F324211
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 213 | 156 | 210 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300031691|Ga0316579_10054990|Ga0316579_100549902 |
| Length | 290 |
| Sequence | MKFNELPLNRLSEANFTADCRKRSIAGRAKPLQRMQRLLLVGVILGIGLSAVFLTPGNSTAAAPQTAAPFISIGMDQAQEPGKMAVVLQIFLLMTVLSLAPAILIMLTSFTRVVIVLSLLRRALGTMQMPPNQVIIGLALFLTFFIMTPVWQQVNQTALQPYLENKIEQQQALQKAAEPLRGFMFKQTREKDLALFVSIAKIERPKDVNDIPISVLIPSFIISEVKTAFQIGLLLYVPFLIIDMVVASVLLSMGMMMLPPIMISLPFKLMLFVLADGWNLLIGSLVRSFI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 3 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 4 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 74 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 75 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 76 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 80 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 81 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 82 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 83 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 84 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 85 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 86 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 87 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 88 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 89 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 90 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 91 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 92 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 93 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 94 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 98 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 100 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 101 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 102 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 103 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 104 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 106 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 107 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 108 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 109 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 110 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 111 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 112 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 113 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 127 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 128 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 129 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 132 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 133 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 134 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 135 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 136 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 137 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 138 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 139 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 140 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 141 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 142 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 143 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 153 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 154 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 155 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 156 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.65 |
| Metatranscriptomes | 0.94 |
| Isolates | 1.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.35 |
| Nodule | 0 |
| Rhizoplane | 6.57 |
| Rhizosphere | 78.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_259194 | 2162886007 | Bacteria | 1393 |
| 2 | JGI25406J46586_10020809 | 3300003203 | Bacteria | 2645 |
| 3 | rootH1_10025955 | 3300003323 | Bacteria | 25198 |
| 4 | Ga0065704_10071733 | 3300005289 | Bacteria | 10081 |
| 5 | Ga0070683_100005436 | 3300005329 | Bacteria | 10641 |
| 6 | Ga0070683_100042915 | 3300005329 | Bacteria | 4166 |
| 7 | Ga0070670_100402140 | 3300005331 | Bacteria | 1209 |
| 8 | Ga0068869_100007977 | 3300005334 | Bacteria | 6804 |
| 9 | Ga0070680_100000038 | 3300005336 | Bacteria | 66468 |
| 10 | Ga0070680_100003355 | 3300005336 | Bacteria | 11953 |
| 11 | Ga0068868_100014572 | 3300005338 | Bacteria | 5799 |
| 12 | Ga0070661_100095526 | 3300005344 | Bacteria | 2204 |
| 13 | Ga0070692_10042158 | 3300005345 | Bacteria | 2342 |
| 14 | Ga0070668_100083360 | 3300005347 | Bacteria | 2510 |
| 15 | Ga0070669_100078220 | 3300005353 | Bacteria | 2458 |
| 16 | Ga0070675_100012698 | 3300005354 | Bacteria | 6606 |
| 17 | Ga0070671_100003099 | 3300005355 | Bacteria | 12944 |
| 18 | Ga0070674_100007176 | 3300005356 | Bacteria | 6558 |
| 19 | Ga0070659_100015951 | 3300005366 | Bacteria | 5635 |
| 20 | Ga0070700_100002862 | 3300005441 | Bacteria | 8854 |
| 21 | Ga0070663_100030822 | 3300005455 | Bacteria | 3680 |
| 22 | Ga0070681_10000106 | 3300005458 | Bacteria | 62398 |
| 23 | Ga0070679_100000026 | 3300005530 | Bacteria | 115669 |
| 24 | Ga0070684_100005375 | 3300005535 | Bacteria | 9812 |
| 25 | Ga0068855_100041711 | 3300005563 | Bacteria | 5438 |
| 26 | Ga0070664_100001707 | 3300005564 | Bacteria | 17586 |
| 27 | Ga0068857_100039003 | 3300005577 | Bacteria | 4206 |
| 28 | Ga0068854_100112084 | 3300005578 | Bacteria | 2059 |
| 29 | Ga0070702_100093777 | 3300005615 | Bacteria | 1826 |
| 30 | Ga0068864_100217338 | 3300005618 | Bacteria | 1762 |
| 31 | Ga0068861_100337822 | 3300005719 | Bacteria | 1317 |
| 32 | Ga0068863_100474003 | 3300005841 | Bacteria | 1230 |
| 33 | Ga0068858_100032479 | 3300005842 | Bacteria | 4847 |
| 34 | Ga0068858_100365781 | 3300005842 | Bacteria | 1383 |
| 35 | Ga0068858_100462196 | 3300005842 | Bacteria | 1224 |
| 36 | Ga0081539_10001533 | 3300005985 | Bacteria | 38679 |
| 37 | Ga0081539_10025845 | 3300005985 | Bacteria | 3765 |
| 38 | Ga0075429_100249648 | 3300006880 | Bacteria | 1554 |
| 39 | Ga0075429_100427406 | 3300006880 | Bacteria | 1160 |
| 40 | Ga0068865_100237335 | 3300006881 | Bacteria | 1433 |
| 41 | Ga0105240_10028630 | 3300009093 | Bacteria | 7272 |
| 42 | Ga0105240_10628951 | 3300009093 | Bacteria | 1179 |
| 43 | Ga0111539_10000063 | 3300009094 | Bacteria | 108022 |
| 44 | Ga0111539_10056376 | 3300009094 | Bacteria | 4670 |
| 45 | Ga0111539_10233058 | 3300009094 | Bacteria | 2144 |
| 46 | Ga0105245_10289149 | 3300009098 | Bacteria | 1605 |
| 47 | Ga0105245_10427207 | 3300009098 | Bacteria | 1329 |
| 48 | Ga0105241_10141234 | 3300009174 | Bacteria | 1961 |
| 49 | Ga0105249_10006997 | 3300009553 | Bacteria | 9843 |
| 50 | Ga0105249_10262989 | 3300009553 | Bacteria | 1715 |
| 51 | Ga0105239_10423433 | 3300010375 | Bacteria | 1508 |
| 52 | Ga0157378_10186483 | 3300013297 | Bacteria | 1954 |
| 53 | Ga0163162_10581392 | 3300013306 | Bacteria | 1247 |
| 54 | Ga0163162_10679440 | 3300013306 | Bacteria | 1152 |
| 55 | Ga0163163_10281870 | 3300014325 | Bacteria | 1713 |
| 56 | Ga0157377_10211211 | 3300014745 | Bacteria | 1238 |
| 57 | Ga0163161_10207942 | 3300017792 | Bacteria | 1511 |
| 58 | Ga0207688_10075791 | 3300025901 | Bacteria | 1915 |
| 59 | Ga0207685_10009644 | 3300025905 | Bacteria | 2813 |
| 60 | Ga0207707_10000071 | 3300025912 | Bacteria | 102604 |
| 61 | Ga0207707_10014456 | 3300025912 | Bacteria | 6875 |
| 62 | Ga0207649_10035108 | 3300025920 | Bacteria | 3010 |
| 63 | Ga0207652_10000088 | 3300025921 | Bacteria | 99810 |
| 64 | Ga0207681_10192223 | 3300025923 | Bacteria | 1562 |
| 65 | Ga0207650_10202192 | 3300025925 | Bacteria | 1592 |
| 66 | Ga0207659_10125213 | 3300025926 | Bacteria | 1975 |
| 67 | Ga0207687_10185849 | 3300025927 | Bacteria | 1613 |
| 68 | Ga0207644_10042822 | 3300025931 | Bacteria | 3210 |
| 69 | Ga0207690_10027264 | 3300025932 | Bacteria | 3609 |
| 70 | Ga0207669_10002407 | 3300025937 | Bacteria | 7974 |
| 71 | Ga0207704_10134187 | 3300025938 | Bacteria | 1720 |
| 72 | Ga0207665_10245280 | 3300025939 | Bacteria | 1321 |
| 73 | Ga0207689_10008001 | 3300025942 | Bacteria | 9232 |
| 74 | Ga0207661_10036805 | 3300025944 | Bacteria | 3823 |
| 75 | Ga0207661_10038051 | 3300025944 | Bacteria | 3768 |
| 76 | Ga0207712_10161354 | 3300025961 | Bacteria | 1742 |
| 77 | Ga0207668_10146383 | 3300025972 | Bacteria | 1823 |
| 78 | Ga0207640_10081940 | 3300025981 | Bacteria | 2208 |
| 79 | Ga0207703_10022997 | 3300026035 | Bacteria | 4893 |
| 80 | Ga0207678_10047201 | 3300026067 | Bacteria | 3725 |
| 81 | Ga0207678_10240372 | 3300026067 | Bacteria | 1551 |
| 82 | Ga0207708_10005686 | 3300026075 | Bacteria | 9214 |
| 83 | Ga0207674_10032585 | 3300026116 | Bacteria | 5464 |
| 84 | Ga0207675_100377878 | 3300026118 | Bacteria | 1393 |
| 85 | Ga0207428_10014148 | 3300027907 | Bacteria | 6947 |
| 86 | Ga0207428_10040691 | 3300027907 | Bacteria | 3767 |
| 87 | Ga0265337_1006800 | 3300028556 | Bacteria | 4353 |
| 88 | Ga0307515_10035125 | 3300028794 | Bacteria | 8170 |
| 89 | Ga0307515_10072393 | 3300028794 | Bacteria | 4652 |
| 90 | Ga0265338_10028368 | 3300028800 | Bacteria | 5583 |
| 91 | Ga0265327_10000014 | 3300031251 | Bacteria | 506288 |
| 92 | Ga0265316_10111070 | 3300031344 | Bacteria | 2076 |
| 93 | Ga0307513_10315996 | 3300031456 | Bacteria | 1322 |
| 94 | Ga0307408_100041646 | 3300031548 | Bacteria | 3257 |
| 95 | Ga0316575_10000404 | 3300031665 | Bacteria | 12327 |
| 96 | Ga0316579_10002813 | 3300031691 | Bacteria | 6654 |
| 97 | Ga0316579_10054990 | 3300031691 | Bacteria | 1866 |
| 98 | Ga0316576_10058397 | 3300031727 | Bacteria | 2822 |
| 99 | Ga0316576_10209636 | 3300031727 | Bacteria | 1467 |
| 100 | Ga0316578_10000845 | 3300031728 | Bacteria | 11481 |
| 101 | Ga0316578_10110241 | 3300031728 | Bacteria | 1653 |
| 102 | Ga0316578_10367909 | 3300031728 | Bacteria | 854 |
| 103 | Ga0307516_10008946 | 3300031730 | Bacteria | 11226 |
| 104 | Ga0316577_10002099 | 3300031733 | Bacteria | 9738 |
| 105 | Ga0316577_10004288 | 3300031733 | Bacteria | 7344 |
| 106 | Ga0316577_10199467 | 3300031733 | Bacteria | 1131 |
| 107 | Ga0307410_10451085 | 3300031852 | Bacteria | 1049 |
| 108 | Ga0326468_10000452 | 3300031889 | Bacteria | 4374 |
| 109 | Ga0307409_100041268 | 3300031995 | Bacteria | 3444 |
| 110 | Ga0307411_10286439 | 3300032005 | Bacteria | 1314 |
| 111 | Ga0307415_100024163 | 3300032126 | Bacteria | 3789 |
| 112 | Ga0316583_10002075 | 3300032133 | Bacteria | 6875 |
| 113 | Ga0316585_10021794 | 3300032137 | Bacteria | 1968 |
| 114 | Ga0316593_10019870 | 3300032168 | Bacteria | 2080 |
| 115 | Ga0316596_1004048 | 3300033541 | Bacteria | 3256 |
| 116 | Ga0373940_0067185 | 3300035088 | Bacteria | 1037 |
| 117 | Ga0373951_0000219 | 3300035091 | Bacteria | 20040 |
| 118 | Ga0373932_0008458 | 3300035112 | Bacteria | 2461 |
| 119 | Ga0316574_0006957 | 3300035398 | Bacteria | 6159 |
| 120 | Ga0316574_0023650 | 3300035398 | Bacteria | 3670 |
| 121 | Ga0373931_0000019 | 3300035691 | Bacteria | 186534 |
| 122 | Ga0373927_0058400 | 3300035695 | Bacteria | 2495 |
| 123 | Ga0316582_0001828 | 3300036647 | Bacteria | 9622 |
| 124 | Ga0316582_0003881 | 3300036647 | Bacteria | 7443 |
| 125 | Ga0316582_0043788 | 3300036647 | Bacteria | 2810 |
| 126 | Ga0316582_0063545 | 3300036647 | Bacteria | 2373 |
| 127 | Ga0316582_0093384 | 3300036647 | Bacteria | 1984 |
| 128 | Ga0316582_0296328 | 3300036647 | Bacteria | 1111 |
| 129 | Ga0316582_0330887 | 3300036647 | Bacteria | 1048 |
| 130 | Ga0316584_0001619 | 3300036712 | Bacteria | 13720 |
| 131 | Ga0316584_0004501 | 3300036712 | Bacteria | 9225 |
| 132 | Ga0316584_0007872 | 3300036712 | Bacteria | 7312 |
| 133 | Ga0316584_0047224 | 3300036712 | Bacteria | 3216 |
| 134 | Ga0316584_0303289 | 3300036712 | Bacteria | 1156 |
| 135 | Ga0373925_0234286 | 3300037068 | Bacteria | 1469 |
| 136 | Ga0316581_0009241 | 3300037588 | Bacteria | 2706 |
| 137 | Ga0400485_07515 | 3300038735 | Bacteria | 3347 |
| 138 | Ga0400485_17202 | 3300038735 | Bacteria | 4078 |
| 139 | Ga0400488_51584 | 3300038741 | Bacteria | 2977 |
| 140 | Ga0400486_26096 | 3300038742 | Bacteria | 60268 |
| 141 | Ga0400486_28434 | 3300038742 | Bacteria | 18431 |
| 142 | Ga0400486_29396 | 3300038742 | Bacteria | 43599 |
| 143 | Ga0400483_021395 | 3300039062 | Bacteria | 114250 |
| 144 | Ga0400483_149839 | 3300039062 | Bacteria | 19167 |
| 145 | Ga0400483_269206 | 3300039062 | Bacteria | 85448 |
| 146 | Ga0400489_26427 | 3300039093 | Bacteria | 6761 |
| 147 | Ga0400489_35275 | 3300039093 | Bacteria | 72456 |
| 148 | Ga0453684_0016532 | 3300044712 | Bacteria | 11522 |
| 149 | Ga0453684_0256821 | 3300044712 | Bacteria | 2004 |
| 150 | Ga0453684_0273623 | 3300044712 | Bacteria | 1928 |
| 151 | Ga0453684_0289226 | 3300044712 | Bacteria | 1866 |
| 152 | Ga0453684_0360884 | 3300044712 | Bacteria | 1636 |
| 153 | Ga0453684_0748809 | 3300044712 | Bacteria | 1058 |
| 154 | Ga0451576_0507388 | 3300045051 | Bacteria | 1267 |
| 155 | Ga0495582_0286224 | 3300046473 | Bacteria | 947 |
| 156 | Ga0495630_0179376 | 3300046517 | Bacteria | 1615 |
| 157 | Ga0495632_0018128 | 3300046519 | Bacteria | 3870 |
| 158 | Ga0495642_0089916 | 3300046528 | Bacteria | 1299 |
| 159 | Ga0495622_0002232 | 3300046557 | Bacteria | 9426 |
| 160 | Ga0495622_0023601 | 3300046557 | Bacteria | 2869 |
| 161 | Ga0495622_0036684 | 3300046557 | Bacteria | 2285 |
| 162 | Ga0495611_0003854 | 3300046648 | Bacteria | 6541 |
| 163 | Ga0495649_0067805 | 3300046694 | Bacteria | 1914 |
| 164 | Ga0495589_0034018 | 3300046794 | Bacteria | 2559 |
| 165 | Ga0495672_0000485 | 3300047320 | Bacteria | 46894 |
| 166 | Ga0495683_0085490 | 3300047323 | Bacteria | 1534 |
| 167 | Ga0495626_0013601 | 3300048091 | Bacteria | 4225 |
| 168 | Ga0496101_0004698 | 3300048904 | Bacteria | 8647 |
| 169 | Ga0496101_0286226 | 3300048904 | Bacteria | 1289 |
| 170 | Ga0496102_0271658 | 3300048905 | Bacteria | 1598 |
| 171 | Ga0496103_0022841 | 3300048906 | Bacteria | 3769 |
| 172 | Ga0496104_0003503 | 3300048907 | Bacteria | 13540 |
| 173 | Ga0496105_0003695 | 3300048908 | Bacteria | 11389 |
| 174 | Ga0496106_0050122 | 3300048909 | Bacteria | 3146 |
| 175 | Ga0496109_0199197 | 3300048912 | Bacteria | 1882 |
| 176 | Ga0496110_0033579 | 3300048913 | Bacteria | 4439 |
| 177 | Ga0496111_0026692 | 3300048914 | Bacteria | 4079 |
| 178 | Ga0496112_0545329 | 3300048915 | Bacteria | 1094 |
| 179 | Ga0496113_0244389 | 3300048916 | Bacteria | 1432 |
| 180 | Ga0496114_0015021 | 3300048917 | Bacteria | 6226 |
| 181 | Ga0496114_0210008 | 3300048917 | Bacteria | 1707 |
| 182 | Ga0496117_0013365 | 3300048920 | Bacteria | 7166 |
| 183 | Ga0496119_0000072 | 3300048922 | Bacteria | 153582 |
| 184 | Ga0496120_0000094 | 3300048923 | Bacteria | 146405 |
| 185 | Ga0496122_0014583 | 3300048925 | Bacteria | 7586 |
| 186 | Ga0496124_0000340 | 3300048927 | Bacteria | 85365 |
| 187 | Ga0496124_0003576 | 3300048927 | Bacteria | 18902 |
| 188 | Ga0496125_0228741 | 3300048928 | Bacteria | 1191 |
| 189 | Ga0496126_0000593 | 3300048929 | Bacteria | 68570 |
| 190 | Ga0496126_0067036 | 3300048929 | Bacteria | 3208 |
| 191 | Ga0496126_0148653 | 3300048929 | Bacteria | 2010 |
| 192 | Ga0501031_0043198 | 3300049568 | Bacteria | 2942 |
| 193 | Ga0501033_0003593 | 3300049570 | Bacteria | 12671 |
| 194 | Ga0501034_0002084 | 3300049571 | Bacteria | 24982 |
| 195 | Ga0501034_0074713 | 3300049571 | Bacteria | 3397 |
| 196 | Ga0501034_0473254 | 3300049571 | Bacteria | 1168 |
| 197 | Ga0501067_0161960 | 3300049583 | Bacteria | 1246 |
| 198 | Ga0501044_0030092 | 3300049823 | Bacteria | 5722 |
| 199 | nmdc:mga09592_151741_c1 | 3300050508 | Bacteria | 1999 |
| 200 | nmdc:mga09592_266587_c1 | 3300050508 | Bacteria | 1485 |
| 201 | nmdc:mga0qj67_137680_c1 | 3300050509 | Bacteria | 1978 |
| 202 | nmdc:mga06r32_282304_c1 | 3300050510 | Bacteria | 1647 |
| 203 | nmdc:mga08y16_3552_c1 | 3300050511 | Bacteria | 16187 |
| 204 | nmdc:mga08y16_5269_c1 | 3300050511 | Bacteria | 13512 |
| 205 | nmdc:mga08y16_554091_c1 | 3300050511 | Bacteria | 1163 |
| 206 | Ga0500635_0037276 | 3300053080 | Bacteria | 1607 |
| 207 | Ga0500566_0000731 | 3300053094 | Bacteria | 18473 |
| 208 | Ga0500652_019516 | 3300053131 | Bacteria | 2520 |
| 209 | Ga0500559_0002923 | 3300053136 | Bacteria | 8595 |
| 210 | Ga0500637_0000548 | 3300053178 | Bacteria | 14704 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035112 | Ga0373932_0008458 | Ga0373932_0008458_1461_2306 | 205 |
| 2 | 3300035691 | Ga0373931_0000019 | Ga0373931_0000019_178940_179785 | 205 |
| 3 | 3300053136 | Ga0500559_0002923 | Ga0500559_0002923_4711_5466 | 208 |
| 4 | 3300028794 | Ga0307515_10035125 | Ga0307515_100351254 | 211 |
| 5 | 3300046519 | Ga0495632_0018128 | Ga0495632_0018128_247_1077 | 211 |
| 6 | 3300053131 | Ga0500652_019516 | Ga0500652_019516_80_910 | 211 |
| 7 | 3300009093 | Ga0105240_10028630 | Ga0105240_100286308 | 215 |
| 8 | 3300028794 | Ga0307515_10072393 | Ga0307515_100723934 | 215 |
| 9 | 3300006880 | Ga0075429_100427406 | Ga0075429_1004274062 | 216 |
| 10 | 3300048929 | Ga0496126_0148653 | Ga0496126_0148653_633_1532 | 216 |
| 11 | 3300050509 | nmdc:mga0qj67_137680_c1 | nmdc:mga0qj67_137680_c1_70_732 | 216 |
| 12 | 3300050510 | nmdc:mga06r32_282304_c1 | nmdc:mga06r32_282304_c1_775_1437 | 216 |
| 13 | 3300028556 | Ga0265337_1006800 | Ga0265337_10068005 | 217 |
| 14 | 3300028800 | Ga0265338_10028368 | Ga0265338_100283686 | 217 |
| 15 | 3300031344 | Ga0265316_10111070 | Ga0265316_101110701 | 217 |
| 16 | 3300003203 | JGI25406J46586_10020809 | JGI25406J46586_100208092 | 219 |
| 17 | 3300005985 | Ga0081539_10001533 | Ga0081539_1000153312 | 219 |
| 18 | 3300005329 | Ga0070683_100005436 | Ga0070683_1000054362 | 220 |
| 19 | 3300005331 | Ga0070670_100402140 | Ga0070670_1004021402 | 220 |
| 20 | 3300005334 | Ga0068869_100007977 | Ga0068869_1000079779 | 220 |
| 21 | 3300005338 | Ga0068868_100014572 | Ga0068868_1000145724 | 220 |
| 22 | 3300005344 | Ga0070661_100095526 | Ga0070661_1000955263 | 220 |
| 23 | 3300005345 | Ga0070692_10042158 | Ga0070692_100421583 | 220 |
| 24 | 3300005353 | Ga0070669_100078220 | Ga0070669_1000782203 | 220 |
| 25 | 3300005354 | Ga0070675_100012698 | Ga0070675_1000126984 | 220 |
| 26 | 3300005366 | Ga0070659_100015951 | Ga0070659_1000159514 | 220 |
| 27 | 3300005441 | Ga0070700_100002862 | Ga0070700_1000028629 | 220 |
| 28 | 3300005455 | Ga0070663_100030822 | Ga0070663_1000308224 | 220 |
| 29 | 3300005535 | Ga0070684_100005375 | Ga0070684_1000053755 | 220 |
| 30 | 3300005564 | Ga0070664_100001707 | Ga0070664_1000017074 | 220 |
| 31 | 3300005577 | Ga0068857_100039003 | Ga0068857_1000390033 | 220 |
| 32 | 3300005578 | Ga0068854_100112084 | Ga0068854_1001120842 | 220 |
| 33 | 3300005615 | Ga0070702_100093777 | Ga0070702_1000937772 | 220 |
| 34 | 3300005618 | Ga0068864_100217338 | Ga0068864_1002173383 | 220 |
| 35 | 3300005719 | Ga0068861_100337822 | Ga0068861_1003378222 | 220 |
| 36 | 3300005841 | Ga0068863_100474003 | Ga0068863_1004740032 | 220 |
| 37 | 3300005842 | Ga0068858_100365781 | Ga0068858_1003657812 | 220 |
| 38 | 3300006880 | Ga0075429_100249648 | Ga0075429_1002496482 | 220 |
| 39 | 3300006881 | Ga0068865_100237335 | Ga0068865_1002373352 | 220 |
| 40 | 3300009094 | Ga0111539_10056376 | Ga0111539_100563764 | 220 |
| 41 | 3300009098 | Ga0105245_10289149 | Ga0105245_102891493 | 220 |
| 42 | 3300009174 | Ga0105241_10141234 | Ga0105241_101412342 | 220 |
| 43 | 3300009553 | Ga0105249_10262989 | Ga0105249_102629892 | 220 |
| 44 | 3300010375 | Ga0105239_10423433 | Ga0105239_104234332 | 220 |
| 45 | 3300013306 | Ga0163162_10581392 | Ga0163162_105813922 | 220 |
| 46 | 3300014325 | Ga0163163_10281870 | Ga0163163_102818703 | 220 |
| 47 | 3300014745 | Ga0157377_10211211 | Ga0157377_102112111 | 220 |
| 48 | 3300025920 | Ga0207649_10035108 | Ga0207649_100351083 | 220 |
| 49 | 3300025923 | Ga0207681_10192223 | Ga0207681_101922233 | 220 |
| 50 | 3300025925 | Ga0207650_10202192 | Ga0207650_102021922 | 220 |
| 51 | 3300025926 | Ga0207659_10125213 | Ga0207659_101252133 | 220 |
| 52 | 3300025927 | Ga0207687_10185849 | Ga0207687_101858493 | 220 |
| 53 | 3300025932 | Ga0207690_10027264 | Ga0207690_100272644 | 220 |
| 54 | 3300025938 | Ga0207704_10134187 | Ga0207704_101341872 | 220 |
| 55 | 3300025942 | Ga0207689_10008001 | Ga0207689_100080014 | 220 |
| 56 | 3300025944 | Ga0207661_10038051 | Ga0207661_100380516 | 220 |
| 57 | 3300025961 | Ga0207712_10161354 | Ga0207712_101613542 | 220 |
| 58 | 3300025972 | Ga0207668_10146383 | Ga0207668_101463831 | 220 |
| 59 | 3300025981 | Ga0207640_10081940 | Ga0207640_100819403 | 220 |
| 60 | 3300026067 | Ga0207678_10047201 | Ga0207678_100472013 | 220 |
| 61 | 3300026075 | Ga0207708_10005686 | Ga0207708_100056865 | 220 |
| 62 | 3300026116 | Ga0207674_10032585 | Ga0207674_100325854 | 220 |
| 63 | 3300026118 | Ga0207675_100377878 | Ga0207675_1003778782 | 220 |
| 64 | 3300027907 | Ga0207428_10040691 | Ga0207428_100406914 | 220 |
| 65 | 3300050511 | nmdc:mga08y16_5269_c1 | nmdc:mga08y16_5269_c1_2368_3165 | 220 |
| 66 | 3300036712 | Ga0316584_0303289 | Ga0316584_0303289_411_1112 | 221 |
| 67 | 3300009093 | Ga0105240_10628951 | Ga0105240_106289512 | 222 |
| 68 | 3300005347 | Ga0070668_100083360 | Ga0070668_1000833603 | 223 |
| 69 | 3300046473 | Ga0495582_0286224 | Ga0495582_0286224_45_821 | 223 |
| 70 | 3300048905 | Ga0496102_0271658 | Ga0496102_0271658_213_989 | 223 |
| 71 | 3300049583 | Ga0501067_0161960 | Ga0501067_0161960_150_926 | 223 |
| 72 | 3300005336 | Ga0070680_100003355 | Ga0070680_10000335515 | 225 |
| 73 | 3300005355 | Ga0070671_100003099 | Ga0070671_1000030999 | 225 |
| 74 | 3300005563 | Ga0068855_100041711 | Ga0068855_1000417115 | 225 |
| 75 | 3300005842 | Ga0068858_100032479 | Ga0068858_1000324795 | 225 |
| 76 | 3300025912 | Ga0207707_10014456 | Ga0207707_100144562 | 225 |
| 77 | 3300025931 | Ga0207644_10042822 | Ga0207644_100428223 | 225 |
| 78 | 3300026035 | Ga0207703_10022997 | Ga0207703_100229974 | 225 |
| 79 | 3300053094 | Ga0500566_0000731 | Ga0500566_0000731_9759_10601 | 225 |
| 80 | 3300005329 | Ga0070683_100042915 | Ga0070683_1000429154 | 226 |
| 81 | 3300005336 | Ga0070680_100000038 | Ga0070680_10000003827 | 226 |
| 82 | 3300005458 | Ga0070681_10000106 | Ga0070681_1000010632 | 226 |
| 83 | 3300005530 | Ga0070679_100000026 | Ga0070679_10000002637 | 226 |
| 84 | 3300025912 | Ga0207707_10000071 | Ga0207707_1000007140 | 226 |
| 85 | 3300025921 | Ga0207652_10000088 | Ga0207652_1000008899 | 226 |
| 86 | 3300025944 | Ga0207661_10036805 | Ga0207661_100368053 | 226 |
| 87 | 3300031548 | Ga0307408_100041646 | Ga0307408_1000416463 | 226 |
| 88 | 3300032005 | Ga0307411_10286439 | Ga0307411_102864392 | 226 |
| 89 | 3300035088 | Ga0373940_0067185 | Ga0373940_0067185_130_846 | 226 |
| 90 | 3300031889 | Ga0326468_10000452 | Ga0326468_100004526 | 227 |
| 91 | 3300032168 | Ga0316593_10019870 | Ga0316593_100198703 | 227 |
| 92 | 3300049571 | Ga0501034_0074713 | Ga0501034_0074713_2327_3199 | 227 |
| 93 | 3300005356 | Ga0070674_100007176 | Ga0070674_1000071765 | 228 |
| 94 | 3300025937 | Ga0207669_10002407 | Ga0207669_100024077 | 228 |
| 95 | 3300048925 | Ga0496122_0014583 | Ga0496122_0014583_4862_5581 | 228 |
| 96 | 3300048927 | Ga0496124_0003576 | Ga0496124_0003576_11224_11943 | 228 |
| 97 | 3300005842 | Ga0068858_100462196 | Ga0068858_1004621961 | 229 |
| 98 | 3300013306 | Ga0163162_10679440 | Ga0163162_106794402 | 229 |
| 99 | 3300017792 | Ga0163161_10207942 | Ga0163161_102079422 | 229 |
| 100 | 3300035091 | Ga0373951_0000219 | Ga0373951_0000219_6498_7331 | 229 |
| 101 | 3300048917 | Ga0496114_0210008 | Ga0496114_0210008_540_1319 | 229 |
| 102 | 3300050508 | nmdc:mga09592_266587_c1 | nmdc:mga09592_266587_c1_534_1268 | 229 |
| 103 | 3300009094 | Ga0111539_10233058 | Ga0111539_102330583 | 230 |
| 104 | 3300031730 | Ga0307516_10008946 | Ga0307516_100089464 | 230 |
| 105 | 3300048907 | Ga0496104_0003503 | Ga0496104_0003503_1505_2281 | 230 |
| 106 | 3300048912 | Ga0496109_0199197 | Ga0496109_0199197_890_1666 | 230 |
| 107 | 3300048913 | Ga0496110_0033579 | Ga0496110_0033579_2859_3635 | 230 |
| 108 | 3300048916 | Ga0496113_0244389 | Ga0496113_0244389_368_1144 | 230 |
| 109 | 3300050508 | nmdc:mga09592_151741_c1 | nmdc:mga09592_151741_c1_667_1377 | 230 |
| 110 | 3300050511 | nmdc:mga08y16_554091_c1 | nmdc:mga08y16_554091_c1_112_822 | 230 |
| 111 | 3300005985 | Ga0081539_10025845 | Ga0081539_100258452 | 232 |
| 112 | 3300025905 | Ga0207685_10009644 | Ga0207685_100096445 | 232 |
| 113 | 3300025939 | Ga0207665_10245280 | Ga0207665_102452802 | 232 |
| 114 | 3300031456 | Ga0307513_10315996 | Ga0307513_103159962 | 232 |
| 115 | 3300048904 | Ga0496101_0004698 | Ga0496101_0004698_5779_6555 | 232 |
| 116 | 3300048906 | Ga0496103_0022841 | Ga0496103_0022841_1745_2521 | 232 |
| 117 | 3300048908 | Ga0496105_0003695 | Ga0496105_0003695_8343_9119 | 232 |
| 118 | 3300048909 | Ga0496106_0050122 | Ga0496106_0050122_1926_2702 | 232 |
| 119 | 3300048914 | Ga0496111_0026692 | Ga0496111_0026692_1833_2609 | 232 |
| 120 | 3300048915 | Ga0496112_0545329 | Ga0496112_0545329_186_962 | 232 |
| 121 | 3300048917 | Ga0496114_0015021 | Ga0496114_0015021_1928_2704 | 232 |
| 122 | 3300035398 | Ga0316574_0023650 | Ga0316574_0023650_1002_1730 | 233 |
| 123 | 3300035695 | Ga0373927_0058400 | Ga0373927_0058400_727_1617 | 233 |
| 124 | 3300036647 | Ga0316582_0003881 | Ga0316582_0003881_1691_2419 | 233 |
| 125 | 3300036712 | Ga0316584_0007872 | Ga0316584_0007872_5846_6574 | 233 |
| 126 | 3300044712 | Ga0453684_0748809 | Ga0453684_0748809_75_797 | 233 |
| 127 | iso_pu_bacteria | 2937843397 | 2937848424 | 233 |
| 128 | 3300009553 | Ga0105249_10006997 | Ga0105249_1000699710 | 234 |
| 129 | 3300013297 | Ga0157378_10186483 | Ga0157378_101864832 | 234 |
| 130 | iso_pu_bacteria | 2889790730 | 2889792949 | 234 |
| 131 | iso_pu_bacteria | 2889914905 | 2889919036 | 234 |
| 132 | 3300033541 | Ga0316596_1004048 | Ga0316596_10040483 | 236 |
| 133 | 3300037068 | Ga0373925_0234286 | Ga0373925_0234286_305_1051 | 236 |
| 134 | 3300046517 | Ga0495630_0179376 | Ga0495630_0179376_130_879 | 236 |
| 135 | 3300046528 | Ga0495642_0089916 | Ga0495642_0089916_55_801 | 236 |
| 136 | 3300046557 | Ga0495622_0002232 | Ga0495622_0002232_4577_5323 | 236 |
| 137 | 3300046557 | Ga0495622_0023601 | Ga0495622_0023601_1771_2520 | 236 |
| 138 | 3300046557 | Ga0495622_0036684 | Ga0495622_0036684_108_857 | 236 |
| 139 | 3300046648 | Ga0495611_0003854 | Ga0495611_0003854_2469_3215 | 236 |
| 140 | 3300046694 | Ga0495649_0067805 | Ga0495649_0067805_1142_1888 | 236 |
| 141 | 3300046794 | Ga0495589_0034018 | Ga0495589_0034018_121_870 | 236 |
| 142 | 3300047320 | Ga0495672_0000485 | Ga0495672_0000485_34918_35664 | 236 |
| 143 | 3300047323 | Ga0495683_0085490 | Ga0495683_0085490_209_955 | 236 |
| 144 | 3300048091 | Ga0495626_0013601 | Ga0495626_0013601_145_891 | 236 |
| 145 | 3300049571 | Ga0501034_0473254 | Ga0501034_0473254_354_1088 | 236 |
| 146 | 3300053080 | Ga0500635_0037276 | Ga0500635_0037276_188_934 | 236 |
| 147 | 3300053178 | Ga0500637_0000548 | Ga0500637_0000548_8774_9520 | 236 |
| 148 | 3300031728 | Ga0316578_10110241 | Ga0316578_101102413 | 237 |
| 149 | 3300031733 | Ga0316577_10004288 | Ga0316577_100042887 | 237 |
| 150 | 3300031852 | Ga0307410_10451085 | Ga0307410_104510852 | 237 |
| 151 | 3300031995 | Ga0307409_100041268 | Ga0307409_1000412683 | 237 |
| 152 | 3300032126 | Ga0307415_100024163 | Ga0307415_1000241633 | 237 |
| 153 | 3300036712 | Ga0316584_0001619 | Ga0316584_0001619_9693_10475 | 237 |
| 154 | 3300048929 | Ga0496126_0067036 | Ga0496126_0067036_2396_3160 | 237 |
| 155 | 3300049570 | Ga0501033_0003593 | Ga0501033_0003593_9551_10375 | 237 |
| 156 | 3300049823 | Ga0501044_0030092 | Ga0501044_0030092_1780_2604 | 237 |
| 157 | 3300025901 | Ga0207688_10075791 | Ga0207688_100757914 | 238 |
| 158 | 3300026067 | Ga0207678_10240372 | Ga0207678_102403721 | 238 |
| 159 | 3300036647 | Ga0316582_0063545 | Ga0316582_0063545_1201_2055 | 238 |
| 160 | 3300036647 | Ga0316582_0093384 | Ga0316582_0093384_18_890 | 238 |
| 161 | 3300044712 | Ga0453684_0016532 | Ga0453684_0016532_2947_3735 | 238 |
| 162 | 3300044712 | Ga0453684_0273623 | Ga0453684_0273623_412_1170 | 238 |
| 163 | 3300048904 | Ga0496101_0286226 | Ga0496101_0286226_84_851 | 238 |
| 164 | 3300049571 | Ga0501034_0002084 | Ga0501034_0002084_24046_24783 | 238 |
| 165 | 3300031665 | Ga0316575_10000404 | Ga0316575_100004048 | 239 |
| 166 | 3300031691 | Ga0316579_10002813 | Ga0316579_100028137 | 239 |
| 167 | 3300031691 | Ga0316579_10054990 | Ga0316579_100549902 | 239 |
| 168 | 3300031727 | Ga0316576_10209636 | Ga0316576_102096361 | 239 |
| 169 | 3300031728 | Ga0316578_10000845 | Ga0316578_100008455 | 239 |
| 170 | 3300031733 | Ga0316577_10002099 | Ga0316577_100020999 | 239 |
| 171 | 3300031733 | Ga0316577_10199467 | Ga0316577_101994672 | 239 |
| 172 | 3300032133 | Ga0316583_10002075 | Ga0316583_100020755 | 239 |
| 173 | 3300032137 | Ga0316585_10021794 | Ga0316585_100217944 | 239 |
| 174 | 3300035398 | Ga0316574_0006957 | Ga0316574_0006957_2157_3017 | 239 |
| 175 | 3300036647 | Ga0316582_0001828 | Ga0316582_0001828_3592_4452 | 239 |
| 176 | 3300036647 | Ga0316582_0043788 | Ga0316582_0043788_1436_2308 | 239 |
| 177 | 3300036647 | Ga0316582_0296328 | Ga0316582_0296328_195_938 | 239 |
| 178 | 3300036647 | Ga0316582_0330887 | Ga0316582_0330887_47_919 | 239 |
| 179 | 3300036712 | Ga0316584_0004501 | Ga0316584_0004501_2146_3006 | 239 |
| 180 | 3300036712 | Ga0316584_0047224 | Ga0316584_0047224_549_1421 | 239 |
| 181 | 3300037588 | Ga0316581_0009241 | Ga0316581_0009241_531_1403 | 239 |
| 182 | 3300038735 | Ga0400485_07515 | Ga0400485_07515_2429_3205 | 239 |
| 183 | 3300038735 | Ga0400485_17202 | Ga0400485_17202_2485_3255 | 239 |
| 184 | 3300038741 | Ga0400488_51584 | Ga0400488_51584_565_1341 | 239 |
| 185 | 3300038742 | Ga0400486_26096 | Ga0400486_26096_15710_16489 | 239 |
| 186 | 3300038742 | Ga0400486_29396 | Ga0400486_29396_25941_26717 | 239 |
| 187 | 3300039062 | Ga0400483_021395 | Ga0400483_021395_98271_99050 | 239 |
| 188 | 3300039062 | Ga0400483_269206 | Ga0400483_269206_33376_34155 | 239 |
| 189 | 3300039093 | Ga0400489_26427 | Ga0400489_26427_2522_3301 | 239 |
| 190 | 3300039093 | Ga0400489_35275 | Ga0400489_35275_43775_44551 | 239 |
| 191 | 3300044712 | Ga0453684_0256821 | Ga0453684_0256821_706_1461 | 239 |
| 192 | 3300049568 | Ga0501031_0043198 | Ga0501031_0043198_1553_2293 | 239 |
| 193 | 3300009094 | Ga0111539_10000063 | Ga0111539_1000006356 | 240 |
| 194 | 3300027907 | Ga0207428_10014148 | Ga0207428_100141487 | 240 |
| 195 | 3300031727 | Ga0316576_10058397 | Ga0316576_100583973 | 240 |
| 196 | 3300031728 | Ga0316578_10367909 | Ga0316578_103679091 | 240 |
| 197 | 3300038742 | Ga0400486_28434 | Ga0400486_28434_15228_16010 | 240 |
| 198 | 3300044712 | Ga0453684_0289226 | Ga0453684_0289226_209_955 | 240 |
| 199 | 3300048920 | Ga0496117_0013365 | Ga0496117_0013365_1128_1883 | 240 |
| 200 | 3300048922 | Ga0496119_0000072 | Ga0496119_0000072_23541_24296 | 240 |
| 201 | 3300048923 | Ga0496120_0000094 | Ga0496120_0000094_57842_58597 | 240 |
| 202 | 3300048927 | Ga0496124_0000340 | Ga0496124_0000340_36284_37039 | 240 |
| 203 | 3300048928 | Ga0496125_0228741 | Ga0496125_0228741_360_1115 | 240 |
| 204 | 3300048929 | Ga0496126_0000593 | Ga0496126_0000593_16340_17095 | 240 |
| 205 | 3300050511 | nmdc:mga08y16_3552_c1 | nmdc:mga08y16_3552_c1_2661_3428 | 240 |
| 206 | 3300009098 | Ga0105245_10427207 | Ga0105245_104272071 | 241 |
| 207 | 3300031251 | Ga0265327_10000014 | Ga0265327_10000014176 | 241 |
| 208 | 2162886007 | SwRhRL2b_contig_259194 | SwRhRL2b_0676.00006270 | 242 |
| 209 | 3300003323 | rootH1_10025955 | rootH1_1002595521 | 242 |
| 210 | 3300005289 | Ga0065704_10071733 | Ga0065704_1007173311 | 242 |
| 211 | 3300039062 | Ga0400483_149839 | Ga0400483_149839_11270_12043 | 242 |
| 212 | 3300044712 | Ga0453684_0360884 | Ga0453684_0360884_759_1526 | 242 |
| 213 | 3300045051 | Ga0451576_0507388 | Ga0451576_0507388_306_1073 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s3l-assembly1.cif.gz_C | structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. | 0.9464 | 49 | 242 |
| 6s3r-assembly1.cif.gz_A | structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. | 0.9349 | 52 | 242 |
| 6s3s-assembly1.cif.gz_D | structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. | 0.934 | 52 | 242 |
| 6s3l-assembly1.cif.gz_C | structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. | 0.928 | 49 | 242 |
| 6r6b-assembly1.cif.gz_B | structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). | 0.9178 | 46 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O65090_275_342_1.10.8.100 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;rRNA adenine dimethylase, C-terminal domain | 0.4907 | 132 | 175 | 1.10.8.100 |
| af_C4J9Z7_68_180_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.4393 | 135 | 204 | 1.10.10.1740 |
| 3wvoC02 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; | 0.3833 | 50 | 191 | 1.10.132.100 |
| af_O65090_275_342_1.10.8.100 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;rRNA adenine dimethylase, C-terminal domain | 0.365 | 132 | 175 | 1.10.8.100 |
| 3wvoC02 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; | 0.3599 | 50 | 191 | 1.10.132.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V5K290-F1-model_v4 | Flagellar biosynthetic protein FliP | 0.9793 | 47 | 241 |
GO:0005886
GO:0009306 GO:0009425 GO:0044781 |
| AF-A0A349MHA8-F1-model_v4 | Flagellar biosynthetic protein FliP | 0.9761 | 47 | 198 |
GO:0005886
GO:0009306 |
| AF-A0A4R3MKZ1-F1-model_v4 | Flagellar biosynthetic protein FliP | 0.9743 | 58 | 242 |
GO:0005886
GO:0009306 GO:0009425 GO:0044781 |
| AF-A0A535XP01-F1-model_v4 | Flagellar biosynthetic protein FliP | 0.9736 | 59 | 242 |
GO:0005886
GO:0009306 GO:0009425 GO:0044781 |
| AF-A0A060QIK4-F1-model_v4 | Flagellar biosynthetic protein FliP | 0.9721 | 59 | 241 |
GO:0005886
GO:0009306 GO:0009425 GO:0044781 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar