F324211

General Info

Members Datasets Scaffolds Average Seq Length
213 156 210 245

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10054990|Ga0316579_100549902
Length 290
Sequence MKFNELPLNRLSEANFTADCRKRSIAGRAKPLQRMQRLLLVGVILGIGLSAVFLTPGNSTAAAPQTAAPFISIGMDQAQEPGKMAVVLQIFLLMTVLSLAPAILIMLTSFTRVVIVLSLLRRALGTMQMPPNQVIIGLALFLTFFIMTPVWQQVNQTALQPYLENKIEQQQALQKAAEPLRGFMFKQTREKDLALFVSIAKIERPKDVNDIPISVLIPSFIISEVKTAFQIGLLLYVPFLIIDMVVASVLLSMGMMMLPPIMISLPFKLMLFVLADGWNLLIGSLVRSFI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
3 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
4 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
93 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
94 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
106 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
107 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
108 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
109 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
110 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
153 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0.94
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 6.57
Rhizosphere 78.87
Stem 0
Stem Tuber 0
Unclassified 12.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_259194 2162886007 Bacteria 1393
2 JGI25406J46586_10020809 3300003203 Bacteria 2645
3 rootH1_10025955 3300003323 Bacteria 25198
4 Ga0065704_10071733 3300005289 Bacteria 10081
5 Ga0070683_100005436 3300005329 Bacteria 10641
6 Ga0070683_100042915 3300005329 Bacteria 4166
7 Ga0070670_100402140 3300005331 Bacteria 1209
8 Ga0068869_100007977 3300005334 Bacteria 6804
9 Ga0070680_100000038 3300005336 Bacteria 66468
10 Ga0070680_100003355 3300005336 Bacteria 11953
11 Ga0068868_100014572 3300005338 Bacteria 5799
12 Ga0070661_100095526 3300005344 Bacteria 2204
13 Ga0070692_10042158 3300005345 Bacteria 2342
14 Ga0070668_100083360 3300005347 Bacteria 2510
15 Ga0070669_100078220 3300005353 Bacteria 2458
16 Ga0070675_100012698 3300005354 Bacteria 6606
17 Ga0070671_100003099 3300005355 Bacteria 12944
18 Ga0070674_100007176 3300005356 Bacteria 6558
19 Ga0070659_100015951 3300005366 Bacteria 5635
20 Ga0070700_100002862 3300005441 Bacteria 8854
21 Ga0070663_100030822 3300005455 Bacteria 3680
22 Ga0070681_10000106 3300005458 Bacteria 62398
23 Ga0070679_100000026 3300005530 Bacteria 115669
24 Ga0070684_100005375 3300005535 Bacteria 9812
25 Ga0068855_100041711 3300005563 Bacteria 5438
26 Ga0070664_100001707 3300005564 Bacteria 17586
27 Ga0068857_100039003 3300005577 Bacteria 4206
28 Ga0068854_100112084 3300005578 Bacteria 2059
29 Ga0070702_100093777 3300005615 Bacteria 1826
30 Ga0068864_100217338 3300005618 Bacteria 1762
31 Ga0068861_100337822 3300005719 Bacteria 1317
32 Ga0068863_100474003 3300005841 Bacteria 1230
33 Ga0068858_100032479 3300005842 Bacteria 4847
34 Ga0068858_100365781 3300005842 Bacteria 1383
35 Ga0068858_100462196 3300005842 Bacteria 1224
36 Ga0081539_10001533 3300005985 Bacteria 38679
37 Ga0081539_10025845 3300005985 Bacteria 3765
38 Ga0075429_100249648 3300006880 Bacteria 1554
39 Ga0075429_100427406 3300006880 Bacteria 1160
40 Ga0068865_100237335 3300006881 Bacteria 1433
41 Ga0105240_10028630 3300009093 Bacteria 7272
42 Ga0105240_10628951 3300009093 Bacteria 1179
43 Ga0111539_10000063 3300009094 Bacteria 108022
44 Ga0111539_10056376 3300009094 Bacteria 4670
45 Ga0111539_10233058 3300009094 Bacteria 2144
46 Ga0105245_10289149 3300009098 Bacteria 1605
47 Ga0105245_10427207 3300009098 Bacteria 1329
48 Ga0105241_10141234 3300009174 Bacteria 1961
49 Ga0105249_10006997 3300009553 Bacteria 9843
50 Ga0105249_10262989 3300009553 Bacteria 1715
51 Ga0105239_10423433 3300010375 Bacteria 1508
52 Ga0157378_10186483 3300013297 Bacteria 1954
53 Ga0163162_10581392 3300013306 Bacteria 1247
54 Ga0163162_10679440 3300013306 Bacteria 1152
55 Ga0163163_10281870 3300014325 Bacteria 1713
56 Ga0157377_10211211 3300014745 Bacteria 1238
57 Ga0163161_10207942 3300017792 Bacteria 1511
58 Ga0207688_10075791 3300025901 Bacteria 1915
59 Ga0207685_10009644 3300025905 Bacteria 2813
60 Ga0207707_10000071 3300025912 Bacteria 102604
61 Ga0207707_10014456 3300025912 Bacteria 6875
62 Ga0207649_10035108 3300025920 Bacteria 3010
63 Ga0207652_10000088 3300025921 Bacteria 99810
64 Ga0207681_10192223 3300025923 Bacteria 1562
65 Ga0207650_10202192 3300025925 Bacteria 1592
66 Ga0207659_10125213 3300025926 Bacteria 1975
67 Ga0207687_10185849 3300025927 Bacteria 1613
68 Ga0207644_10042822 3300025931 Bacteria 3210
69 Ga0207690_10027264 3300025932 Bacteria 3609
70 Ga0207669_10002407 3300025937 Bacteria 7974
71 Ga0207704_10134187 3300025938 Bacteria 1720
72 Ga0207665_10245280 3300025939 Bacteria 1321
73 Ga0207689_10008001 3300025942 Bacteria 9232
74 Ga0207661_10036805 3300025944 Bacteria 3823
75 Ga0207661_10038051 3300025944 Bacteria 3768
76 Ga0207712_10161354 3300025961 Bacteria 1742
77 Ga0207668_10146383 3300025972 Bacteria 1823
78 Ga0207640_10081940 3300025981 Bacteria 2208
79 Ga0207703_10022997 3300026035 Bacteria 4893
80 Ga0207678_10047201 3300026067 Bacteria 3725
81 Ga0207678_10240372 3300026067 Bacteria 1551
82 Ga0207708_10005686 3300026075 Bacteria 9214
83 Ga0207674_10032585 3300026116 Bacteria 5464
84 Ga0207675_100377878 3300026118 Bacteria 1393
85 Ga0207428_10014148 3300027907 Bacteria 6947
86 Ga0207428_10040691 3300027907 Bacteria 3767
87 Ga0265337_1006800 3300028556 Bacteria 4353
88 Ga0307515_10035125 3300028794 Bacteria 8170
89 Ga0307515_10072393 3300028794 Bacteria 4652
90 Ga0265338_10028368 3300028800 Bacteria 5583
91 Ga0265327_10000014 3300031251 Bacteria 506288
92 Ga0265316_10111070 3300031344 Bacteria 2076
93 Ga0307513_10315996 3300031456 Bacteria 1322
94 Ga0307408_100041646 3300031548 Bacteria 3257
95 Ga0316575_10000404 3300031665 Bacteria 12327
96 Ga0316579_10002813 3300031691 Bacteria 6654
97 Ga0316579_10054990 3300031691 Bacteria 1866
98 Ga0316576_10058397 3300031727 Bacteria 2822
99 Ga0316576_10209636 3300031727 Bacteria 1467
100 Ga0316578_10000845 3300031728 Bacteria 11481
101 Ga0316578_10110241 3300031728 Bacteria 1653
102 Ga0316578_10367909 3300031728 Bacteria 854
103 Ga0307516_10008946 3300031730 Bacteria 11226
104 Ga0316577_10002099 3300031733 Bacteria 9738
105 Ga0316577_10004288 3300031733 Bacteria 7344
106 Ga0316577_10199467 3300031733 Bacteria 1131
107 Ga0307410_10451085 3300031852 Bacteria 1049
108 Ga0326468_10000452 3300031889 Bacteria 4374
109 Ga0307409_100041268 3300031995 Bacteria 3444
110 Ga0307411_10286439 3300032005 Bacteria 1314
111 Ga0307415_100024163 3300032126 Bacteria 3789
112 Ga0316583_10002075 3300032133 Bacteria 6875
113 Ga0316585_10021794 3300032137 Bacteria 1968
114 Ga0316593_10019870 3300032168 Bacteria 2080
115 Ga0316596_1004048 3300033541 Bacteria 3256
116 Ga0373940_0067185 3300035088 Bacteria 1037
117 Ga0373951_0000219 3300035091 Bacteria 20040
118 Ga0373932_0008458 3300035112 Bacteria 2461
119 Ga0316574_0006957 3300035398 Bacteria 6159
120 Ga0316574_0023650 3300035398 Bacteria 3670
121 Ga0373931_0000019 3300035691 Bacteria 186534
122 Ga0373927_0058400 3300035695 Bacteria 2495
123 Ga0316582_0001828 3300036647 Bacteria 9622
124 Ga0316582_0003881 3300036647 Bacteria 7443
125 Ga0316582_0043788 3300036647 Bacteria 2810
126 Ga0316582_0063545 3300036647 Bacteria 2373
127 Ga0316582_0093384 3300036647 Bacteria 1984
128 Ga0316582_0296328 3300036647 Bacteria 1111
129 Ga0316582_0330887 3300036647 Bacteria 1048
130 Ga0316584_0001619 3300036712 Bacteria 13720
131 Ga0316584_0004501 3300036712 Bacteria 9225
132 Ga0316584_0007872 3300036712 Bacteria 7312
133 Ga0316584_0047224 3300036712 Bacteria 3216
134 Ga0316584_0303289 3300036712 Bacteria 1156
135 Ga0373925_0234286 3300037068 Bacteria 1469
136 Ga0316581_0009241 3300037588 Bacteria 2706
137 Ga0400485_07515 3300038735 Bacteria 3347
138 Ga0400485_17202 3300038735 Bacteria 4078
139 Ga0400488_51584 3300038741 Bacteria 2977
140 Ga0400486_26096 3300038742 Bacteria 60268
141 Ga0400486_28434 3300038742 Bacteria 18431
142 Ga0400486_29396 3300038742 Bacteria 43599
143 Ga0400483_021395 3300039062 Bacteria 114250
144 Ga0400483_149839 3300039062 Bacteria 19167
145 Ga0400483_269206 3300039062 Bacteria 85448
146 Ga0400489_26427 3300039093 Bacteria 6761
147 Ga0400489_35275 3300039093 Bacteria 72456
148 Ga0453684_0016532 3300044712 Bacteria 11522
149 Ga0453684_0256821 3300044712 Bacteria 2004
150 Ga0453684_0273623 3300044712 Bacteria 1928
151 Ga0453684_0289226 3300044712 Bacteria 1866
152 Ga0453684_0360884 3300044712 Bacteria 1636
153 Ga0453684_0748809 3300044712 Bacteria 1058
154 Ga0451576_0507388 3300045051 Bacteria 1267
155 Ga0495582_0286224 3300046473 Bacteria 947
156 Ga0495630_0179376 3300046517 Bacteria 1615
157 Ga0495632_0018128 3300046519 Bacteria 3870
158 Ga0495642_0089916 3300046528 Bacteria 1299
159 Ga0495622_0002232 3300046557 Bacteria 9426
160 Ga0495622_0023601 3300046557 Bacteria 2869
161 Ga0495622_0036684 3300046557 Bacteria 2285
162 Ga0495611_0003854 3300046648 Bacteria 6541
163 Ga0495649_0067805 3300046694 Bacteria 1914
164 Ga0495589_0034018 3300046794 Bacteria 2559
165 Ga0495672_0000485 3300047320 Bacteria 46894
166 Ga0495683_0085490 3300047323 Bacteria 1534
167 Ga0495626_0013601 3300048091 Bacteria 4225
168 Ga0496101_0004698 3300048904 Bacteria 8647
169 Ga0496101_0286226 3300048904 Bacteria 1289
170 Ga0496102_0271658 3300048905 Bacteria 1598
171 Ga0496103_0022841 3300048906 Bacteria 3769
172 Ga0496104_0003503 3300048907 Bacteria 13540
173 Ga0496105_0003695 3300048908 Bacteria 11389
174 Ga0496106_0050122 3300048909 Bacteria 3146
175 Ga0496109_0199197 3300048912 Bacteria 1882
176 Ga0496110_0033579 3300048913 Bacteria 4439
177 Ga0496111_0026692 3300048914 Bacteria 4079
178 Ga0496112_0545329 3300048915 Bacteria 1094
179 Ga0496113_0244389 3300048916 Bacteria 1432
180 Ga0496114_0015021 3300048917 Bacteria 6226
181 Ga0496114_0210008 3300048917 Bacteria 1707
182 Ga0496117_0013365 3300048920 Bacteria 7166
183 Ga0496119_0000072 3300048922 Bacteria 153582
184 Ga0496120_0000094 3300048923 Bacteria 146405
185 Ga0496122_0014583 3300048925 Bacteria 7586
186 Ga0496124_0000340 3300048927 Bacteria 85365
187 Ga0496124_0003576 3300048927 Bacteria 18902
188 Ga0496125_0228741 3300048928 Bacteria 1191
189 Ga0496126_0000593 3300048929 Bacteria 68570
190 Ga0496126_0067036 3300048929 Bacteria 3208
191 Ga0496126_0148653 3300048929 Bacteria 2010
192 Ga0501031_0043198 3300049568 Bacteria 2942
193 Ga0501033_0003593 3300049570 Bacteria 12671
194 Ga0501034_0002084 3300049571 Bacteria 24982
195 Ga0501034_0074713 3300049571 Bacteria 3397
196 Ga0501034_0473254 3300049571 Bacteria 1168
197 Ga0501067_0161960 3300049583 Bacteria 1246
198 Ga0501044_0030092 3300049823 Bacteria 5722
199 nmdc:mga09592_151741_c1 3300050508 Bacteria 1999
200 nmdc:mga09592_266587_c1 3300050508 Bacteria 1485
201 nmdc:mga0qj67_137680_c1 3300050509 Bacteria 1978
202 nmdc:mga06r32_282304_c1 3300050510 Bacteria 1647
203 nmdc:mga08y16_3552_c1 3300050511 Bacteria 16187
204 nmdc:mga08y16_5269_c1 3300050511 Bacteria 13512
205 nmdc:mga08y16_554091_c1 3300050511 Bacteria 1163
206 Ga0500635_0037276 3300053080 Bacteria 1607
207 Ga0500566_0000731 3300053094 Bacteria 18473
208 Ga0500652_019516 3300053131 Bacteria 2520
209 Ga0500559_0002923 3300053136 Bacteria 8595
210 Ga0500637_0000548 3300053178 Bacteria 14704

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035112 Ga0373932_0008458 Ga0373932_0008458_1461_2306 205
2 3300035691 Ga0373931_0000019 Ga0373931_0000019_178940_179785 205
3 3300053136 Ga0500559_0002923 Ga0500559_0002923_4711_5466 208
4 3300028794 Ga0307515_10035125 Ga0307515_100351254 211
5 3300046519 Ga0495632_0018128 Ga0495632_0018128_247_1077 211
6 3300053131 Ga0500652_019516 Ga0500652_019516_80_910 211
7 3300009093 Ga0105240_10028630 Ga0105240_100286308 215
8 3300028794 Ga0307515_10072393 Ga0307515_100723934 215
9 3300006880 Ga0075429_100427406 Ga0075429_1004274062 216
10 3300048929 Ga0496126_0148653 Ga0496126_0148653_633_1532 216
11 3300050509 nmdc:mga0qj67_137680_c1 nmdc:mga0qj67_137680_c1_70_732 216
12 3300050510 nmdc:mga06r32_282304_c1 nmdc:mga06r32_282304_c1_775_1437 216
13 3300028556 Ga0265337_1006800 Ga0265337_10068005 217
14 3300028800 Ga0265338_10028368 Ga0265338_100283686 217
15 3300031344 Ga0265316_10111070 Ga0265316_101110701 217
16 3300003203 JGI25406J46586_10020809 JGI25406J46586_100208092 219
17 3300005985 Ga0081539_10001533 Ga0081539_1000153312 219
18 3300005329 Ga0070683_100005436 Ga0070683_1000054362 220
19 3300005331 Ga0070670_100402140 Ga0070670_1004021402 220
20 3300005334 Ga0068869_100007977 Ga0068869_1000079779 220
21 3300005338 Ga0068868_100014572 Ga0068868_1000145724 220
22 3300005344 Ga0070661_100095526 Ga0070661_1000955263 220
23 3300005345 Ga0070692_10042158 Ga0070692_100421583 220
24 3300005353 Ga0070669_100078220 Ga0070669_1000782203 220
25 3300005354 Ga0070675_100012698 Ga0070675_1000126984 220
26 3300005366 Ga0070659_100015951 Ga0070659_1000159514 220
27 3300005441 Ga0070700_100002862 Ga0070700_1000028629 220
28 3300005455 Ga0070663_100030822 Ga0070663_1000308224 220
29 3300005535 Ga0070684_100005375 Ga0070684_1000053755 220
30 3300005564 Ga0070664_100001707 Ga0070664_1000017074 220
31 3300005577 Ga0068857_100039003 Ga0068857_1000390033 220
32 3300005578 Ga0068854_100112084 Ga0068854_1001120842 220
33 3300005615 Ga0070702_100093777 Ga0070702_1000937772 220
34 3300005618 Ga0068864_100217338 Ga0068864_1002173383 220
35 3300005719 Ga0068861_100337822 Ga0068861_1003378222 220
36 3300005841 Ga0068863_100474003 Ga0068863_1004740032 220
37 3300005842 Ga0068858_100365781 Ga0068858_1003657812 220
38 3300006880 Ga0075429_100249648 Ga0075429_1002496482 220
39 3300006881 Ga0068865_100237335 Ga0068865_1002373352 220
40 3300009094 Ga0111539_10056376 Ga0111539_100563764 220
41 3300009098 Ga0105245_10289149 Ga0105245_102891493 220
42 3300009174 Ga0105241_10141234 Ga0105241_101412342 220
43 3300009553 Ga0105249_10262989 Ga0105249_102629892 220
44 3300010375 Ga0105239_10423433 Ga0105239_104234332 220
45 3300013306 Ga0163162_10581392 Ga0163162_105813922 220
46 3300014325 Ga0163163_10281870 Ga0163163_102818703 220
47 3300014745 Ga0157377_10211211 Ga0157377_102112111 220
48 3300025920 Ga0207649_10035108 Ga0207649_100351083 220
49 3300025923 Ga0207681_10192223 Ga0207681_101922233 220
50 3300025925 Ga0207650_10202192 Ga0207650_102021922 220
51 3300025926 Ga0207659_10125213 Ga0207659_101252133 220
52 3300025927 Ga0207687_10185849 Ga0207687_101858493 220
53 3300025932 Ga0207690_10027264 Ga0207690_100272644 220
54 3300025938 Ga0207704_10134187 Ga0207704_101341872 220
55 3300025942 Ga0207689_10008001 Ga0207689_100080014 220
56 3300025944 Ga0207661_10038051 Ga0207661_100380516 220
57 3300025961 Ga0207712_10161354 Ga0207712_101613542 220
58 3300025972 Ga0207668_10146383 Ga0207668_101463831 220
59 3300025981 Ga0207640_10081940 Ga0207640_100819403 220
60 3300026067 Ga0207678_10047201 Ga0207678_100472013 220
61 3300026075 Ga0207708_10005686 Ga0207708_100056865 220
62 3300026116 Ga0207674_10032585 Ga0207674_100325854 220
63 3300026118 Ga0207675_100377878 Ga0207675_1003778782 220
64 3300027907 Ga0207428_10040691 Ga0207428_100406914 220
65 3300050511 nmdc:mga08y16_5269_c1 nmdc:mga08y16_5269_c1_2368_3165 220
66 3300036712 Ga0316584_0303289 Ga0316584_0303289_411_1112 221
67 3300009093 Ga0105240_10628951 Ga0105240_106289512 222
68 3300005347 Ga0070668_100083360 Ga0070668_1000833603 223
69 3300046473 Ga0495582_0286224 Ga0495582_0286224_45_821 223
70 3300048905 Ga0496102_0271658 Ga0496102_0271658_213_989 223
71 3300049583 Ga0501067_0161960 Ga0501067_0161960_150_926 223
72 3300005336 Ga0070680_100003355 Ga0070680_10000335515 225
73 3300005355 Ga0070671_100003099 Ga0070671_1000030999 225
74 3300005563 Ga0068855_100041711 Ga0068855_1000417115 225
75 3300005842 Ga0068858_100032479 Ga0068858_1000324795 225
76 3300025912 Ga0207707_10014456 Ga0207707_100144562 225
77 3300025931 Ga0207644_10042822 Ga0207644_100428223 225
78 3300026035 Ga0207703_10022997 Ga0207703_100229974 225
79 3300053094 Ga0500566_0000731 Ga0500566_0000731_9759_10601 225
80 3300005329 Ga0070683_100042915 Ga0070683_1000429154 226
81 3300005336 Ga0070680_100000038 Ga0070680_10000003827 226
82 3300005458 Ga0070681_10000106 Ga0070681_1000010632 226
83 3300005530 Ga0070679_100000026 Ga0070679_10000002637 226
84 3300025912 Ga0207707_10000071 Ga0207707_1000007140 226
85 3300025921 Ga0207652_10000088 Ga0207652_1000008899 226
86 3300025944 Ga0207661_10036805 Ga0207661_100368053 226
87 3300031548 Ga0307408_100041646 Ga0307408_1000416463 226
88 3300032005 Ga0307411_10286439 Ga0307411_102864392 226
89 3300035088 Ga0373940_0067185 Ga0373940_0067185_130_846 226
90 3300031889 Ga0326468_10000452 Ga0326468_100004526 227
91 3300032168 Ga0316593_10019870 Ga0316593_100198703 227
92 3300049571 Ga0501034_0074713 Ga0501034_0074713_2327_3199 227
93 3300005356 Ga0070674_100007176 Ga0070674_1000071765 228
94 3300025937 Ga0207669_10002407 Ga0207669_100024077 228
95 3300048925 Ga0496122_0014583 Ga0496122_0014583_4862_5581 228
96 3300048927 Ga0496124_0003576 Ga0496124_0003576_11224_11943 228
97 3300005842 Ga0068858_100462196 Ga0068858_1004621961 229
98 3300013306 Ga0163162_10679440 Ga0163162_106794402 229
99 3300017792 Ga0163161_10207942 Ga0163161_102079422 229
100 3300035091 Ga0373951_0000219 Ga0373951_0000219_6498_7331 229
101 3300048917 Ga0496114_0210008 Ga0496114_0210008_540_1319 229
102 3300050508 nmdc:mga09592_266587_c1 nmdc:mga09592_266587_c1_534_1268 229
103 3300009094 Ga0111539_10233058 Ga0111539_102330583 230
104 3300031730 Ga0307516_10008946 Ga0307516_100089464 230
105 3300048907 Ga0496104_0003503 Ga0496104_0003503_1505_2281 230
106 3300048912 Ga0496109_0199197 Ga0496109_0199197_890_1666 230
107 3300048913 Ga0496110_0033579 Ga0496110_0033579_2859_3635 230
108 3300048916 Ga0496113_0244389 Ga0496113_0244389_368_1144 230
109 3300050508 nmdc:mga09592_151741_c1 nmdc:mga09592_151741_c1_667_1377 230
110 3300050511 nmdc:mga08y16_554091_c1 nmdc:mga08y16_554091_c1_112_822 230
111 3300005985 Ga0081539_10025845 Ga0081539_100258452 232
112 3300025905 Ga0207685_10009644 Ga0207685_100096445 232
113 3300025939 Ga0207665_10245280 Ga0207665_102452802 232
114 3300031456 Ga0307513_10315996 Ga0307513_103159962 232
115 3300048904 Ga0496101_0004698 Ga0496101_0004698_5779_6555 232
116 3300048906 Ga0496103_0022841 Ga0496103_0022841_1745_2521 232
117 3300048908 Ga0496105_0003695 Ga0496105_0003695_8343_9119 232
118 3300048909 Ga0496106_0050122 Ga0496106_0050122_1926_2702 232
119 3300048914 Ga0496111_0026692 Ga0496111_0026692_1833_2609 232
120 3300048915 Ga0496112_0545329 Ga0496112_0545329_186_962 232
121 3300048917 Ga0496114_0015021 Ga0496114_0015021_1928_2704 232
122 3300035398 Ga0316574_0023650 Ga0316574_0023650_1002_1730 233
123 3300035695 Ga0373927_0058400 Ga0373927_0058400_727_1617 233
124 3300036647 Ga0316582_0003881 Ga0316582_0003881_1691_2419 233
125 3300036712 Ga0316584_0007872 Ga0316584_0007872_5846_6574 233
126 3300044712 Ga0453684_0748809 Ga0453684_0748809_75_797 233
127 iso_pu_bacteria 2937843397 2937848424 233
128 3300009553 Ga0105249_10006997 Ga0105249_1000699710 234
129 3300013297 Ga0157378_10186483 Ga0157378_101864832 234
130 iso_pu_bacteria 2889790730 2889792949 234
131 iso_pu_bacteria 2889914905 2889919036 234
132 3300033541 Ga0316596_1004048 Ga0316596_10040483 236
133 3300037068 Ga0373925_0234286 Ga0373925_0234286_305_1051 236
134 3300046517 Ga0495630_0179376 Ga0495630_0179376_130_879 236
135 3300046528 Ga0495642_0089916 Ga0495642_0089916_55_801 236
136 3300046557 Ga0495622_0002232 Ga0495622_0002232_4577_5323 236
137 3300046557 Ga0495622_0023601 Ga0495622_0023601_1771_2520 236
138 3300046557 Ga0495622_0036684 Ga0495622_0036684_108_857 236
139 3300046648 Ga0495611_0003854 Ga0495611_0003854_2469_3215 236
140 3300046694 Ga0495649_0067805 Ga0495649_0067805_1142_1888 236
141 3300046794 Ga0495589_0034018 Ga0495589_0034018_121_870 236
142 3300047320 Ga0495672_0000485 Ga0495672_0000485_34918_35664 236
143 3300047323 Ga0495683_0085490 Ga0495683_0085490_209_955 236
144 3300048091 Ga0495626_0013601 Ga0495626_0013601_145_891 236
145 3300049571 Ga0501034_0473254 Ga0501034_0473254_354_1088 236
146 3300053080 Ga0500635_0037276 Ga0500635_0037276_188_934 236
147 3300053178 Ga0500637_0000548 Ga0500637_0000548_8774_9520 236
148 3300031728 Ga0316578_10110241 Ga0316578_101102413 237
149 3300031733 Ga0316577_10004288 Ga0316577_100042887 237
150 3300031852 Ga0307410_10451085 Ga0307410_104510852 237
151 3300031995 Ga0307409_100041268 Ga0307409_1000412683 237
152 3300032126 Ga0307415_100024163 Ga0307415_1000241633 237
153 3300036712 Ga0316584_0001619 Ga0316584_0001619_9693_10475 237
154 3300048929 Ga0496126_0067036 Ga0496126_0067036_2396_3160 237
155 3300049570 Ga0501033_0003593 Ga0501033_0003593_9551_10375 237
156 3300049823 Ga0501044_0030092 Ga0501044_0030092_1780_2604 237
157 3300025901 Ga0207688_10075791 Ga0207688_100757914 238
158 3300026067 Ga0207678_10240372 Ga0207678_102403721 238
159 3300036647 Ga0316582_0063545 Ga0316582_0063545_1201_2055 238
160 3300036647 Ga0316582_0093384 Ga0316582_0093384_18_890 238
161 3300044712 Ga0453684_0016532 Ga0453684_0016532_2947_3735 238
162 3300044712 Ga0453684_0273623 Ga0453684_0273623_412_1170 238
163 3300048904 Ga0496101_0286226 Ga0496101_0286226_84_851 238
164 3300049571 Ga0501034_0002084 Ga0501034_0002084_24046_24783 238
165 3300031665 Ga0316575_10000404 Ga0316575_100004048 239
166 3300031691 Ga0316579_10002813 Ga0316579_100028137 239
167 3300031691 Ga0316579_10054990 Ga0316579_100549902 239
168 3300031727 Ga0316576_10209636 Ga0316576_102096361 239
169 3300031728 Ga0316578_10000845 Ga0316578_100008455 239
170 3300031733 Ga0316577_10002099 Ga0316577_100020999 239
171 3300031733 Ga0316577_10199467 Ga0316577_101994672 239
172 3300032133 Ga0316583_10002075 Ga0316583_100020755 239
173 3300032137 Ga0316585_10021794 Ga0316585_100217944 239
174 3300035398 Ga0316574_0006957 Ga0316574_0006957_2157_3017 239
175 3300036647 Ga0316582_0001828 Ga0316582_0001828_3592_4452 239
176 3300036647 Ga0316582_0043788 Ga0316582_0043788_1436_2308 239
177 3300036647 Ga0316582_0296328 Ga0316582_0296328_195_938 239
178 3300036647 Ga0316582_0330887 Ga0316582_0330887_47_919 239
179 3300036712 Ga0316584_0004501 Ga0316584_0004501_2146_3006 239
180 3300036712 Ga0316584_0047224 Ga0316584_0047224_549_1421 239
181 3300037588 Ga0316581_0009241 Ga0316581_0009241_531_1403 239
182 3300038735 Ga0400485_07515 Ga0400485_07515_2429_3205 239
183 3300038735 Ga0400485_17202 Ga0400485_17202_2485_3255 239
184 3300038741 Ga0400488_51584 Ga0400488_51584_565_1341 239
185 3300038742 Ga0400486_26096 Ga0400486_26096_15710_16489 239
186 3300038742 Ga0400486_29396 Ga0400486_29396_25941_26717 239
187 3300039062 Ga0400483_021395 Ga0400483_021395_98271_99050 239
188 3300039062 Ga0400483_269206 Ga0400483_269206_33376_34155 239
189 3300039093 Ga0400489_26427 Ga0400489_26427_2522_3301 239
190 3300039093 Ga0400489_35275 Ga0400489_35275_43775_44551 239
191 3300044712 Ga0453684_0256821 Ga0453684_0256821_706_1461 239
192 3300049568 Ga0501031_0043198 Ga0501031_0043198_1553_2293 239
193 3300009094 Ga0111539_10000063 Ga0111539_1000006356 240
194 3300027907 Ga0207428_10014148 Ga0207428_100141487 240
195 3300031727 Ga0316576_10058397 Ga0316576_100583973 240
196 3300031728 Ga0316578_10367909 Ga0316578_103679091 240
197 3300038742 Ga0400486_28434 Ga0400486_28434_15228_16010 240
198 3300044712 Ga0453684_0289226 Ga0453684_0289226_209_955 240
199 3300048920 Ga0496117_0013365 Ga0496117_0013365_1128_1883 240
200 3300048922 Ga0496119_0000072 Ga0496119_0000072_23541_24296 240
201 3300048923 Ga0496120_0000094 Ga0496120_0000094_57842_58597 240
202 3300048927 Ga0496124_0000340 Ga0496124_0000340_36284_37039 240
203 3300048928 Ga0496125_0228741 Ga0496125_0228741_360_1115 240
204 3300048929 Ga0496126_0000593 Ga0496126_0000593_16340_17095 240
205 3300050511 nmdc:mga08y16_3552_c1 nmdc:mga08y16_3552_c1_2661_3428 240
206 3300009098 Ga0105245_10427207 Ga0105245_104272071 241
207 3300031251 Ga0265327_10000014 Ga0265327_10000014176 241
208 2162886007 SwRhRL2b_contig_259194 SwRhRL2b_0676.00006270 242
209 3300003323 rootH1_10025955 rootH1_1002595521 242
210 3300005289 Ga0065704_10071733 Ga0065704_1007173311 242
211 3300039062 Ga0400483_149839 Ga0400483_149839_11270_12043 242
212 3300044712 Ga0453684_0360884 Ga0453684_0360884_759_1526 242
213 3300045051 Ga0451576_0507388 Ga0451576_0507388_306_1073 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00813

FliP

FliP family

93

285

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s3l-assembly1.cif.gz_C structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. 0.9464 49 242
6s3r-assembly1.cif.gz_A structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. 0.9349 52 242
6s3s-assembly1.cif.gz_D structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.934 52 242
6s3l-assembly1.cif.gz_C structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. 0.928 49 242
6r6b-assembly1.cif.gz_B structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). 0.9178 46 241
ID Description Score Start End Superfamily
af_O65090_275_342_1.10.8.100 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;rRNA adenine dimethylase, C-terminal domain 0.4907 132 175 1.10.8.100
af_C4J9Z7_68_180_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4393 135 204 1.10.10.1740
3wvoC02 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; 0.3833 50 191 1.10.132.100
af_O65090_275_342_1.10.8.100 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;rRNA adenine dimethylase, C-terminal domain 0.365 132 175 1.10.8.100
3wvoC02 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; 0.3599 50 191 1.10.132.100
ID Description Score Start End GO Terms
AF-A0A1V5K290-F1-model_v4 Flagellar biosynthetic protein FliP 0.9793 47 241 GO:0005886
GO:0009306
GO:0009425
GO:0044781
AF-A0A349MHA8-F1-model_v4 Flagellar biosynthetic protein FliP 0.9761 47 198 GO:0005886
GO:0009306
AF-A0A4R3MKZ1-F1-model_v4 Flagellar biosynthetic protein FliP 0.9743 58 242 GO:0005886
GO:0009306
GO:0009425
GO:0044781
AF-A0A535XP01-F1-model_v4 Flagellar biosynthetic protein FliP 0.9736 59 242 GO:0005886
GO:0009306
GO:0009425
GO:0044781
AF-A0A060QIK4-F1-model_v4 Flagellar biosynthetic protein FliP 0.9721 59 241 GO:0005886
GO:0009306
GO:0009425
GO:0044781

Feature Viewer

pLDDT pTM Quality
79.87 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map