F327983

General Info

Members Datasets Scaffolds Average Seq Length
216 146 211 272

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0065456|Ga0495672_0065456_997_1923
Length 308
Sequence LTVRSGLFAALGASLLLAVACGQKPDAAKVAEAADPASQSGTALEKAVAGKWRMDAEKARDPYRHPAETLAFFGIKPSDTVVEIYPGGGWYTAILGPYLKTGGGKLYAAHPDPASSPGAKANVDAYTAAFVKHPETYGTIEVTIASRESPGMAPDGTADAVLTFRNIHNWMAGGYAEKIFADAYKALKPGGVLGIEEHRLPSARDQDLTASTGYVQQSYVIQLGERAGFKFEESSEINANRLDTADHPLGVWMLPPNMRAPAAGSPEAAGYDPEKYKAIGESDRMTLRFRKPAAPAAAPQPAAQAPAQ

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2643221656 Pelomonas sp. Root405 Isolate Unclassified
5 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
80 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
88 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
127 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
128 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
129 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
130 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
131 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
132 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
135 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0.93
Rhizoplane 0.46
Rhizosphere 88.89
Stem 0
Stem Tuber 0.46
Unclassified 6.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10005435 3300003316 Bacteria 25490
2 rootL2_10030875 3300003322 Bacteria 8710
3 Ga0055524_1000218 3300003775 Bacteria 60665
4 Ga0065165_1018923 3300005262 Bacteria 2476
5 Ga0065715_10169398 3300005293 Bacteria 1559
6 Ga0068869_100129961 3300005334 Bacteria 1935
7 Ga0070682_100021594 3300005337 Bacteria 3802
8 Ga0070687_100142568 3300005343 Bacteria 1397
9 Ga0070668_100000240 3300005347 Bacteria 36015
10 Ga0070671_100000232 3300005355 Bacteria 37343
11 Ga0070714_100440802 3300005435 Bacteria 1236
12 Ga0070694_100149877 3300005444 Bacteria 1702
13 Ga0070694_100393873 3300005444 Bacteria 1083
14 Ga0070708_100060826 3300005445 Bacteria 3372
15 Ga0070681_10066529 3300005458 Bacteria 3572
16 Ga0070685_10083392 3300005466 Bacteria 1920
17 Ga0070706_100096802 3300005467 Bacteria 2740
18 Ga0070707_100134567 3300005468 Bacteria 2404
19 Ga0070679_100047964 3300005530 Bacteria 4256
20 Ga0070679_100527719 3300005530 Bacteria 1124
21 Ga0070686_100221113 3300005544 Bacteria 1369
22 Ga0070696_100288772 3300005546 Bacteria 1252
23 Ga0068855_100053428 3300005563 Bacteria 4753
24 Ga0068856_100025823 3300005614 Bacteria 5728
25 Ga0068861_100086397 3300005719 Unclassified 2466
26 Ga0068863_100000001 3300005841 Bacteria 581116
27 Ga0068863_100158294 3300005841 Bacteria 2169
28 Ga0068858_100140621 3300005842 Bacteria 2266
29 Ga0068858_100383900 3300005842 Unclassified 1348
30 Ga0068862_100047662 3300005844 Bacteria 3658
31 Ga0068862_100080765 3300005844 Bacteria 2820
32 Ga0068862_100158961 3300005844 Bacteria 2016
33 Ga0068862_100253690 3300005844 Bacteria 1604
34 Ga0075430_100033363 3300006846 Bacteria 4369
35 Ga0099826_10000051 3300006948 Bacteria 73584
36 Ga0105240_10018868 3300009093 Bacteria 9234
37 Ga0105240_10212264 3300009093 Bacteria 2261
38 Ga0111539_10079545 3300009094 Unclassified 3856
39 Ga0111539_10814754 3300009094 Unclassified 1086
40 Ga0114129_10286064 3300009147 Bacteria 2201
41 Ga0105249_10000760 3300009553 Bacteria 28970
42 Ga0105249_10006062 3300009553 Bacteria 10476
43 Ga0105249_10190326 3300009553 Bacteria 2002
44 Ga0105246_10050825 3300011119 Bacteria 2844
45 Ga0157369_10001506 3300013105 Bacteria 28594
46 Ga0157378_10779324 3300013297 Unclassified 981
47 Ga0163162_10181958 3300013306 Bacteria 2228
48 Ga0163163_10081172 3300014325 Unclassified 3244
49 Ga0163163_10426838 3300014325 Unclassified 1385
50 Ga0163161_10085232 3300017792 Bacteria 2331
51 Ga0209564_1037477 3300025295 Bacteria 1365
52 Ga0209256_1000347 3300025299 Bacteria 75262
53 Ga0209256_1035291 3300025299 Bacteria 1323
54 Ga0207684_10107357 3300025910 Bacteria 2388
55 Ga0207707_10314350 3300025912 Bacteria 1353
56 Ga0207707_10643895 3300025912 Bacteria 894
57 Ga0207695_10066083 3300025913 Bacteria 3716
58 Ga0207646_10051352 3300025922 Bacteria 3690
59 Ga0207644_10000025 3300025931 Bacteria 152401
60 Ga0207712_10016435 3300025961 Bacteria 4792
61 Ga0207712_10111260 3300025961 Bacteria 2055
62 Ga0207668_10000111 3300025972 Bacteria 58689
63 Ga0207702_10072177 3300026078 Bacteria 2974
64 Ga0207641_10000001 3300026088 Bacteria 1180841
65 Ga0207676_10353855 3300026095 Bacteria 1359
66 Ga0207675_100684016 3300026118 Bacteria 1034
67 Ga0209282_1000014 3300027666 Bacteria 207318
68 Ga0207428_10079581 3300027907 Unclassified 2562
69 Ga0268265_10108952 3300028380 Bacteria 2256
70 Ga0268265_10391807 3300028380 Bacteria 1281
71 Ga0268264_10030779 3300028381 Bacteria 4398
72 Ga0268264_10458199 3300028381 Unclassified 1237
73 Ga0268264_10756613 3300028381 Unclassified 968
74 Ga0307515_10061385 3300028794 Bacteria 5334
75 Ga0307515_10073177 3300028794 Bacteria 4611
76 Ga0316177_1115684 3300030731 Bacteria 1361
77 Ga0265327_10001986 3300031251 Bacteria 23280
78 Ga0307513_10057336 3300031456 Bacteria 4150
79 Ga0307408_100056168 3300031548 Bacteria 2854
80 Ga0307408_100210037 3300031548 Bacteria 1581
81 Ga0307408_100264382 3300031548 Bacteria 1425
82 Ga0307408_100388987 3300031548 Bacteria 1194
83 Ga0307408_100468792 3300031548 Bacteria 1096
84 Ga0316579_10025003 3300031691 Bacteria 2692
85 Ga0316578_10014261 3300031728 Bacteria 4239
86 Ga0307405_10179389 3300031731 Bacteria 1519
87 Ga0307405_10487278 3300031731 Bacteria 985
88 Ga0307413_10000936 3300031824 Bacteria 10415
89 Ga0307413_10062090 3300031824 Bacteria 2309
90 Ga0307410_10000437 3300031852 Bacteria 16691
91 Ga0307410_10056548 3300031852 Bacteria 2668
92 Ga0307410_10401607 3300031852 Bacteria 1107
93 Ga0307406_10345462 3300031901 Bacteria 1160
94 Ga0307407_10005484 3300031903 Bacteria 5510
95 Ga0307407_10037701 3300031903 Bacteria 2673
96 Ga0307407_10309193 3300031903 Bacteria 1105
97 Ga0307412_10000122 3300031911 Bacteria 59264
98 Ga0307412_10013785 3300031911 Bacteria 4749
99 Ga0307412_10039485 3300031911 Bacteria 3047
100 Ga0307412_10188292 3300031911 Bacteria 1558
101 Ga0307409_100029139 3300031995 Bacteria 3946
102 Ga0307409_100031250 3300031995 Bacteria 3840
103 Ga0307409_100081403 3300031995 Bacteria 2617
104 Ga0307409_100221916 3300031995 Bacteria 1707
105 Ga0307416_100061027 3300032002 Bacteria 3074
106 Ga0307416_100123975 3300032002 Bacteria 2310
107 Ga0307416_100163617 3300032002 Bacteria 2060
108 Ga0307416_100240823 3300032002 Bacteria 1753
109 Ga0307414_10000068 3300032004 Bacteria 100925
110 Ga0307414_10042714 3300032004 Bacteria 3082
111 Ga0307414_10047242 3300032004 Bacteria 2961
112 Ga0307414_10358663 3300032004 Bacteria 1253
113 Ga0307414_10441141 3300032004 Bacteria 1140
114 Ga0307414_10472248 3300032004 Bacteria 1104
115 Ga0307411_10011258 3300032005 Bacteria 4817
116 Ga0307411_10032108 3300032005 Bacteria 3240
117 Ga0307411_10087954 3300032005 Bacteria 2159
118 Ga0307411_10091476 3300032005 Bacteria 2125
119 Ga0307415_100017523 3300032126 Bacteria 4297
120 Ga0307415_100022709 3300032126 Bacteria 3878
121 Ga0307415_100043979 3300032126 Bacteria 2983
122 Ga0307415_100498537 3300032126 Bacteria 1064
123 Ga0316583_10014120 3300032133 Bacteria 2881
124 Ga0307507_10053977 3300033179 Bacteria 3832
125 Ga0316584_0112171 3300036712 Bacteria 2040
126 Ga0395900_0348761 3300037418 Unclassified 1454
127 Ga0395898_0120725 3300037466 Bacteria 2511
128 Ga0395898_0291683 3300037466 Bacteria 1556
129 Ga0395905_0002064 3300037471 Bacteria 22890
130 Ga0316581_0000614 3300037588 Bacteria 7088
131 Ga0436361_0279504 3300039447 Bacteria 1622
132 Ga0439445_0044514 3300042004 Bacteria 1186
133 Ga0439435_0049014 3300042436 Bacteria 1204
134 Ga0451577_0001385 3300042876 Bacteria 32460
135 Ga0466969_0006973 3300044656 Bacteria 6011
136 Ga0466965_0032797 3300044683 Bacteria 2537
137 Ga0466966_0000115 3300044684 Bacteria 49898
138 Ga0466961_0000137 3300044693 Bacteria 49031
139 Ga0466964_0000061 3300044706 Bacteria 23354
140 Ga0453684_0002183 3300044712 Bacteria 48811
141 Ga0466971_0000907 3300044719 Bacteria 12133
142 Ga0466970_0000553 3300044765 Bacteria 18250
143 Ga0466957_0004018 3300044842 Bacteria 8138
144 Ga0466959_0026705 3300045049 Bacteria 4280
145 Ga0451576_0000137 3300045051 Bacteria 185212
146 Ga0495590_0001721 3300046457 Bacteria 9306
147 Ga0495594_0183839 3300046499 Bacteria 1190
148 Ga0495642_0017836 3300046528 Bacteria 2774
149 Ga0495613_0119010 3300046689 Bacteria 1898
150 Ga0495649_0087604 3300046694 Bacteria 1661
151 Ga0495672_0065456 3300047320 Bacteria 2078
152 Ga0495680_0191366 3300047322 Unclassified 1472
153 Ga0495686_0000179 3300047472 Bacteria 121257
154 Ga0495686_0051567 3300047472 Bacteria 2581
155 Ga0495686_0058828 3300047472 Bacteria 2395
156 Ga0496100_0336405 3300048903 Bacteria 1137
157 Ga0496117_0001914 3300048920 Bacteria 27897
158 Ga0496118_0012102 3300048921 Bacteria 8329
159 Ga0496125_0000735 3300048928 Bacteria 54271
160 Ga0496126_0000082 3300048929 Bacteria 218571
161 Ga0501297_005462 3300049520 Bacteria 1330
162 Ga0501032_0000271 3300049569 Bacteria 43560
163 Ga0501032_0001877 3300049569 Bacteria 16593
164 Ga0501034_0090357 3300049571 Bacteria 3060
165 Ga0501034_0102013 3300049571 Bacteria 2862
166 Ga0501034_0209506 3300049571 Bacteria 1905
167 Ga0501037_0021692 3300049573 Bacteria 4750
168 Ga0501037_0025664 3300049573 Bacteria 4353
169 Ga0501043_0051046 3300049579 Bacteria 3251
170 Ga0501043_0066699 3300049579 Bacteria 2826
171 Ga0501047_0131861 3300049581 Bacteria 2379
172 Ga0501047_0333889 3300049581 Bacteria 1354
173 Ga0501048_0083805 3300049582 Bacteria 2248
174 Ga0501067_0000093 3300049583 Bacteria 52103
175 Ga0501067_0000404 3300049583 Bacteria 23609
176 Ga0501068_0000915 3300049584 Bacteria 15432
177 Ga0501068_0002332 3300049584 Bacteria 10112
178 Ga0501072_0109853 3300049588 Bacteria 2195
179 Ga0501073_0000068 3300049589 Bacteria 63524
180 Ga0501073_0000084 3300049589 Bacteria 59662
181 Ga0501073_0037732 3300049589 Bacteria 3429
182 Ga0501077_0000056 3300049593 Bacteria 57478
183 Ga0501077_0000557 3300049593 Bacteria 22637
184 Ga0501198_004204 3300049649 Bacteria 1993
185 Ga0501211_004767 3300049658 Bacteria 1372
186 Ga0501223_000966 3300049663 Bacteria 6770
187 Ga0501223_040967 3300049663 Bacteria 899
188 Ga0501224_000009 3300049664 Bacteria 107191
189 Ga0501235_049215 3300049669 Bacteria 974
190 Ga0501249_043292 3300049679 Bacteria 1024
191 Ga0501221_001469 3300049704 Bacteria 3903
192 Ga0501225_0000111 3300049705 Bacteria 25256
193 Ga0501229_002732 3300049706 Bacteria 2086
194 Ga0501234_000428 3300049707 Bacteria 6278
195 Ga0501080_0001062 3300049742 Bacteria 22597
196 Ga0501080_0036798 3300049742 Bacteria 4569
197 Ga0501080_0104079 3300049742 Bacteria 2632
198 Ga0501083_0139290 3300049744 Bacteria 1589
199 Ga0501267_001894 3300049764 Bacteria 1843
200 Ga0501044_0002185 3300049823 Bacteria 22434
201 Ga0501044_0007701 3300049823 Bacteria 11845
202 Ga0501044_0053623 3300049823 Bacteria 4148
203 Ga0501044_0074924 3300049823 Bacteria 3437
204 Ga0501226_000067 3300049853 Bacteria 34043
205 nmdc:mga05p37_42675_c1 3300050507 Bacteria 5574
206 nmdc:mga0qj67_166804_c1 3300050509 Bacteria 1788
207 nmdc:mga06r32_127806_c1 3300050510 Bacteria 2511
208 nmdc:mga06r32_498890_c1 3300050510 Bacteria 1194
209 nmdc:mga08y16_116071_c1 3300050511 Unclassified 2787
210 Ga0500595_003360 3300053119 Bacteria 7511
211 Ga0466962_0000766 3300061719 Bacteria 14407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100158294 Ga0068863_1001582943 225
2 3300009093 Ga0105240_10018868 Ga0105240_100188682 225
3 3300013105 Ga0157369_10001506 Ga0157369_1000150610 225
4 3300025913 Ga0207695_10066083 Ga0207695_100660832 225
5 3300037466 Ga0395898_0291683 Ga0395898_0291683_217_1008 225
6 3300031548 Ga0307408_100468792 Ga0307408_1004687922 228
7 3300005563 Ga0068855_100053428 Ga0068855_1000534282 233
8 3300005458 Ga0070681_10066529 Ga0070681_100665294 234
9 3300009093 Ga0105240_10212264 Ga0105240_102122641 234
10 3300031548 Ga0307408_100388987 Ga0307408_1003889872 235
11 3300031731 Ga0307405_10487278 Ga0307405_104872782 235
12 3300031903 Ga0307407_10309193 Ga0307407_103091932 235
13 3300031995 Ga0307409_100081403 Ga0307409_1000814034 235
14 3300032002 Ga0307416_100061027 Ga0307416_1000610274 235
15 3300032004 Ga0307414_10358663 Ga0307414_103586632 235
16 3300032005 Ga0307411_10087954 Ga0307411_100879542 235
17 3300032126 Ga0307415_100498537 Ga0307415_1004985371 235
18 3300005530 Ga0070679_100047964 Ga0070679_1000479643 236
19 3300025912 Ga0207707_10314350 Ga0207707_103143502 236
20 3300031824 Ga0307413_10000936 Ga0307413_100009363 238
21 3300031852 Ga0307410_10000437 Ga0307410_1000043718 238
22 3300031911 Ga0307412_10013785 Ga0307412_100137855 238
23 3300031995 Ga0307409_100031250 Ga0307409_1000312504 238
24 3300032005 Ga0307411_10011258 Ga0307411_100112583 238
25 3300032126 Ga0307415_100043979 Ga0307415_1000439792 238
26 3300044712 Ga0453684_0002183 Ga0453684_0002183_24527_25423 239
27 3300045051 Ga0451576_0000137 Ga0451576_0000137_160857_161753 239
28 3300046528 Ga0495642_0017836 Ga0495642_0017836_784_1641 240
29 3300049571 Ga0501034_0102013 Ga0501034_0102013_1428_2357 240
30 3300049581 Ga0501047_0131861 Ga0501047_0131861_1006_1926 240
31 3300049588 Ga0501072_0109853 Ga0501072_0109853_220_1149 240
32 3300049581 Ga0501047_0333889 Ga0501047_0333889_322_1257 243
33 3300049582 Ga0501048_0083805 Ga0501048_0083805_1194_2129 243
34 3300049589 Ga0501073_0037732 Ga0501073_0037732_568_1503 243
35 3300049742 Ga0501080_0001062 Ga0501080_0001062_11085_12020 243
36 3300049744 Ga0501083_0139290 Ga0501083_0139290_382_1317 243
37 3300049823 Ga0501044_0074924 Ga0501044_0074924_663_1598 243
38 3300005334 Ga0068869_100129961 Ga0068869_1001299612 244
39 3300005842 Ga0068858_100383900 Ga0068858_1003839002 244
40 3300005844 Ga0068862_100080765 Ga0068862_1000807652 244
41 3300005844 Ga0068862_100158961 Ga0068862_1001589613 244
42 3300006846 Ga0075430_100033363 Ga0075430_1000333633 244
43 3300009094 Ga0111539_10814754 Ga0111539_108147541 244
44 3300009553 Ga0105249_10000760 Ga0105249_1000076012 244
45 3300013306 Ga0163162_10181958 Ga0163162_101819582 244
46 3300014325 Ga0163163_10426838 Ga0163163_104268382 244
47 3300025961 Ga0207712_10111260 Ga0207712_101112602 244
48 3300026095 Ga0207676_10353855 Ga0207676_103538552 244
49 3300028380 Ga0268265_10108952 Ga0268265_101089521 244
50 3300028381 Ga0268264_10756613 Ga0268264_107566131 244
51 3300031548 Ga0307408_100264382 Ga0307408_1002643822 244
52 3300031731 Ga0307405_10179389 Ga0307405_101793891 244
53 3300031911 Ga0307412_10000122 Ga0307412_1000012249 244
54 3300032004 Ga0307414_10000068 Ga0307414_1000006821 244
55 3300032005 Ga0307411_10091476 Ga0307411_100914762 244
56 3300046499 Ga0495594_0183839 Ga0495594_0183839_153_971 244
57 3300046689 Ga0495613_0119010 Ga0495613_0119010_698_1516 244
58 3300047322 Ga0495680_0191366 Ga0495680_0191366_191_1009 244
59 3300049520 Ga0501297_005462 Ga0501297_005462_494_1306 244
60 3300049571 Ga0501034_0090357 Ga0501034_0090357_1135_1959 244
61 3300049649 Ga0501198_004204 Ga0501198_004204_1050_1874 244
62 3300049658 Ga0501211_004767 Ga0501211_004767_511_1323 244
63 3300049663 Ga0501223_000966 Ga0501223_000966_4875_5699 244
64 3300049664 Ga0501224_000009 Ga0501224_000009_56403_57227 244
65 3300049669 Ga0501235_049215 Ga0501235_049215_140_964 244
66 3300049679 Ga0501249_043292 Ga0501249_043292_146_958 244
67 3300049704 Ga0501221_001469 Ga0501221_001469_2625_3437 244
68 3300049705 Ga0501225_0000111 Ga0501225_0000111_5358_6182 244
69 3300049706 Ga0501229_002732 Ga0501229_002732_457_1269 244
70 3300049707 Ga0501234_000428 Ga0501234_000428_4358_5182 244
71 3300049853 Ga0501226_000067 Ga0501226_000067_7048_7872 244
72 3300050509 nmdc:mga0qj67_166804_c1 nmdc:mga0qj67_166804_c1_460_1299 244
73 3300025299 Ga0209256_1035291 Ga0209256_10352912 245
74 3300031903 Ga0307407_10037701 Ga0307407_100377013 245
75 3300031911 Ga0307412_10039485 Ga0307412_100394852 245
76 3300031995 Ga0307409_100221916 Ga0307409_1002219162 245
77 3300032002 Ga0307416_100123975 Ga0307416_1001239752 245
78 3300032126 Ga0307415_100017523 Ga0307415_1000175233 245
79 3300047472 Ga0495686_0051567 Ga0495686_0051567_39_860 245
80 3300048920 Ga0496117_0001914 Ga0496117_0001914_13001_13852 245
81 3300048921 Ga0496118_0012102 Ga0496118_0012102_6203_7054 245
82 3300048929 Ga0496126_0000082 Ga0496126_0000082_35155_36006 245
83 3300049764 Ga0501267_001894 Ga0501267_001894_191_1015 245
84 3300031852 Ga0307410_10401607 Ga0307410_104016071 246
85 3300042436 Ga0439435_0049014 Ga0439435_0049014_145_981 246
86 3300047472 Ga0495686_0058828 Ga0495686_0058828_1401_2297 246
87 3300005337 Ga0070682_100021594 Ga0070682_1000215941 247
88 3300031824 Ga0307413_10062090 Ga0307413_100620902 247
89 3300031852 Ga0307410_10056548 Ga0307410_100565484 247
90 3300031903 Ga0307407_10005484 Ga0307407_100054845 247
91 3300031911 Ga0307412_10188292 Ga0307412_101882922 247
92 3300031995 Ga0307409_100029139 Ga0307409_1000291393 247
93 3300032002 Ga0307416_100240823 Ga0307416_1002408232 247
94 3300032004 Ga0307414_10042714 Ga0307414_100427143 247
95 3300032004 Ga0307414_10472248 Ga0307414_104722482 247
96 3300032005 Ga0307411_10032108 Ga0307411_100321083 247
97 3300032126 Ga0307415_100022709 Ga0307415_1000227094 247
98 3300042876 Ga0451577_0001385 Ga0451577_0001385_22906_23745 247
99 3300049569 Ga0501032_0001877 Ga0501032_0001877_1871_2734 247
100 3300049573 Ga0501037_0025664 Ga0501037_0025664_2567_3430 247
101 3300049579 Ga0501043_0066699 Ga0501043_0066699_1297_2160 247
102 3300049583 Ga0501067_0000404 Ga0501067_0000404_21971_22834 247
103 3300049584 Ga0501068_0002332 Ga0501068_0002332_8057_8920 247
104 3300049589 Ga0501073_0000068 Ga0501073_0000068_58905_59768 247
105 3300049593 Ga0501077_0000557 Ga0501077_0000557_3666_4529 247
106 3300049742 Ga0501080_0036798 Ga0501080_0036798_22_885 247
107 3300049823 Ga0501044_0002185 Ga0501044_0002185_19532_20395 247
108 3300049823 Ga0501044_0053623 Ga0501044_0053623_1836_2654 247
109 3300005435 Ga0070714_100440802 Ga0070714_1004408021 248
110 3300025912 Ga0207707_10643895 Ga0207707_106438951 248
111 3300031456 Ga0307513_10057336 Ga0307513_100573363 248
112 3300037418 Ga0395900_0348761 Ga0395900_0348761_99_890 248
113 3300037466 Ga0395898_0120725 Ga0395898_0120725_520_1311 248
114 3300003775 Ga0055524_1000218 Ga0055524_100021827 249
115 3300005262 Ga0065165_1018923 Ga0065165_10189232 249
116 3300005347 Ga0070668_100000240 Ga0070668_10000024014 249
117 3300005355 Ga0070671_100000232 Ga0070671_1000002325 249
118 3300005841 Ga0068863_100000001 Ga0068863_100000001606 249
119 3300005844 Ga0068862_100047662 Ga0068862_1000476624 249
120 3300006948 Ga0099826_10000051 Ga0099826_1000005128 249
121 3300009553 Ga0105249_10006062 Ga0105249_1000606212 249
122 3300025295 Ga0209564_1037477 Ga0209564_10374772 249
123 3300025299 Ga0209256_1000347 Ga0209256_100034728 249
124 3300025931 Ga0207644_10000025 Ga0207644_1000002544 249
125 3300025961 Ga0207712_10016435 Ga0207712_100164354 249
126 3300025972 Ga0207668_10000111 Ga0207668_1000011118 249
127 3300026088 Ga0207641_10000001 Ga0207641_10000001941 249
128 3300027666 Ga0209282_1000014 Ga0209282_1000014145 249
129 3300028381 Ga0268264_10030779 Ga0268264_100307795 249
130 3300042004 Ga0439445_0044514 Ga0439445_0044514_208_1032 249
131 3300046694 Ga0495649_0087604 Ga0495649_0087604_734_1543 249
132 3300005444 Ga0070694_100149877 Ga0070694_1001498771 250
133 3300005445 Ga0070708_100060826 Ga0070708_1000608264 250
134 3300005467 Ga0070706_100096802 Ga0070706_1000968021 250
135 3300005468 Ga0070707_100134567 Ga0070707_1001345673 250
136 3300005530 Ga0070679_100527719 Ga0070679_1005277191 250
137 3300005546 Ga0070696_100288772 Ga0070696_1002887722 250
138 3300013297 Ga0157378_10779324 Ga0157378_107793241 250
139 3300025910 Ga0207684_10107357 Ga0207684_101073571 250
140 3300025922 Ga0207646_10051352 Ga0207646_100513521 250
141 3300039447 Ga0436361_0279504 Ga0436361_0279504_633_1418 250
142 3300047472 Ga0495686_0000179 Ga0495686_0000179_88806_89720 250
143 3300049569 Ga0501032_0000271 Ga0501032_0000271_21462_22382 250
144 3300049571 Ga0501034_0209506 Ga0501034_0209506_459_1379 250
145 3300049573 Ga0501037_0021692 Ga0501037_0021692_2055_2975 250
146 3300049579 Ga0501043_0051046 Ga0501043_0051046_1534_2454 250
147 3300049583 Ga0501067_0000093 Ga0501067_0000093_43204_44124 250
148 3300049584 Ga0501068_0000915 Ga0501068_0000915_2939_3859 250
149 3300049589 Ga0501073_0000084 Ga0501073_0000084_52862_53782 250
150 3300049593 Ga0501077_0000056 Ga0501077_0000056_27704_28624 250
151 3300049742 Ga0501080_0104079 Ga0501080_0104079_126_1046 250
152 3300049823 Ga0501044_0007701 Ga0501044_0007701_3222_4142 250
153 3300053119 Ga0500595_003360 Ga0500595_003360_4751_5641 250
154 iso_pu_bacteria 2643221585 2643936566 250
155 iso_pu_bacteria 2643221639 2644222410 250
156 iso_pu_bacteria 2643221646 2644256420 250
157 iso_pu_bacteria 2643221656 2644317922 250
158 iso_pu_bacteria 2885427238 2885428643 250
159 3300026118 Ga0207675_100684016 Ga0207675_1006840161 251
160 3300030731 Ga0316177_1115684 Ga0316177_11156842 251
161 3300031251 Ga0265327_10001986 Ga0265327_100019867 251
162 3300031548 Ga0307408_100056168 Ga0307408_1000561683 251
163 3300031901 Ga0307406_10345462 Ga0307406_103454622 251
164 3300032002 Ga0307416_100163617 Ga0307416_1001636171 251
165 3300032004 Ga0307414_10047242 Ga0307414_100472424 251
166 3300044656 Ga0466969_0006973 Ga0466969_0006973_1169_2053 251
167 3300044683 Ga0466965_0032797 Ga0466965_0032797_230_1114 251
168 3300044684 Ga0466966_0000115 Ga0466966_0000115_39568_40452 251
169 3300044693 Ga0466961_0000137 Ga0466961_0000137_3380_4264 251
170 3300044706 Ga0466964_0000061 Ga0466964_0000061_21382_22266 251
171 3300044719 Ga0466971_0000907 Ga0466971_0000907_7770_8654 251
172 3300044765 Ga0466970_0000553 Ga0466970_0000553_17079_17963 251
173 3300044842 Ga0466957_0004018 Ga0466957_0004018_3602_4486 251
174 3300045049 Ga0466959_0026705 Ga0466959_0026705_3352_4236 251
175 3300047320 Ga0495672_0065456 Ga0495672_0065456_997_1923 251
176 3300061719 Ga0466962_0000766 Ga0466962_0000766_12408_13292 251
177 3300005293 Ga0065715_10169398 Ga0065715_101693982 252
178 3300005343 Ga0070687_100142568 Ga0070687_1001425682 252
179 3300005444 Ga0070694_100393873 Ga0070694_1003938732 252
180 3300005466 Ga0070685_10083392 Ga0070685_100833922 252
181 3300005544 Ga0070686_100221113 Ga0070686_1002211131 252
182 3300005719 Ga0068861_100086397 Ga0068861_1000863971 252
183 3300005842 Ga0068858_100140621 Ga0068858_1001406212 252
184 3300005844 Ga0068862_100253690 Ga0068862_1002536903 252
185 3300009094 Ga0111539_10079545 Ga0111539_100795452 252
186 3300009147 Ga0114129_10286064 Ga0114129_102860644 252
187 3300009553 Ga0105249_10190326 Ga0105249_101903262 252
188 3300011119 Ga0105246_10050825 Ga0105246_100508254 252
189 3300014325 Ga0163163_10081172 Ga0163163_100811722 252
190 3300017792 Ga0163161_10085232 Ga0163161_100852324 252
191 3300027907 Ga0207428_10079581 Ga0207428_100795813 252
192 3300028380 Ga0268265_10391807 Ga0268265_103918072 252
193 3300028381 Ga0268264_10458199 Ga0268264_104581991 252
194 3300031548 Ga0307408_100210037 Ga0307408_1002100371 252
195 3300031691 Ga0316579_10025003 Ga0316579_100250031 252
196 3300031728 Ga0316578_10014261 Ga0316578_100142614 252
197 3300032133 Ga0316583_10014120 Ga0316583_100141202 252
198 3300033179 Ga0307507_10053977 Ga0307507_100539774 252
199 3300036712 Ga0316584_0112171 Ga0316584_0112171_49_864 252
200 3300037588 Ga0316581_0000614 Ga0316581_0000614_602_1411 252
201 3300048903 Ga0496100_0336405 Ga0496100_0336405_120_935 252
202 3300050507 nmdc:mga05p37_42675_c1 nmdc:mga05p37_42675_c1_4354_5214 252
203 3300050510 nmdc:mga06r32_127806_c1 nmdc:mga06r32_127806_c1_1606_2439 252
204 3300050510 nmdc:mga06r32_498890_c1 nmdc:mga06r32_498890_c1_271_1128 252
205 3300050511 nmdc:mga08y16_116071_c1 nmdc:mga08y16_116071_c1_1378_2238 252
206 3300032004 Ga0307414_10441141 Ga0307414_104411412 253
207 3300037471 Ga0395905_0002064 Ga0395905_0002064_5683_6528 253
208 3300046457 Ga0495590_0001721 Ga0495590_0001721_5130_5975 253
209 3300048928 Ga0496125_0000735 Ga0496125_0000735_16515_17339 253
210 3300003316 rootH1_10005435 rootH1_1000543512 254
211 3300003322 rootL2_10030875 rootL2_100308753 254
212 3300005614 Ga0068856_100025823 Ga0068856_1000258233 254
213 3300026078 Ga0207702_10072177 Ga0207702_100721772 254
214 3300028794 Ga0307515_10061385 Ga0307515_100613855 254
215 3300028794 Ga0307515_10073177 Ga0307515_100731774 254
216 3300049663 Ga0501223_040967 Ga0501223_040967_41_847 254

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.7882 22 254
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.7855 45 167
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.7765 22 254
4qtt-assembly1.cif.gz_B structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form) 0.7739 33 253
3tma-assembly1.cif.gz_A crystal structure of trmn from thermus thermophilus 0.7707 46 254
ID Description Score Start End Superfamily
af_A0A1D6EZM8_172_271_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8205 123 203 3.40.50.150
3tmaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.802 46 254 3.40.50.150
3dp7B03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7936 59 254 3.40.50.150
3dh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7882 22 254 3.40.50.150
af_A0A1D6K4H3_75_167_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7861 123 253 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A520G6B3-F1-model_v4 Methyltransferase 0.999 157 254 GO:0008168
GO:0032259
AF-A0A257MXU4-F1-model_v4 Methyltransferase 0.9917 122 254
AF-A0A520G6B3-F1-model_v4 Methyltransferase 0.9889 157 254 GO:0008168
GO:0032259
AF-A0A7Z8QKB8-F1-model_v4 Methyltransferase 0.9876 154 254
AF-A0A6N7CVK5-F1-model_v4 Methyltransferase 0.9868 162 254

Feature Viewer

pLDDT pTM Quality
92.59 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map