F327487

General Info

Members Datasets Scaffolds Average Seq Length
216 172 432 125

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100022516|Ga0075434_1000225165
Length 143
Sequence MSASNGHNGARVVQTEIEFSLPCGFIDGDGTLHRDGTMRRATAADEILPLRDPRVQANPAYLVVILLSRVVTRLGGVDPITPKTIENLFASDLAYLQDLYNQLNGPDAGRAPLRCPECRHEFTPEVVAPGGSFATPPTSSWGR

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 1.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 4.63
Rhizosphere 91.67
Stem 0
Stem Tuber 0
Unclassified 18.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100022516 3300006871 Bacteria 6136
2 rootH1_10004905 3300003323 Bacteria 1764
3 rootH1_10159009 3300003323 Bacteria 4120
4 Ga0065704_10567193 3300005289 Unclassified 625
5 Ga0065707_10309782 3300005295 Unclassified 987
6 Ga0070683_100057570 3300005329 Unclassified 3611
7 Ga0070690_100113862 3300005330 Unclassified 1808
8 Ga0070670_100070840 3300005331 Bacteria 2993
9 Ga0070666_10613321 3300005335 Unclassified 794
10 Ga0068868_100833579 3300005338 Bacteria 834
11 Ga0070661_100926013 3300005344 Bacteria 720
12 Ga0070668_100213052 3300005347 Bacteria 1590
13 Ga0070668_100232741 3300005347 Bacteria 1524
14 Ga0070668_100672651 3300005347 Bacteria 911
15 Ga0070668_101556061 3300005347 Bacteria 605
16 Ga0070675_100159435 3300005354 Bacteria 1939
17 Ga0070688_100710077 3300005365 Bacteria 779
18 Ga0070703_10034299 3300005406 Bacteria 1548
19 Ga0070714_100535166 3300005435 Bacteria 1120
20 Ga0070705_100031058 3300005440 Unclassified 2954
21 Ga0070700_101097145 3300005441 Bacteria 659
22 Ga0070694_101524154 3300005444 Bacteria 566
23 Ga0070678_101005883 3300005456 Bacteria 766
24 Ga0070684_100002519 3300005535 Bacteria 13508
25 Ga0070697_101848586 3300005536 Unclassified 540
26 Ga0070672_100043810 3300005543 Bacteria 3454
27 Ga0070665_102067991 3300005548 Bacteria 574
28 Ga0068855_100024454 3300005563 Bacteria 7226
29 Ga0068855_101758364 3300005563 Bacteria 631
30 Ga0068859_100415669 3300005617 Bacteria 1441
31 Ga0068864_100094854 3300005618 Unclassified 2638
32 Ga0068870_10455117 3300005840 Bacteria 844
33 Ga0068863_101083078 3300005841 Bacteria 806
34 Ga0068860_100112206 3300005843 Bacteria 2607
35 Ga0068862_100006577 3300005844 Bacteria 9638
36 Ga0081455_10028160 3300005937 Bacteria 5136
37 Ga0081455_10103419 3300005937 Bacteria 2281
38 Ga0081539_10076691 3300005985 Bacteria 1770
39 Ga0070717_11974750 3300006028 Bacteria 526
40 Ga0097621_100036162 3300006237 Bacteria 3950
41 Ga0068871_100045249 3300006358 Bacteria 3542
42 Ga0075428_100011819 3300006844 Bacteria 9716
43 Ga0075428_100013634 3300006844 Bacteria 9051
44 Ga0075428_101177203 3300006844 Unclassified 808
45 Ga0075430_100013300 3300006846 Bacteria 7016
46 Ga0075430_100187493 3300006846 Bacteria 1720
47 Ga0075431_100011507 3300006847 Bacteria 8921
48 Ga0075433_10013351 3300006852 Bacteria 6674
49 Ga0075433_10495123 3300006852 Bacteria 1076
50 Ga0075433_10775503 3300006852 Unclassified 838
51 Ga0075434_100007373 3300006871 Bacteria 10182
52 Ga0075429_100024201 3300006880 Bacteria 5267
53 Ga0075429_100361847 3300006880 Unclassified 1270
54 Ga0068865_100441261 3300006881 Unclassified 1074
55 Ga0097620_100415682 3300006931 Bacteria 1441
56 Ga0075435_101090861 3300007076 Unclassified 698
57 Ga0105240_10042526 3300009093 Bacteria 5789
58 Ga0111539_10980720 3300009094 Bacteria 982
59 Ga0111539_13357880 3300009094 Unclassified 515
60 Ga0114129_10009949 3300009147 Bacteria 13556
61 Ga0114129_10170884 3300009147 Bacteria 2963
62 Ga0114129_11125008 3300009147 Bacteria 982
63 Ga0114129_12608516 3300009147 Unclassified 603
64 Ga0105248_10906306 3300009177 Unclassified 995
65 Ga0105248_10977832 3300009177 Unclassified 956
66 Ga0105249_11905596 3300009553 Bacteria 667
67 Ga0105239_10015057 3300010375 Bacteria 8574
68 Ga0105239_12348641 3300010375 Unclassified 621
69 Ga0157378_10122435 3300013297 Bacteria 2399
70 Ga0157378_11778827 3300013297 Bacteria 664
71 Ga0157378_13137850 3300013297 Unclassified 513
72 Ga0157375_13516172 3300013308 Unclassified 521
73 Ga0163163_10126779 3300014325 Unclassified 2591
74 Ga0163163_10639004 3300014325 Bacteria 1128
75 Ga0163163_10944386 3300014325 Bacteria 926
76 Ga0157379_11619032 3300014968 Unclassified 632
77 Ga0157376_10000132 3300014969 Bacteria 51733
78 Ga0213872_10153958 3300021361 Bacteria 1003
79 Ga0213875_10294562 3300021388 Bacteria 767
80 Ga0207680_10675975 3300025903 Unclassified 740
81 Ga0207684_11151795 3300025910 Bacteria 644
82 Ga0207695_10246516 3300025913 Bacteria 1686
83 Ga0207650_10881625 3300025925 Unclassified 760
84 Ga0207659_10282837 3300025926 Bacteria 1357
85 Ga0207644_10077219 3300025931 Bacteria 2452
86 Ga0207704_10624009 3300025938 Bacteria 885
87 Ga0207711_10843100 3300025941 Unclassified 853
88 Ga0207689_11714374 3300025942 Bacteria 520
89 Ga0207661_10039211 3300025944 Unclassified 3717
90 Ga0207667_10023807 3300025949 Bacteria 6739
91 Ga0207668_11181331 3300025972 Bacteria 687
92 Ga0207677_10754662 3300026023 Bacteria 867
93 Ga0207702_11150569 3300026078 Bacteria 770
94 Ga0207641_10178795 3300026088 Bacteria 1942
95 Ga0207641_10215237 3300026088 Bacteria 1779
96 Ga0268265_10328482 3300028380 Bacteria 1388
97 Ga0268264_10277492 3300028381 Bacteria 1568
98 Ga0265336_10014790 3300028666 Bacteria 2580
99 Ga0265338_10089231 3300028800 Bacteria 2555
100 Ga0265332_10047949 3300031238 Unclassified 1838
101 Ga0265320_10089883 3300031240 Bacteria 1423
102 Ga0265325_10473188 3300031241 Bacteria 544
103 Ga0265329_10020818 3300031242 Bacteria 2211
104 Ga0265339_10017577 3300031249 Bacteria 4231
105 Ga0265331_10350202 3300031250 Bacteria 662
106 Ga0265316_10051954 3300031344 Bacteria 3217
107 Ga0307513_10777136 3300031456 Bacteria 663
108 Ga0265313_10229930 3300031595 Bacteria 762
109 Ga0316579_10461683 3300031691 Unclassified 614
110 Ga0265314_10130873 3300031711 Bacteria 1565
111 Ga0265342_10079352 3300031712 Bacteria 1898
112 Ga0307407_10692731 3300031903 Bacteria 767
113 Ga0373928_0106840 3300035084 Bacteria 736
114 Ga0373934_0115275 3300035086 Unclassified 1091
115 Ga0373934_0243868 3300035086 Bacteria 742
116 Ga0373953_0129520 3300035117 Bacteria 1075
117 Ga0373954_0054630 3300035118 Unclassified 1878
118 Ga0373956_0260065 3300035119 Bacteria 825
119 Ga0373931_0069022 3300035691 Bacteria 1925
120 Ga0373933_0248017 3300035724 Bacteria 1146
121 Ga0373947_0135907 3300035725 Bacteria 1573
122 Ga0373937_0008844 3300036401 Bacteria 8738
123 Ga0316582_0004489 3300036647 Bacteria 7068
124 Ga0316584_0430572 3300036712 Bacteria 936
125 Ga0395899_0566300 3300037312 Bacteria 728
126 Ga0395900_0100929 3300037418 Bacteria 2964
127 Ga0395900_0464838 3300037418 Bacteria 1219
128 Ga0395898_0072369 3300037466 Bacteria 3330
129 Ga0395905_0015601 3300037471 Bacteria 7218
130 Ga0395905_0206466 3300037471 Bacteria 1841
131 Ga0395905_0344441 3300037471 Bacteria 1382
132 Ga0436364_0659496 3300037853 Bacteria 2774
133 Ga0395901_0016788 3300038443 Bacteria 7460
134 Ga0395901_0074032 3300038443 Bacteria 3553
135 Ga0436361_0023261 3300039447 Bacteria 1014
136 Ga0436361_1039187 3300039447 Bacteria 2456
137 Ga0466969_0011996 3300044656 Bacteria 4580
138 Ga0466972_0016305 3300044658 Bacteria 3713
139 Ga0453683_0006915 3300044673 Bacteria 7736
140 Ga0466965_0001038 3300044683 Bacteria 10762
141 Ga0466965_0014301 3300044683 Bacteria 3754
142 Ga0466966_0049045 3300044684 Bacteria 2689
143 Ga0466961_0016628 3300044693 Bacteria 4730
144 Ga0466963_0065396 3300044694 Bacteria 2438
145 Ga0466963_0822419 3300044694 Bacteria 655
146 Ga0466964_0012140 3300044706 Bacteria 3257
147 Ga0466971_0002683 3300044719 Bacteria 7519
148 Ga0466968_0000274 3300044735 Bacteria 16425
149 Ga0466968_0047167 3300044735 Bacteria 1831
150 Ga0466968_0269180 3300044735 Bacteria 813
151 Ga0466957_0031743 3300044842 Bacteria 3158
152 Ga0466960_0005990 3300044901 Bacteria 4854
153 Ga0466959_0000741 3300045049 Bacteria 19082
154 Ga0451576_0508702 3300045051 Bacteria 1265
155 Ga0466958_0013896 3300045836 Bacteria 4592
156 Ga0466967_0076066 3300045976 Bacteria 3019
157 Ga0466967_0649770 3300045976 Bacteria 1043
158 Ga0495585_0035236 3300046492 Bacteria 2830
159 Ga0495631_0506963 3300046518 Bacteria 514
160 Ga0495587_0149677 3300046536 Bacteria 1330
161 Ga0495599_0244360 3300046678 Unclassified 1094
162 Ga0495623_0484846 3300046679 Unclassified 654
163 Ga0495670_0081491 3300046691 Bacteria 1649
164 Ga0495589_0473109 3300046794 Bacteria 573
165 Ga0495684_0761401 3300047471 Unclassified 636
166 Ga0495602_0038886 3300048088 Bacteria 4390
167 Ga0496104_0034507 3300048907 Bacteria 4718
168 Ga0496105_0005670 3300048908 Bacteria 9501
169 Ga0496109_0000063 3300048912 Bacteria 112773
170 Ga0496109_0069868 3300048912 Unclassified 3222
171 Ga0496112_0000811 3300048915 Bacteria 22087
172 Ga0496114_0053232 3300048917 Bacteria 3374
173 Ga0496114_1030513 3300048917 Bacteria 707
174 Ga0496114_1537160 3300048917 Unclassified 553
175 Ga0496115_0006206 3300048918 Bacteria 8741
176 Ga0496115_0015624 3300048918 Bacteria 5763
177 Ga0496121_0011446 3300048924 Bacteria 9849
178 Ga0496126_0046799 3300048929 Unclassified 3964
179 Ga0501031_0635937 3300049568 Bacteria 686
180 Ga0501036_0043786 3300049572 Bacteria 3791
181 Ga0501038_0044390 3300049574 Bacteria 3862
182 Ga0501039_0008791 3300049575 Bacteria 7695
183 Ga0501040_0035273 3300049576 Bacteria 3392
184 Ga0501041_0053999 3300049577 Bacteria 2451
185 Ga0501048_0155409 3300049582 Bacteria 1618
186 Ga0501071_0031958 3300049587 Bacteria 3735
187 Ga0501071_0407216 3300049587 Bacteria 1039
188 Ga0501072_0010043 3300049588 Bacteria 7203
189 Ga0501074_0145457 3300049590 Bacteria 1695
190 Ga0501075_0000265 3300049591 Bacteria 28570
191 Ga0501076_0000132 3300049592 Bacteria 41750
192 Ga0501079_0089216 3300049741 Bacteria 2388
193 Ga0501080_0037311 3300049742 Bacteria 4538
194 Ga0501081_0008717 3300049743 Bacteria 6592
195 Ga0501083_0072378 3300049744 Bacteria 2292
196 Ga0501045_0231525 3300049824 Bacteria 1375
197 nmdc:mga0k408_116050_c1 3300050493 Bacteria 1584
198 nmdc:mga05p37_1561_c1 3300050507 Bacteria 26611
199 nmdc:mga05p37_83764_c1 3300050507 Bacteria 2716
200 nmdc:mga09592_12285_c1 3300050508 Bacteria 6972
201 nmdc:mga09592_342113_c1 3300050508 Unclassified 1295
202 nmdc:mga0qj67_202283_c1 3300050509 Bacteria 1613
203 nmdc:mga0qj67_31318_c1 3300050509 Unclassified 4143
204 nmdc:mga06r32_125515_c1 3300050510 Bacteria 2535
205 nmdc:mga08y16_960682_c1 3300050511 Bacteria 837
206 nmdc:mga0n895_1272_c1 3300050512 Bacteria 18627
207 nmdc:mga0n895_9128_c1 3300050512 Bacteria 8656
208 nmdc:mga0rr50_492088_c1 3300050513 Bacteria 1042
209 nmdc:mga0a205_14123_c1 3300050515 Bacteria 7452
210 Ga0501084_0003024 3300054114 Bacteria 13623
211 Ga0587094_043405 3300059513 Unclassified 740
212 Ga0587076_078853 3300059645 Bacteria 699
213 Ga0587111_0002766 3300060346 Unclassified 2396
214 Ga0501082_0003636 3300060353 Bacteria 13469
215 Ga0466962_0008341 3300061719 Bacteria 4965
216 Ga0530510_0000011 3300061734 Bacteria 125603
217 Ga0075434_100022516
218 rootH1_10004905
219 rootH1_10159009
220 Ga0065704_10567193
221 Ga0065707_10309782
222 Ga0070683_100057570
223 Ga0070690_100113862
224 Ga0070670_100070840
225 Ga0070666_10613321
226 Ga0068868_100833579
227 Ga0070661_100926013
228 Ga0070668_100213052
229 Ga0070668_100232741
230 Ga0070668_100672651
231 Ga0070668_101556061
232 Ga0070675_100159435
233 Ga0070688_100710077
234 Ga0070703_10034299
235 Ga0070714_100535166
236 Ga0070705_100031058
237 Ga0070700_101097145
238 Ga0070694_101524154
239 Ga0070678_101005883
240 Ga0070684_100002519
241 Ga0070697_101848586
242 Ga0070672_100043810
243 Ga0070665_102067991
244 Ga0068855_100024454
245 Ga0068855_101758364
246 Ga0068859_100415669
247 Ga0068864_100094854
248 Ga0068870_10455117
249 Ga0068863_101083078
250 Ga0068860_100112206
251 Ga0068862_100006577
252 Ga0081455_10028160
253 Ga0081455_10103419
254 Ga0081539_10076691
255 Ga0070717_11974750
256 Ga0097621_100036162
257 Ga0068871_100045249
258 Ga0075428_100011819
259 Ga0075428_100013634
260 Ga0075428_101177203
261 Ga0075430_100013300
262 Ga0075430_100187493
263 Ga0075431_100011507
264 Ga0075433_10013351
265 Ga0075433_10495123
266 Ga0075433_10775503
267 Ga0075434_100007373
268 Ga0075429_100024201
269 Ga0075429_100361847
270 Ga0068865_100441261
271 Ga0097620_100415682
272 Ga0075435_101090861
273 Ga0105240_10042526
274 Ga0111539_10980720
275 Ga0111539_13357880
276 Ga0114129_10009949
277 Ga0114129_10170884
278 Ga0114129_11125008
279 Ga0114129_12608516
280 Ga0105248_10906306
281 Ga0105248_10977832
282 Ga0105249_11905596
283 Ga0105239_10015057
284 Ga0105239_12348641
285 Ga0157378_10122435
286 Ga0157378_11778827
287 Ga0157378_13137850
288 Ga0157375_13516172
289 Ga0163163_10126779
290 Ga0163163_10639004
291 Ga0163163_10944386
292 Ga0157379_11619032
293 Ga0157376_10000132
294 Ga0213872_10153958
295 Ga0213875_10294562
296 Ga0207680_10675975
297 Ga0207684_11151795
298 Ga0207695_10246516
299 Ga0207650_10881625
300 Ga0207659_10282837
301 Ga0207644_10077219
302 Ga0207704_10624009
303 Ga0207711_10843100
304 Ga0207689_11714374
305 Ga0207661_10039211
306 Ga0207667_10023807
307 Ga0207668_11181331
308 Ga0207677_10754662
309 Ga0207702_11150569
310 Ga0207641_10178795
311 Ga0207641_10215237
312 Ga0268265_10328482
313 Ga0268264_10277492
314 Ga0265336_10014790
315 Ga0265338_10089231
316 Ga0265332_10047949
317 Ga0265320_10089883
318 Ga0265325_10473188
319 Ga0265329_10020818
320 Ga0265339_10017577
321 Ga0265331_10350202
322 Ga0265316_10051954
323 Ga0307513_10777136
324 Ga0265313_10229930
325 Ga0316579_10461683
326 Ga0265314_10130873
327 Ga0265342_10079352
328 Ga0307407_10692731
329 Ga0373928_0106840
330 Ga0373934_0115275
331 Ga0373934_0243868
332 Ga0373953_0129520
333 Ga0373954_0054630
334 Ga0373956_0260065
335 Ga0373931_0069022
336 Ga0373933_0248017
337 Ga0373947_0135907
338 Ga0373937_0008844
339 Ga0316582_0004489
340 Ga0316584_0430572
341 Ga0395899_0566300
342 Ga0395900_0100929
343 Ga0395900_0464838
344 Ga0395898_0072369
345 Ga0395905_0015601
346 Ga0395905_0206466
347 Ga0395905_0344441
348 Ga0436364_0659496
349 Ga0395901_0016788
350 Ga0395901_0074032
351 Ga0436361_0023261
352 Ga0436361_1039187
353 Ga0466969_0011996
354 Ga0466972_0016305
355 Ga0453683_0006915
356 Ga0466965_0001038
357 Ga0466965_0014301
358 Ga0466966_0049045
359 Ga0466961_0016628
360 Ga0466963_0065396
361 Ga0466963_0822419
362 Ga0466964_0012140
363 Ga0466971_0002683
364 Ga0466968_0000274
365 Ga0466968_0047167
366 Ga0466968_0269180
367 Ga0466957_0031743
368 Ga0466960_0005990
369 Ga0466959_0000741
370 Ga0451576_0508702
371 Ga0466958_0013896
372 Ga0466967_0076066
373 Ga0466967_0649770
374 Ga0495585_0035236
375 Ga0495631_0506963
376 Ga0495587_0149677
377 Ga0495599_0244360
378 Ga0495623_0484846
379 Ga0495670_0081491
380 Ga0495589_0473109
381 Ga0495684_0761401
382 Ga0495602_0038886
383 Ga0496104_0034507
384 Ga0496105_0005670
385 Ga0496109_0000063
386 Ga0496109_0069868
387 Ga0496112_0000811
388 Ga0496114_0053232
389 Ga0496114_1030513
390 Ga0496114_1537160
391 Ga0496115_0006206
392 Ga0496115_0015624
393 Ga0496121_0011446
394 Ga0496126_0046799
395 Ga0501031_0635937
396 Ga0501036_0043786
397 Ga0501038_0044390
398 Ga0501039_0008791
399 Ga0501040_0035273
400 Ga0501041_0053999
401 Ga0501048_0155409
402 Ga0501071_0031958
403 Ga0501071_0407216
404 Ga0501072_0010043
405 Ga0501074_0145457
406 Ga0501075_0000265
407 Ga0501076_0000132
408 Ga0501079_0089216
409 Ga0501080_0037311
410 Ga0501081_0008717
411 Ga0501083_0072378
412 Ga0501045_0231525
413 nmdc:mga0k408_116050_c1
414 nmdc:mga05p37_1561_c1
415 nmdc:mga05p37_83764_c1
416 nmdc:mga09592_12285_c1
417 nmdc:mga09592_342113_c1
418 nmdc:mga0qj67_202283_c1
419 nmdc:mga0qj67_31318_c1
420 nmdc:mga06r32_125515_c1
421 nmdc:mga08y16_960682_c1
422 nmdc:mga0n895_1272_c1
423 nmdc:mga0n895_9128_c1
424 nmdc:mga0rr50_492088_c1
425 nmdc:mga0a205_14123_c1
426 Ga0501084_0003024
427 Ga0587094_043405
428 Ga0587076_078853
429 Ga0587111_0002766
430 Ga0501082_0003636
431 Ga0466962_0008341
432 Ga0530510_0000011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ir3-assembly1.cif.gz_J human nuclear pre-60s ribosomal particle - state b' 0.7012 3 28
8fl0-assembly1.cif.gz_NF human nucleolar pre-60s ribosomal subunit (state h) 0.6623 3 33
8pv1-assembly1.cif.gz_CK chaetomium thermophilum pre-60s state 6 - pre-5s rotation - l1 intermediate - composite structure 0.6186 3 33
8i9t-assembly1.cif.gz_CK cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-1 0.5884 3 33
8ipy-assembly1.cif.gz_J human nuclear pre-60s ribosomal particle - state d' 0.5785 1 33
ID Description Score Start End Superfamily
af_A4IC96_177_260_2.40.10.310 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.6193 3 34 2.40.10.310
3kluA01 Alpha Beta;2-Layer Sandwich;rbstp2171; 0.5748 4 93 3.30.2220.30
af_Q9W454_27_274_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.5187 1 41 2.40.10.10
2yt2A00 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5099 3 30 2.30.29.30
af_Q9VXC6_23_253_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.4927 1 39 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A3N4ZXH0-F1-model_v4 Tail assembly chaperone E/41/14-like protein 0.9987 4 93
AF-A0A0F5YNS6-F1-model_v4 Uncharacterized protein 0.9953 1 93
AF-A0A537YFX0-F1-model_v4 Phage tail assembly protein 0.9953 1 94
AF-A0A0V7ZM78-F1-model_v4 Phage tail protein 0.9943 1 93
AF-A0A6M0SGC7-F1-model_v4 Phage tail assembly protein 0.9929 1 93

Map