_10202131
336 Ga0265314_10078795
337 Ga0316576_10020212
338 Ga0316576_10099669
339 Ga0316576_10296953
340 Ga0316576_10470020
341 Ga0316577_10152787
342 Ga0316593_10000071
343 Ga0316593_10009458
344 Ga0316593_10073809
345 Ga0316593_10149711
346 Ga0373930_0137543
347 Ga0316574_0000634
348 Ga0316574_0001182
349 Ga0373931_0014782
350 Ga0316582_0060937
351 Ga0316584_0218887
352 Ga0316584_0397590
353 Ga0373925_0017511
354 Ga0373925_0218926
355 Ga0436365_1383407
356 Ga0436360_0111982
357 Ga0436360_0277075
358 Ga0436360_0668031
359 Ga0436361_0042883
360 Ga0436361_0088096
361 Ga0436361_0355425
362 Ga0436361_0363848
363 Ga0436361_0717160
364 Ga0436363_0444084
365 Ga0436363_0484836
366 Ga0436362_0704226
367 Ga0436362_0971524
368 Ga0453683_0014786
369 Ga0453683_0016427
370 Ga0453683_0425477
371 Ga0453684_0001588
372 Ga0453684_0016252
373 Ga0453684_0234073
374 Ga0451576_0030114
375 Ga0451576_0032358
376 Ga0451576_0097653
377 Ga0451576_0779169
378 Ga0495580_0000918
379 Ga0495582_0000743
380 Ga0495594_0000167
381 Ga0495666_0114218
382 Ga0495622_0044065
383 Ga0495658_0242911
384 Ga0496116_0008945
385 Ga0496117_0029303
386 Ga0496121_0081711
387 Ga0496126_0034324
388 Ga0496126_0333041
389 Ga0501034_0237684
390 Ga0501036_0221021
391 Ga0501040_0596858
392 Ga0501072_0134905
393 Ga0501072_0140535
394 Ga0501075_0498709
395 Ga0501076_0375707
396 Ga0501079_0183286
397 Ga0501080_0243291
398 Ga0501045_0689808
399 nmdc:mga03683_244179_c1
400 nmdc:mga03683_281_c1
401 nmdc:mga03683_29_c1
402 nmdc:mga03683_35553_c1
403 nmdc:mga03n38_400288_c1
404 nmdc:mga00v17_531_c1
405 nmdc:mga00v17_65260_c1
406 nmdc:mga0k408_23945_c1
407 nmdc:mga0k408_60779_c1
408 nmdc:mga06z11_20297_c1
409 nmdc:mga06z11_293028_c1
410 nmdc:mga07m45_35497_c1
411 nmdc:mga05p37_30263_c1
412 nmdc:mga05p37_43119_c2
413 nmdc:mga05p37_5571_c1
414 nmdc:mga05p37_584156_c1
415 nmdc:mga05p37_837345_c1
416 nmdc:mga05p37_9081_c1
417 nmdc:mga09592_325926_c1
418 nmdc:mga09592_7449_c1
419 nmdc:mga0qj67_100642_c1
420 nmdc:mga0qj67_17912_c1
421 nmdc:mga06r32_434347_c1
422 nmdc:mga06r32_600_c2
423 nmdc:mga08y16_73581_c1
424 nmdc:mga0n895_308699_c1
425 nmdc:mga0a205_34611_c1
426 Ga0500555_000055
427 Ga0500556_0000420
428 Ga0500595_000008
429 Ga0500642_0050103
430 Ga0500658_0050632
431 Ga0587079_018331
432 Ga0501082_0137141
433 Ga0530510_0159029
434 2919501554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

58

114

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

118

211

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mmm-assembly1.cif.gz_F structure of the 70s chloroplast ribosome 0.9741 4 151
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9728 4 153
7azo-assembly1.cif.gz_L5A 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 0.9722 3 153
6ore-assembly1.cif.gz_E release complex 70s 0.9708 4 151
8a63-assembly1.cif.gz_J cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9691 3 150
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9715 4 151 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9391 3 153 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9308 3 151 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9163 4 151 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8947 4 151 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A656K911-F1-model_v4 deleted 0.9925 34 154
AF-A0A554FZ23-F1-model_v4 Large ribosomal subunit protein uL5 0.9911 3 153 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2V9MCD7-F1-model_v4 Large ribosomal subunit protein uL5 0.9903 3 153 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2H0P0R1-F1-model_v4 Large ribosomal subunit protein uL5 0.9902 3 153 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7W1M1M4-F1-model_v4 Large ribosomal subunit protein uL5 0.9902 3 152 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map