F327843

General Info

Members Datasets Scaffolds Average Seq Length
216 142 204 220

Family's Representative Sequence

Representative Sequence 3300041410|Ga0439461_0037956|Ga0439461_0037956_65_733
Length 209
Sequence MPAHRPRQFDLIAFDWDGTLFDSTRIIVRCIQDAVADVGGTVPTDREAAYVIGMGLMRYPELGASYRRHYMGRQNDLSLFDGVLPMLSDLRERHHWLAVATGKSRRGLDEVLQTVQLAGVFDGSRTADETAGKPDPRMLHELMREFGTDPERTLMIGDTTHDLQMALNAGCPSVAVSYGAHTPEGFEALQPLAIVHSVGGLHAWLRENA

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221570 Acidovorax sp. Root568 Isolate Unclassified
3 2643221596 Acidovorax sp. Root70 Isolate Unclassified
4 2643221609 Acidovorax sp. Root217 Isolate Unclassified
5 2643221611 Acidovorax sp. Root219 Isolate Unclassified
6 2643221652 Acidovorax sp. Root402 Isolate Unclassified
7 2643221717 Acidovorax sp. Root267 Isolate Unclassified
8 2738543012 Acidovorax sp. CF301 Isolate Unclassified
9 2816332133 Acidovorax radicis 2721A Isolate Unclassified
10 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
11 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
12 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
77 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
78 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
79 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
82 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
83 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
84 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
85 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
86 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
87 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
88 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
89 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
90 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
91 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
92 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
140 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 0
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 0
Rhizoplane 1.39
Rhizosphere 78.24
Stem 0
Stem Tuber 0
Unclassified 11.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1007484 3300003792 Bacteria 4108
2 Ga0055531_10001947 3300003794 Bacteria 14432
3 Ga0065707_10219479 3300005295 Bacteria 1231
4 Ga0070658_10385296 3300005327 Bacteria 1203
5 Ga0068868_100022563 3300005338 Bacteria 4753
6 Ga0070661_100016478 3300005344 Bacteria 5226
7 Ga0070659_100000701 3300005366 Bacteria 24367
8 Ga0070659_100422804 3300005366 Bacteria 1127
9 Ga0070706_100263088 3300005467 Bacteria 1610
10 Ga0070679_100037946 3300005530 Bacteria 4787
11 Ga0070679_100130878 3300005530 Bacteria 2490
12 Ga0068853_100123172 3300005539 Bacteria 2315
13 Ga0068855_100080777 3300005563 Bacteria 3770
14 Ga0068855_100146187 3300005563 Bacteria 2691
15 Ga0068855_100218162 3300005563 Bacteria 2140
16 Ga0068855_100341504 3300005563 Bacteria 1651
17 Ga0068855_100605462 3300005563 Bacteria 1181
18 Ga0070664_100161571 3300005564 Bacteria 1982
19 Ga0068862_100891244 3300005844 Bacteria 874
20 Ga0075365_10003019 3300006038 Bacteria 8529
21 Ga0075363_100130647 3300006048 Bacteria 1408
22 Ga0075362_10053350 3300006177 Bacteria 1814
23 Ga0075367_10106443 3300006178 Bacteria 1718
24 Ga0075367_10137370 3300006178 Bacteria 1513
25 Ga0075366_10000297 3300006195 Bacteria 22376
26 Ga0075366_10159740 3300006195 Bacteria 1365
27 Ga0075366_10344885 3300006195 Bacteria 914
28 Ga0068865_100813170 3300006881 Bacteria 807
29 Ga0105240_10010605 3300009093 Bacteria 12949
30 Ga0105245_10007033 3300009098 Bacteria 9874
31 Ga0105241_10043787 3300009174 Bacteria 3390
32 Ga0105242_10001240 3300009176 Bacteria 20102
33 Ga0105248_11713160 3300009177 Bacteria 712
34 Ga0157376_10678313 3300014969 Bacteria 1034
35 Ga0163161_10147941 3300017792 Bacteria 1783
36 Ga0213872_10000339 3300021361 Bacteria 39618
37 Ga0213872_10073201 3300021361 Bacteria 1543
38 Ga0209673_1010989 3300025273 Bacteria 3770
39 Ga0209673_1019971 3300025273 Bacteria 2389
40 Ga0209051_1000244 3300025303 Bacteria 91505
41 Ga0209257_1000144 3300025304 Bacteria 197078
42 Ga0207705_10130173 3300025909 Bacteria 1872
43 Ga0207705_10391568 3300025909 Bacteria 1074
44 Ga0207695_10120694 3300025913 Bacteria 2590
45 Ga0207649_10000359 3300025920 Bacteria 34180
46 Ga0207681_10020033 3300025923 Bacteria 4236
47 Ga0207694_10050861 3300025924 Bacteria 3211
48 Ga0207687_10009343 3300025927 Bacteria 6411
49 Ga0207690_10032846 3300025932 Bacteria 3333
50 Ga0207686_10170537 3300025934 Bacteria 1534
51 Ga0207689_10062357 3300025942 Bacteria 3066
52 Ga0207679_10000047 3300025945 Bacteria 119891
53 Ga0207667_10084903 3300025949 Bacteria 3277
54 Ga0207667_10117327 3300025949 Bacteria 2743
55 Ga0207667_10298523 3300025949 Bacteria 1646
56 Ga0207639_10213738 3300026041 Bacteria 1662
57 Ga0209970_1000606 3300027614 Bacteria 6226
58 Ga0209970_1036305 3300027614 Bacteria 868
59 Ga0209983_1013200 3300027665 Bacteria 1698
60 Ga0209974_10010746 3300027876 Bacteria 3084
61 Ga0209974_10014186 3300027876 Bacteria 2655
62 Ga0265334_10066645 3300028573 Bacteria 1347
63 Ga0307515_10000084 3300028794 Bacteria 221434
64 Ga0307515_10113009 3300028794 Bacteria 3153
65 Ga0307515_10341061 3300028794 Bacteria 1151
66 Ga0265330_10000156 3300031235 Bacteria 55313
67 Ga0265332_10000157 3300031238 Bacteria 55228
68 Ga0265325_10021006 3300031241 Bacteria 3593
69 Ga0265340_10015374 3300031247 Bacteria 3977
70 Ga0307513_10000008 3300031456 Bacteria 442128
71 Ga0307513_10011348 3300031456 Bacteria 11079
72 Ga0307513_10067372 3300031456 Bacteria 3756
73 Ga0307513_10317306 3300031456 Bacteria 1318
74 Ga0307408_100000663 3300031548 Bacteria 28685
75 Ga0307408_100220468 3300031548 Bacteria 1547
76 Ga0307408_100304765 3300031548 Bacteria 1336
77 Ga0307408_101038196 3300031548 Bacteria 757
78 Ga0307514_10000319 3300031649 Bacteria 115327
79 Ga0265314_10000446 3300031711 Bacteria 55219
80 Ga0265314_10045617 3300031711 Bacteria 3097
81 Ga0307406_10001789 3300031901 Bacteria 11747
82 Ga0307406_10045841 3300031901 Bacteria 2747
83 Ga0373959_0078266 3300034820 Bacteria 758
84 Ga0395899_0004638 3300037312 Bacteria 10716
85 Ga0395899_0006125 3300037312 Bacteria 9320
86 Ga0395899_0267480 3300037312 Bacteria 1167
87 Ga0395900_0012897 3300037418 Bacteria 8537
88 Ga0395900_0085292 3300037418 Bacteria 3245
89 Ga0395900_0101668 3300037418 Bacteria 2952
90 Ga0395900_0176063 3300037418 Bacteria 2176
91 Ga0395900_0244757 3300037418 Bacteria 1797
92 Ga0395898_0002457 3300037466 Bacteria 21855
93 Ga0395898_0005633 3300037466 Bacteria 13498
94 Ga0395898_0276239 3300037466 Bacteria 1602
95 Ga0395898_0294563 3300037466 Bacteria 1548
96 Ga0395905_0000407 3300037471 Bacteria 60417
97 Ga0395905_0002746 3300037471 Bacteria 19269
98 Ga0395905_0017113 3300037471 Bacteria 6885
99 Ga0395905_0018289 3300037471 Bacteria 6652
100 Ga0395905_0027743 3300037471 Bacteria 5339
101 Ga0395905_0036247 3300037471 Bacteria 4632
102 Ga0395905_0036262 3300037471 Bacteria 4631
103 Ga0395905_0068098 3300037471 Bacteria 3334
104 Ga0395905_0069778 3300037471 Bacteria 3291
105 Ga0395905_0131357 3300037471 Bacteria 2355
106 Ga0395905_0149744 3300037471 Bacteria 2195
107 Ga0395905_0911056 3300037471 Bacteria 782
108 Ga0395901_0009542 3300038443 Bacteria 9846
109 Ga0395901_0041547 3300038443 Bacteria 4766
110 Ga0395901_0044556 3300038443 Bacteria 4601
111 Ga0395901_0045083 3300038443 Bacteria 4575
112 Ga0395901_0101009 3300038443 Bacteria 3027
113 Ga0395901_0111590 3300038443 Bacteria 2872
114 Ga0395901_0155009 3300038443 Bacteria 2406
115 Ga0395901_0209311 3300038443 Bacteria 2042
116 Ga0395901_0472748 3300038443 Bacteria 1279
117 Ga0395901_0514210 3300038443 Bacteria 1217
118 Ga0436361_0265063 3300039447 Bacteria 36678
119 Ga0436361_0508128 3300039447 Bacteria 12467
120 Ga0436361_1166274 3300039447 Bacteria 3758
121 Ga0439439_0062265 3300041406 Bacteria 992
122 Ga0439461_0037956 3300041410 Bacteria 1031
123 Ga0451791_0888984 3300041451 Bacteria 1104
124 Ga0439441_062541 3300042001 Bacteria 786
125 Ga0439449_0000371 3300042007 Bacteria 16522
126 Ga0439457_039530 3300042014 Bacteria 1051
127 Ga0450911_003388 3300042115 Bacteria 2827
128 Ga0450890_002976 3300042127 Bacteria 2278
129 Ga0450894_013486 3300042131 Bacteria 1074
130 Ga0450905_007932 3300042142 Bacteria 1451
131 Ga0450905_037235 3300042142 Bacteria 765
132 Ga0439446_0006378 3300042156 Bacteria 3073
133 Ga0439446_0083727 3300042156 Bacteria 991
134 Ga0439458_0031130 3300042157 Bacteria 1271
135 Ga0450909_011001 3300042185 Bacteria 1325
136 Ga0439435_0125632 3300042436 Bacteria 807
137 Ga0439464_0004251 3300042439 Bacteria 3657
138 Ga0450916_034842 3300042530 Bacteria 746
139 Ga0450893_0016325 3300042532 Bacteria 1257
140 Ga0451577_0000641 3300042876 Bacteria 55722
141 Ga0451577_0123124 3300042876 Bacteria 2323
142 Ga0466969_0055709 3300044656 Bacteria 1933
143 Ga0466972_0288003 3300044658 Bacteria 767
144 Ga0453683_0003564 3300044673 Bacteria 11430
145 Ga0453683_0378384 3300044673 Bacteria 911
146 Ga0466965_0372216 3300044683 Bacteria 785
147 Ga0466966_0045144 3300044684 Bacteria 2818
148 Ga0466966_0258430 3300044684 Bacteria 1049
149 Ga0466961_0031308 3300044693 Bacteria 3420
150 Ga0466963_0666137 3300044694 Bacteria 734
151 Ga0453684_0001818 3300044712 Bacteria 56168
152 Ga0453684_0888524 3300044712 Bacteria 955
153 Ga0453684_1068382 3300044712 Bacteria 855
154 Ga0466971_0324957 3300044719 Bacteria 742
155 Ga0466968_0024177 3300044735 Bacteria 2480
156 Ga0466970_0122679 3300044765 Bacteria 1424
157 Ga0466960_0269223 3300044901 Bacteria 951
158 Ga0466959_0013433 3300045049 Bacteria 5934
159 Ga0466959_0219830 3300045049 Bacteria 1318
160 Ga0451576_0002104 3300045051 Bacteria 31012
161 Ga0451576_0016175 3300045051 Bacteria 8242
162 Ga0451576_0505808 3300045051 Bacteria 1269
163 Ga0466958_0040835 3300045836 Bacteria 2789
164 Ga0466967_0449195 3300045976 Bacteria 1260
165 Ga0495663_0006855 3300046525 Bacteria 3143
166 Ga0495642_0162925 3300046528 Bacteria 967
167 Ga0495654_0002974 3300046530 Bacteria 10608
168 Ga0495621_0029738 3300046539 Bacteria 1864
169 Ga0495597_0000110 3300046542 Bacteria 72678
170 Ga0495656_0015025 3300046615 Bacteria 2914
171 Ga0495668_0291204 3300046616 Bacteria 895
172 Ga0495588_0098654 3300046674 Bacteria 1534
173 Ga0495669_0040560 3300046684 Bacteria 2065
174 Ga0496105_0437437 3300048908 Bacteria 1034
175 Ga0496108_0240179 3300048911 Bacteria 1576
176 Ga0496122_0000998 3300048925 Bacteria 50283
177 Ga0496123_0000045 3300048926 Bacteria 249294
178 Ga0496124_0050300 3300048927 Bacteria 3552
179 Ga0496124_0138350 3300048927 Bacteria 1925
180 Ga0496125_0023409 3300048928 Bacteria 5701
181 Ga0496126_0110535 3300048929 Bacteria 2394
182 Ga0496126_0429259 3300048929 Bacteria 1067
183 Ga0501032_0180394 3300049569 Bacteria 1383
184 Ga0501032_0321107 3300049569 Bacteria 999
185 Ga0501034_0184978 3300049571 Bacteria 2047
186 Ga0501037_0057380 3300049573 Bacteria 2843
187 Ga0501037_0275215 3300049573 Bacteria 1174
188 Ga0501046_0068216 3300049580 Bacteria 2768
189 Ga0501047_0070399 3300049581 Bacteria 3368
190 Ga0501073_0224316 3300049589 Bacteria 1298
191 Ga0501206_005674 3300049653 Bacteria 1610
192 Ga0501249_031022 3300049679 Bacteria 1191
193 Ga0501080_0200498 3300049742 Bacteria 1832
194 Ga0501035_0188096 3300049822 Bacteria 1776
195 Ga0501035_0297215 3300049822 Bacteria 1361
196 Ga0501044_0234701 3300049823 Bacteria 1780
197 Ga0501044_0339830 3300049823 Bacteria 1422
198 nmdc:mga0k408_2216_c1 3300050493 Bacteria 10412
199 nmdc:mga06z11_58368_c1 3300050494 Bacteria 2002
200 Ga0500644_0019120 3300053088 Bacteria 2017
201 Ga0500646_0035865 3300053090 Bacteria 1380
202 Ga0500616_0026615 3300053153 Bacteria 3200
203 Ga0590075_012460 3300059424 Bacteria 2066
204 Ga0590075_033855 3300059424 Bacteria 1298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0449195 Ga0466967_0449195_703_1248 181
2 3300042001 Ga0439441_062541 Ga0439441_062541_23_691 200
3 3300049653 Ga0501206_005674 Ga0501206_005674_596_1204 202
4 3300044684 Ga0466966_0258430 Ga0466966_0258430_233_895 203
5 3300027614 Ga0209970_1000606 Ga0209970_10006064 207
6 3300027876 Ga0209974_10014186 Ga0209974_100141861 207
7 3300041410 Ga0439461_0037956 Ga0439461_0037956_65_733 208
8 3300042131 Ga0450894_013486 Ga0450894_013486_110_778 208
9 3300042156 Ga0439446_0006378 Ga0439446_0006378_1880_2548 208
10 3300042185 Ga0450909_011001 Ga0450909_011001_50_718 208
11 3300042436 Ga0439435_0125632 Ga0439435_0125632_11_679 208
12 3300042532 Ga0450893_0016325 Ga0450893_0016325_300_968 208
13 3300042156 Ga0439446_0083727 Ga0439446_0083727_288_956 211
14 3300044735 Ga0466968_0024177 Ga0466968_0024177_1599_2270 212
15 iso_pu_bacteria 2881101125 2881105484 215
16 iso_pu_bacteria 2919704043 2919707228 215
17 3300042876 Ga0451577_0123124 Ga0451577_0123124_1091_1750 217
18 iso_pu_bacteria 2939631187 2939632650 217
19 3300005467 Ga0070706_100263088 Ga0070706_1002630882 218
20 3300006195 Ga0075366_10000297 Ga0075366_1000029720 218
21 3300021361 Ga0213872_10000339 Ga0213872_1000033918 218
22 3300021361 Ga0213872_10073201 Ga0213872_100732012 218
23 3300028794 Ga0307515_10000084 Ga0307515_10000084130 218
24 3300028794 Ga0307515_10113009 Ga0307515_101130092 218
25 3300028794 Ga0307515_10341061 Ga0307515_103410612 218
26 3300031456 Ga0307513_10011348 Ga0307513_1001134812 218
27 3300031456 Ga0307513_10067372 Ga0307513_100673722 218
28 3300031456 Ga0307513_10317306 Ga0307513_103173062 218
29 3300031649 Ga0307514_10000319 Ga0307514_1000031932 218
30 3300034820 Ga0373959_0078266 Ga0373959_0078266_53_712 218
31 3300039447 Ga0436361_0265063 Ga0436361_0265063_6070_6729 218
32 3300039447 Ga0436361_1166274 Ga0436361_1166274_773_1432 218
33 3300042115 Ga0450911_003388 Ga0450911_003388_124_783 218
34 3300042142 Ga0450905_007932 Ga0450905_007932_61_720 218
35 3300042530 Ga0450916_034842 Ga0450916_034842_66_725 218
36 3300046530 Ga0495654_0002974 Ga0495654_0002974_6798_7457 218
37 3300048927 Ga0496124_0138350 Ga0496124_0138350_937_1596 218
38 3300048928 Ga0496125_0023409 Ga0496125_0023409_2240_2899 218
39 3300048929 Ga0496126_0110535 Ga0496126_0110535_882_1541 218
40 3300049569 Ga0501032_0321107 Ga0501032_0321107_217_873 218
41 3300049571 Ga0501034_0184978 Ga0501034_0184978_732_1388 218
42 3300049573 Ga0501037_0275215 Ga0501037_0275215_460_1116 218
43 3300049580 Ga0501046_0068216 Ga0501046_0068216_251_907 218
44 3300049581 Ga0501047_0070399 Ga0501047_0070399_1033_1689 218
45 3300049589 Ga0501073_0224316 Ga0501073_0224316_348_1004 218
46 3300049742 Ga0501080_0200498 Ga0501080_0200498_741_1397 218
47 3300049822 Ga0501035_0297215 Ga0501035_0297215_85_741 218
48 3300049823 Ga0501044_0234701 Ga0501044_0234701_1032_1688 218
49 3300050493 nmdc:mga0k408_2216_c1 nmdc:mga0k408_2216_c1_7374_8033 218
50 3300053088 Ga0500644_0019120 Ga0500644_0019120_579_1238 218
51 3300053153 Ga0500616_0026615 Ga0500616_0026615_1404_2063 218
52 3300005344 Ga0070661_100016478 Ga0070661_1000164785 219
53 3300005366 Ga0070659_100000701 Ga0070659_10000070119 219
54 3300005563 Ga0068855_100146187 Ga0068855_1001461873 219
55 3300005563 Ga0068855_100218162 Ga0068855_1002181622 219
56 3300005564 Ga0070664_100161571 Ga0070664_1001615712 219
57 3300006038 Ga0075365_10003019 Ga0075365_100030194 219
58 3300006048 Ga0075363_100130647 Ga0075363_1001306471 219
59 3300006178 Ga0075367_10106443 Ga0075367_101064432 219
60 3300006195 Ga0075366_10159740 Ga0075366_101597401 219
61 3300025920 Ga0207649_10000359 Ga0207649_1000035931 219
62 3300025932 Ga0207690_10032846 Ga0207690_100328464 219
63 3300025945 Ga0207679_10000047 Ga0207679_1000004733 219
64 3300025949 Ga0207667_10117327 Ga0207667_101173272 219
65 3300025949 Ga0207667_10298523 Ga0207667_102985232 219
66 3300027665 Ga0209983_1013200 Ga0209983_10132003 219
67 3300028573 Ga0265334_10066645 Ga0265334_100666453 219
68 3300031235 Ga0265330_10000156 Ga0265330_1000015650 219
69 3300031238 Ga0265332_10000157 Ga0265332_1000015750 219
70 3300031241 Ga0265325_10021006 Ga0265325_100210063 219
71 3300031247 Ga0265340_10015374 Ga0265340_100153743 219
72 3300031548 Ga0307408_100220468 Ga0307408_1002204682 219
73 3300031711 Ga0265314_10000446 Ga0265314_100004463 219
74 3300037312 Ga0395899_0004638 Ga0395899_0004638_4050_4709 219
75 3300037418 Ga0395900_0012897 Ga0395900_0012897_1201_1860 219
76 3300037466 Ga0395898_0005633 Ga0395898_0005633_8506_9165 219
77 3300037471 Ga0395905_0002746 Ga0395905_0002746_11349_12008 219
78 3300037471 Ga0395905_0017113 Ga0395905_0017113_5559_6218 219
79 3300037471 Ga0395905_0018289 Ga0395905_0018289_4492_5151 219
80 3300037471 Ga0395905_0069778 Ga0395905_0069778_2176_2835 219
81 3300037471 Ga0395905_0149744 Ga0395905_0149744_572_1231 219
82 3300038443 Ga0395901_0009542 Ga0395901_0009542_8737_9396 219
83 3300038443 Ga0395901_0041547 Ga0395901_0041547_1014_1673 219
84 3300038443 Ga0395901_0045083 Ga0395901_0045083_2103_2762 219
85 3300038443 Ga0395901_0155009 Ga0395901_0155009_28_687 219
86 3300038443 Ga0395901_0514210 Ga0395901_0514210_426_1085 219
87 3300045051 Ga0451576_0505808 Ga0451576_0505808_498_1160 219
88 3300050494 nmdc:mga06z11_58368_c1 nmdc:mga06z11_58368_c1_924_1586 219
89 iso_pu_bacteria 2643221609 2644059724 219
90 iso_pu_bacteria 2643221611 2644074867 219
91 iso_pu_bacteria 2738543012 2739241252 219
92 iso_pu_bacteria 2816332133 2816473418 219
93 3300005530 Ga0070679_100037946 Ga0070679_1000379462 220
94 3300005563 Ga0068855_100080777 Ga0068855_1000807775 220
95 3300006177 Ga0075362_10053350 Ga0075362_100533502 220
96 3300009093 Ga0105240_10010605 Ga0105240_100106059 220
97 3300025909 Ga0207705_10130173 Ga0207705_101301732 220
98 3300025913 Ga0207695_10120694 Ga0207695_101206942 220
99 3300025924 Ga0207694_10050861 Ga0207694_100508611 220
100 3300025949 Ga0207667_10084903 Ga0207667_100849033 220
101 3300031456 Ga0307513_10000008 Ga0307513_10000008375 220
102 3300031901 Ga0307406_10045841 Ga0307406_100458412 220
103 3300037466 Ga0395898_0294563 Ga0395898_0294563_139_801 220
104 3300041451 Ga0451791_0888984 Ga0451791_0888984_219_884 220
105 3300044656 Ga0466969_0055709 Ga0466969_0055709_479_1144 220
106 3300044719 Ga0466971_0324957 Ga0466971_0324957_65_730 220
107 3300045836 Ga0466958_0040835 Ga0466958_0040835_1210_1875 220
108 iso_pu_bacteria 2547132374 2548499931 220
109 iso_pu_bacteria 2643221570 2643868162 220
110 iso_pu_bacteria 2643221596 2643993843 220
111 iso_pu_bacteria 2643221652 2644293769 220
112 iso_pu_bacteria 2643221717 2644644751 220
113 3300003792 Ga0055540_1007484 Ga0055540_10074842 221
114 3300003794 Ga0055531_10001947 Ga0055531_100019479 221
115 3300005295 Ga0065707_10219479 Ga0065707_102194791 221
116 3300005327 Ga0070658_10385296 Ga0070658_103852962 221
117 3300005338 Ga0068868_100022563 Ga0068868_1000225632 221
118 3300005366 Ga0070659_100422804 Ga0070659_1004228042 221
119 3300005530 Ga0070679_100130878 Ga0070679_1001308782 221
120 3300005539 Ga0068853_100123172 Ga0068853_1001231722 221
121 3300005563 Ga0068855_100341504 Ga0068855_1003415041 221
122 3300005563 Ga0068855_100605462 Ga0068855_1006054622 221
123 3300005844 Ga0068862_100891244 Ga0068862_1008912442 221
124 3300006178 Ga0075367_10137370 Ga0075367_101373702 221
125 3300006195 Ga0075366_10344885 Ga0075366_103448852 221
126 3300006881 Ga0068865_100813170 Ga0068865_1008131702 221
127 3300009098 Ga0105245_10007033 Ga0105245_1000703311 221
128 3300009174 Ga0105241_10043787 Ga0105241_100437873 221
129 3300009176 Ga0105242_10001240 Ga0105242_100012406 221
130 3300009177 Ga0105248_11713160 Ga0105248_117131601 221
131 3300014969 Ga0157376_10678313 Ga0157376_106783132 221
132 3300017792 Ga0163161_10147941 Ga0163161_101479413 221
133 3300025273 Ga0209673_1010989 Ga0209673_10109893 221
134 3300025273 Ga0209673_1019971 Ga0209673_10199712 221
135 3300025303 Ga0209051_1000244 Ga0209051_10002443 221
136 3300025304 Ga0209257_1000144 Ga0209257_1000144176 221
137 3300025909 Ga0207705_10391568 Ga0207705_103915682 221
138 3300025923 Ga0207681_10020033 Ga0207681_100200334 221
139 3300025927 Ga0207687_10009343 Ga0207687_100093439 221
140 3300025934 Ga0207686_10170537 Ga0207686_101705372 221
141 3300025942 Ga0207689_10062357 Ga0207689_100623573 221
142 3300026041 Ga0207639_10213738 Ga0207639_102137382 221
143 3300027614 Ga0209970_1036305 Ga0209970_10363052 221
144 3300027876 Ga0209974_10010746 Ga0209974_100107463 221
145 3300031548 Ga0307408_100000663 Ga0307408_10000066330 221
146 3300031548 Ga0307408_100304765 Ga0307408_1003047652 221
147 3300031548 Ga0307408_101038196 Ga0307408_1010381961 221
148 3300031711 Ga0265314_10045617 Ga0265314_100456174 221
149 3300031901 Ga0307406_10001789 Ga0307406_1000178913 221
150 3300037312 Ga0395899_0006125 Ga0395899_0006125_5047_5715 221
151 3300037312 Ga0395899_0267480 Ga0395899_0267480_70_738 221
152 3300037418 Ga0395900_0085292 Ga0395900_0085292_1790_2458 221
153 3300037418 Ga0395900_0101668 Ga0395900_0101668_476_1144 221
154 3300037418 Ga0395900_0176063 Ga0395900_0176063_645_1313 221
155 3300037418 Ga0395900_0244757 Ga0395900_0244757_338_1006 221
156 3300037466 Ga0395898_0002457 Ga0395898_0002457_1775_2443 221
157 3300037466 Ga0395898_0276239 Ga0395898_0276239_607_1275 221
158 3300037471 Ga0395905_0000407 Ga0395905_0000407_58151_58819 221
159 3300037471 Ga0395905_0027743 Ga0395905_0027743_3962_4672 221
160 3300037471 Ga0395905_0036247 Ga0395905_0036247_3244_3912 221
161 3300037471 Ga0395905_0036262 Ga0395905_0036262_498_1166 221
162 3300037471 Ga0395905_0068098 Ga0395905_0068098_1810_2478 221
163 3300037471 Ga0395905_0131357 Ga0395905_0131357_46_717 221
164 3300037471 Ga0395905_0911056 Ga0395905_0911056_80_748 221
165 3300038443 Ga0395901_0044556 Ga0395901_0044556_2363_3031 221
166 3300038443 Ga0395901_0101009 Ga0395901_0101009_1992_2660 221
167 3300038443 Ga0395901_0111590 Ga0395901_0111590_702_1370 221
168 3300038443 Ga0395901_0209311 Ga0395901_0209311_516_1184 221
169 3300038443 Ga0395901_0472748 Ga0395901_0472748_259_927 221
170 3300039447 Ga0436361_0508128 Ga0436361_0508128_3072_3746 221
171 3300041406 Ga0439439_0062265 Ga0439439_0062265_202_870 221
172 3300042007 Ga0439449_0000371 Ga0439449_0000371_14070_14738 221
173 3300042014 Ga0439457_039530 Ga0439457_039530_88_756 221
174 3300042127 Ga0450890_002976 Ga0450890_002976_311_979 221
175 3300042142 Ga0450905_037235 Ga0450905_037235_11_679 221
176 3300042157 Ga0439458_0031130 Ga0439458_0031130_505_1173 221
177 3300042439 Ga0439464_0004251 Ga0439464_0004251_1382_2050 221
178 3300042876 Ga0451577_0000641 Ga0451577_0000641_13416_14084 221
179 3300044658 Ga0466972_0288003 Ga0466972_0288003_27_695 221
180 3300044673 Ga0453683_0003564 Ga0453683_0003564_3827_4495 221
181 3300044673 Ga0453683_0378384 Ga0453683_0378384_179_847 221
182 3300044683 Ga0466965_0372216 Ga0466965_0372216_40_708 221
183 3300044684 Ga0466966_0045144 Ga0466966_0045144_129_797 221
184 3300044693 Ga0466961_0031308 Ga0466961_0031308_2065_2733 221
185 3300044694 Ga0466963_0666137 Ga0466963_0666137_14_682 221
186 3300044712 Ga0453684_0001818 Ga0453684_0001818_42085_42753 221
187 3300044712 Ga0453684_0888524 Ga0453684_0888524_151_816 221
188 3300044712 Ga0453684_1068382 Ga0453684_1068382_16_684 221
189 3300044765 Ga0466970_0122679 Ga0466970_0122679_598_1266 221
190 3300044901 Ga0466960_0269223 Ga0466960_0269223_208_876 221
191 3300045049 Ga0466959_0013433 Ga0466959_0013433_3275_3943 221
192 3300045049 Ga0466959_0219830 Ga0466959_0219830_252_920 221
193 3300045051 Ga0451576_0002104 Ga0451576_0002104_27925_28593 221
194 3300045051 Ga0451576_0016175 Ga0451576_0016175_7273_7941 221
195 3300046525 Ga0495663_0006855 Ga0495663_0006855_654_1322 221
196 3300046528 Ga0495642_0162925 Ga0495642_0162925_52_720 221
197 3300046539 Ga0495621_0029738 Ga0495621_0029738_295_963 221
198 3300046542 Ga0495597_0000110 Ga0495597_0000110_28606_29274 221
199 3300046615 Ga0495656_0015025 Ga0495656_0015025_810_1478 221
200 3300046616 Ga0495668_0291204 Ga0495668_0291204_117_785 221
201 3300046674 Ga0495588_0098654 Ga0495588_0098654_48_716 221
202 3300046684 Ga0495669_0040560 Ga0495669_0040560_1133_1801 221
203 3300048908 Ga0496105_0437437 Ga0496105_0437437_262_930 221
204 3300048911 Ga0496108_0240179 Ga0496108_0240179_801_1469 221
205 3300048925 Ga0496122_0000998 Ga0496122_0000998_47323_47991 221
206 3300048926 Ga0496123_0000045 Ga0496123_0000045_47261_47929 221
207 3300048927 Ga0496124_0050300 Ga0496124_0050300_2511_3179 221
208 3300048929 Ga0496126_0429259 Ga0496126_0429259_66_734 221
209 3300049569 Ga0501032_0180394 Ga0501032_0180394_373_1041 221
210 3300049573 Ga0501037_0057380 Ga0501037_0057380_1652_2320 221
211 3300049679 Ga0501249_031022 Ga0501249_031022_352_1020 221
212 3300049822 Ga0501035_0188096 Ga0501035_0188096_53_721 221
213 3300049823 Ga0501044_0339830 Ga0501044_0339830_442_1110 221
214 3300053090 Ga0500646_0035865 Ga0500646_0035865_258_926 221
215 3300059424 Ga0590075_012460 Ga0590075_012460_47_712 221
216 3300059424 Ga0590075_033855 Ga0590075_033855_293_964 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

12

176

0.95

PF13242

Hydrolase_like

HAD-hyrolase-like

130

201

0.92

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

9

170

0.84

PF12710

HAD

haloacid dehalogenase-like hydrolase

12

167

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6j-assembly1.cif.gz_A crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis 0.9162 8 213
4ex7-assembly1.cif.gz_A crystal structure of the alnumycin p phosphatase in complex with free phosphate 0.9008 9 220
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.8966 9 221
3d6j-assembly1.cif.gz_A crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis 0.8958 8 213
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.8935 5 219
ID Description Score Start End Superfamily
3d6jA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.94 91 213 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9233 90 203 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9217 11 220 3.40.50.1000
af_D7SFJ0_151_278_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9195 96 211 3.40.50.1000
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.918 92 185 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A4Q5V4N8-F1-model_v4 deleted 0.9991 19 221
AF-A0A7C9PGW6-F1-model_v4 HAD-IA family hydrolase 0.9954 5 221 GO:0005829
GO:0006281
GO:0008967
AF-A0A4Q5V4N8-F1-model_v4 deleted 0.9942 19 221
AF-A0A1F4KAC7-F1-model_v4 HAD family hydrolase 0.9915 1 221 GO:0005829
GO:0006281
GO:0008967
AF-A0A7C9PGW6-F1-model_v4 HAD-IA family hydrolase 0.9908 5 221 GO:0005829
GO:0006281
GO:0008967

Feature Viewer

pLDDT pTM Quality
90.86 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map