F316770

General Info

Members Datasets Scaffolds Average Seq Length
207 142 414 173

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0432399|Ga0436363_0432399_1196_1816
Length 206
Sequence VRLSAAQRGLSNYKKSGYAATTTISKAADSSRTTRMDLKQHIRSIPDFPKPGILFYDISTLLAHPKAWQTTVHRLAEALQPHQPDLLVGIESRGFLVAAPLAYQLGRGFAMVRKQGKLPGPTARFTYHLEYGTDTIEIQEDAIKPGERVVVLDDLLATGGTMQAAINLVRQRGGEVTAAACIIELCFLNGRSRIDVPLTSMVAYES

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
130 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
131 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
134 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
135 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
138 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
139 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
140 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
141 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
142 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 0.48
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.7
Nodule 0
Rhizoplane 0.48
Rhizosphere 82.13
Stem 0
Stem Tuber 0
Unclassified 3.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0432399 3300039450 Unclassified 2093
2 Ga0055536_1027357 3300003781 Bacteria 1578
3 Ga0055530_10043647 3300003791 Unclassified 1080
4 Ga0055531_10014763 3300003794 Bacteria 3495
5 Ga0065704_10019298 3300005289 Bacteria 1299
6 Ga0070669_100034048 3300005353 Bacteria 3688
7 Ga0070674_100003099 3300005356 Bacteria 9252
8 Ga0070709_10007327 3300005434 Bacteria 6046
9 Ga0070714_100025387 3300005435 Bacteria 4890
10 Ga0070714_100116778 3300005435 Bacteria 2369
11 Ga0070714_100316180 3300005435 Bacteria 1459
12 Ga0070713_100010253 3300005436 Bacteria 6765
13 Ga0070713_100460105 3300005436 Bacteria 1196
14 Ga0070713_100461720 3300005436 Bacteria 1194
15 Ga0070713_100538851 3300005436 Bacteria 1104
16 Ga0070713_101154496 3300005436 Unclassified 749
17 Ga0070710_10002218 3300005437 Bacteria 9174
18 Ga0070710_10103308 3300005437 Bacteria 1701
19 Ga0070711_100010652 3300005439 Bacteria 5696
20 Ga0070711_100113239 3300005439 Bacteria 1995
21 Ga0070711_100191958 3300005439 Bacteria 1571
22 Ga0070711_100319403 3300005439 Bacteria 1240
23 Ga0070700_100974858 3300005441 Bacteria 695
24 Ga0070708_100532083 3300005445 Bacteria 1109
25 Ga0070708_101356425 3300005445 Bacteria 664
26 Ga0070681_10072520 3300005458 Bacteria 3406
27 Ga0070681_10679100 3300005458 Bacteria 945
28 Ga0068867_101335467 3300005459 Bacteria 663
29 Ga0070698_100009998 3300005471 Bacteria 10139
30 Ga0070698_100160442 3300005471 Bacteria 2192
31 Ga0070699_100382168 3300005518 Bacteria 1271
32 Ga0070684_100361610 3300005535 Bacteria 1336
33 Ga0070697_100273375 3300005536 Bacteria 1449
34 Ga0070697_100623264 3300005536 Bacteria 949
35 Ga0070696_100016587 3300005546 Bacteria 4964
36 Ga0070696_100359986 3300005546 Bacteria 1129
37 Ga0070704_100628312 3300005549 Bacteria 946
38 Ga0068866_10019201 3300005718 Bacteria 3106
39 Ga0068861_100122625 3300005719 Bacteria 2099
40 Ga0068861_101497959 3300005719 Bacteria 662
41 Ga0068860_100056609 3300005843 Bacteria 3727
42 Ga0068862_100009031 3300005844 Bacteria 8249
43 Ga0081538_10001311 3300005981 Bacteria 25698
44 Ga0081540_1005961 3300005983 Bacteria 8984
45 Ga0081539_10024193 3300005985 Bacteria 3950
46 Ga0070717_10001664 3300006028 Bacteria 15451
47 Ga0070717_10152350 3300006028 Bacteria 2001
48 Ga0070712_100008438 3300006175 Bacteria 6483
49 Ga0070712_101196931 3300006175 Bacteria 661
50 Ga0075366_10029271 3300006195 Bacteria 3235
51 Ga0075428_100317674 3300006844 Bacteria 1674
52 Ga0075431_100204776 3300006847 Bacteria 2017
53 Ga0075429_100862253 3300006880 Bacteria 793
54 Ga0099795_10012733 3300007788 Bacteria 2560
55 Ga0099795_10031365 3300007788 Bacteria 1829
56 Ga0105240_10414594 3300009093 Bacteria 1514
57 Ga0105240_10699955 3300009093 Bacteria 1106
58 Ga0111539_10000097 3300009094 Bacteria 91946
59 Ga0111539_11014996 3300009094 Bacteria 964
60 Ga0099796_10028475 3300010159 Bacteria 1794
61 Ga0099796_10060843 3300010159 Bacteria 1338
62 Ga0163163_11074836 3300014325 Bacteria 868
63 Ga0157380_10235942 3300014326 Bacteria 1646
64 Ga0157379_10210006 3300014968 Bacteria 1762
65 Ga0213872_10038538 3300021361 Bacteria 2181
66 Ga0213872_10055130 3300021361 Bacteria 1802
67 Ga0213874_10052642 3300021377 Unclassified 1253
68 Ga0213875_10225152 3300021388 Bacteria 883
69 Ga0213871_10084251 3300021441 Bacteria 914
70 Ga0209148_1000583 3300025254 Bacteria 33478
71 Ga0209233_1044638 3300025261 Bacteria 937
72 Ga0209455_1000673 3300025272 Bacteria 20495
73 Ga0209676_1000049 3300025292 Bacteria 403210
74 Ga0209050_1022587 3300025298 Unclassified 2249
75 Ga0209050_1084580 3300025298 Bacteria 665
76 Ga0209257_1000376 3300025304 Bacteria 89065
77 Ga0207642_10003884 3300025899 Bacteria 4765
78 Ga0207699_10101920 3300025906 Bacteria 1823
79 Ga0207707_10115225 3300025912 Bacteria 2349
80 Ga0207707_10467046 3300025912 Bacteria 1079
81 Ga0207695_10463316 3300025913 Bacteria 1150
82 Ga0207693_10005585 3300025915 Bacteria 10452
83 Ga0207693_10006704 3300025915 Bacteria 9508
84 Ga0207693_10032882 3300025915 Bacteria 4094
85 Ga0207663_10003442 3300025916 Bacteria 7748
86 Ga0207663_10136754 3300025916 Bacteria 1701
87 Ga0207663_10223085 3300025916 Bacteria 1372
88 Ga0207663_11055266 3300025916 Bacteria 653
89 Ga0207660_10787932 3300025917 Bacteria 776
90 Ga0207681_10129434 3300025923 Bacteria 1864
91 Ga0207700_10055503 3300025928 Bacteria 2978
92 Ga0207700_10183992 3300025928 Bacteria 1751
93 Ga0207700_10260296 3300025928 Bacteria 1485
94 Ga0207700_10298582 3300025928 Bacteria 1390
95 Ga0207664_10173534 3300025929 Bacteria 1847
96 Ga0207664_10182057 3300025929 Bacteria 1804
97 Ga0207664_10676746 3300025929 Bacteria 928
98 Ga0207669_10002800 3300025937 Bacteria 7472
99 Ga0207665_10062078 3300025939 Bacteria 2535
100 Ga0207703_10306986 3300026035 Bacteria 1449
101 Ga0207678_10748234 3300026067 Bacteria 862
102 Ga0207708_10693359 3300026075 Bacteria 870
103 Ga0207648_10455248 3300026089 Bacteria 1166
104 Ga0207675_100019729 3300026118 Bacteria 6292
105 Ga0207428_10000211 3300027907 Bacteria 80851
106 Ga0207428_10287536 3300027907 Bacteria 1219
107 Ga0268265_10015446 3300028380 Bacteria 5226
108 Ga0268264_10042459 3300028381 Bacteria 3764
109 Ga0307517_10116487 3300028786 Bacteria 2000
110 Ga0265325_10056882 3300031241 Bacteria 1996
111 Ga0265325_10308851 3300031241 Bacteria 705
112 Ga0265340_10056286 3300031247 Bacteria 1892
113 Ga0265339_10029145 3300031249 Bacteria 3134
114 Ga0265331_10000326 3300031250 Bacteria 51446
115 Ga0265327_10009533 3300031251 Bacteria 6988
116 Ga0265327_10010076 3300031251 Bacteria 6705
117 Ga0265316_10157390 3300031344 Bacteria 1700
118 Ga0265316_10416300 3300031344 Bacteria 966
119 Ga0307513_10052702 3300031456 Bacteria 4379
120 Ga0307513_10536324 3300031456 Bacteria 884
121 Ga0307408_100647011 3300031548 Bacteria 945
122 Ga0307408_100901115 3300031548 Bacteria 809
123 Ga0265313_10000465 3300031595 Bacteria 42567
124 Ga0265313_10004662 3300031595 Bacteria 10367
125 Ga0316575_10195715 3300031665 Bacteria 841
126 Ga0307405_10215238 3300031731 Bacteria 1406
127 Ga0307413_10434726 3300031824 Bacteria 1037
128 Ga0307407_10058417 3300031903 Bacteria 2242
129 Ga0307412_10320025 3300031911 Bacteria 1234
130 Ga0307409_100928244 3300031995 Bacteria 885
131 Ga0307414_10452579 3300032004 Bacteria 1126
132 Ga0307411_10021486 3300032005 Bacteria 3778
133 Ga0307411_10260589 3300032005 Bacteria 1369
134 Ga0316053_101284 3300032120 Unclassified 1312
135 Ga0307415_101510197 3300032126 Bacteria 643
136 Ga0373923_0215186 3300035111 Bacteria 892
137 Ga0373927_0084147 3300035695 Bacteria 2063
138 Ga0373937_0155060 3300036401 Bacteria 2146
139 Ga0373925_0103845 3300037068 Bacteria 2188
140 Ga0395899_0038918 3300037312 Bacteria 3561
141 Ga0395899_0119206 3300037312 Bacteria 1892
142 Ga0395900_0407100 3300037418 Bacteria 1323
143 Ga0395900_0579569 3300037418 Bacteria 1064
144 Ga0436364_0798411 3300037853 Bacteria 1118
145 Ga0436364_1074642 3300037853 Bacteria 865
146 Ga0395901_0045548 3300038443 Bacteria 4553
147 Ga0436365_1519216 3300039437 Unclassified 552
148 Ga0436365_1768400 3300039437 Bacteria 916
149 Ga0436365_1880932 3300039437 Bacteria 1225
150 Ga0436360_0619619 3300039438 Bacteria 1187
151 Ga0436360_0917299 3300039438 Bacteria 1509
152 Ga0436360_1211722 3300039438 Bacteria 2011
153 Ga0436360_1238413 3300039438 Bacteria 1827
154 Ga0436361_0071465 3300039447 Bacteria 1373
155 Ga0436361_0604004 3300039447 Bacteria 7673
156 Ga0436361_0622018 3300039447 Bacteria 3428
157 Ga0436361_0670973 3300039447 Bacteria 911
158 Ga0436361_0718183 3300039447 Bacteria 2457
159 Ga0436361_1004503 3300039447 Bacteria 7769
160 Ga0436363_0398244 3300039450 Bacteria 604
161 Ga0436363_0719557 3300039450 Bacteria 5247
162 Ga0436362_0130971 3300039453 Unclassified 1149
163 Ga0495652_0676667 3300046529 Bacteria 696
164 Ga0495686_0144600 3300047472 Bacteria 1401
165 Ga0496112_0807606 3300048915 Bacteria 863
166 Ga0496126_0046774 3300048929 Bacteria 3965
167 Ga0501034_0381758 3300049571 Bacteria 1334
168 Ga0501037_0129061 3300049573 Bacteria 1814
169 Ga0501043_0439052 3300049579 Bacteria 982
170 Ga0501047_0081386 3300049581 Bacteria 3113
171 Ga0501067_0106302 3300049583 Bacteria 1560
172 Ga0501070_0160425 3300049586 Bacteria 1854
173 Ga0501073_0554078 3300049589 Bacteria 794
174 Ga0501073_0628595 3300049589 Bacteria 741
175 Ga0501075_0145538 3300049591 Bacteria 1806
176 Ga0501076_0351100 3300049592 Bacteria 1211
177 Ga0501077_0007245 3300049593 Bacteria 6842
178 Ga0501080_0231388 3300049742 Bacteria 1689
179 Ga0501080_0304457 3300049742 Bacteria 1445
180 Ga0501080_0568807 3300049742 Bacteria 1008
181 Ga0501080_0573991 3300049742 Bacteria 1003
182 Ga0501080_1003651 3300049742 Bacteria 724
183 Ga0501083_0016604 3300049744 Bacteria 5148
184 Ga0501044_0010628 3300049823 Bacteria 9986
185 Ga0501044_0284774 3300049823 Bacteria 1585
186 nmdc:mga03683_429295_c1 3300050489 Bacteria 634
187 nmdc:mga05p37_104934_c1 3300050507 Bacteria 3477
188 nmdc:mga09592_573385_c1 3300050508 Bacteria 968
189 nmdc:mga06r32_395103_c1 3300050510 Bacteria 1365
190 nmdc:mga08y16_179_c1 3300050511 Bacteria 56078
191 nmdc:mga08y16_493327_c1 3300050511 Bacteria 1245
192 nmdc:mga0n895_314281_c1 3300050512 Bacteria 1587
193 nmdc:mga0a205_680886_c1 3300050515 Bacteria 879
194 Ga0500644_0284210 3300053088 Bacteria 705
195 Ga0500646_0025791 3300053090 Bacteria 1590
196 Ga0500641_0018854 3300053096 Bacteria 2601
197 Ga0500555_004602 3300053103 Bacteria 3918
198 Ga0500595_000692 3300053119 Bacteria 20111
199 Ga0500609_022244 3300053731 Bacteria 867
200 Ga0590077_015419 3300059426 Bacteria 1598
201 Ga0501082_0161677 3300060353 Bacteria 1946
202 2512035722 2511231221 Bacteria 6846400
203 2599100379 2597490356 Bacteria 7030811
204 2846956393 2846952575 Bacteria 6587527
205 2848862029 2848858292 Bacteria 7391279
206 2883356154 2883354860 Bacteria 5865246
207 8054007889 8054002106 Bacteria 7987183
208 Ga0436363_0432399
209 Ga0055536_1027357
210 Ga0055530_10043647
211 Ga0055531_10014763
212 Ga0065704_10019298
213 Ga0070669_100034048
214 Ga0070674_100003099
215 Ga0070709_10007327
216 Ga0070714_100025387
217 Ga0070714_100116778
218 Ga0070714_100316180
219 Ga0070713_100010253
220 Ga0070713_100460105
221 Ga0070713_100461720
222 Ga0070713_100538851
223 Ga0070713_101154496
224 Ga0070710_10002218
225 Ga0070710_10103308
226 Ga0070711_100010652
227 Ga0070711_100113239
228 Ga0070711_100191958
229 Ga0070711_100319403
230 Ga0070700_100974858
231 Ga0070708_100532083
232 Ga0070708_101356425
233 Ga0070681_10072520
234 Ga0070681_10679100
235 Ga0068867_101335467
236 Ga0070698_100009998
237 Ga0070698_100160442
238 Ga0070699_100382168
239 Ga0070684_100361610
240 Ga0070697_100273375
241 Ga0070697_100623264
242 Ga0070696_100016587
243 Ga0070696_100359986
244 Ga0070704_100628312
245 Ga0068866_10019201
246 Ga0068861_100122625
247 Ga0068861_101497959
248 Ga0068860_100056609
249 Ga0068862_100009031
250 Ga0081538_10001311
251 Ga0081540_1005961
252 Ga0081539_10024193
253 Ga0070717_10001664
254 Ga0070717_10152350
255 Ga0070712_100008438
256 Ga0070712_101196931
257 Ga0075366_10029271
258 Ga0075428_100317674
259 Ga0075431_100204776
260 Ga0075429_100862253
261 Ga0099795_10012733
262 Ga0099795_10031365
263 Ga0105240_10414594
264 Ga0105240_10699955
265 Ga0111539_10000097
266 Ga0111539_11014996
267 Ga0099796_10028475
268 Ga0099796_10060843
269 Ga0163163_11074836
270 Ga0157380_10235942
271 Ga0157379_10210006
272 Ga0213872_10038538
273 Ga0213872_10055130
274 Ga0213874_10052642
275 Ga0213875_10225152
276 Ga0213871_10084251
277 Ga0209148_1000583
278 Ga0209233_1044638
279 Ga0209455_1000673
280 Ga0209676_1000049
281 Ga0209050_1022587
282 Ga0209050_1084580
283 Ga0209257_1000376
284 Ga0207642_10003884
285 Ga0207699_10101920
286 Ga0207707_10115225
287 Ga0207707_10467046
288 Ga0207695_10463316
289 Ga0207693_10005585
290 Ga0207693_10006704
291 Ga0207693_10032882
292 Ga0207663_10003442
293 Ga0207663_10136754
294 Ga0207663_10223085
295 Ga0207663_11055266
296 Ga0207660_10787932
297 Ga0207681_10129434
298 Ga0207700_10055503
299 Ga0207700_10183992
300 Ga0207700_10260296
301 Ga0207700_10298582
302 Ga0207664_10173534
303 Ga0207664_10182057
304 Ga0207664_10676746
305 Ga0207669_10002800
306 Ga0207665_10062078
307 Ga0207703_10306986
308 Ga0207678_10748234
309 Ga0207708_10693359
310 Ga0207648_10455248
311 Ga0207675_100019729
312 Ga0207428_10000211
313 Ga0207428_10287536
314 Ga0268265_10015446
315 Ga0268264_10042459
316 Ga0307517_10116487
317 Ga0265325_10056882
318 Ga0265325_10308851
319 Ga0265340_10056286
320 Ga0265339_10029145
321 Ga0265331_10000326
322 Ga0265327_10009533
323 Ga0265327_10010076
324 Ga0265316_10157390
325 Ga0265316_10416300
326 Ga0307513_10052702
327 Ga0307513_10536324
328 Ga0307408_100647011
329 Ga0307408_100901115
330 Ga0265313_10000465
331 Ga0265313_10004662
332 Ga0316575_10195715
333 Ga0307405_10215238
334 Ga0307413_10434726
335 Ga0307407_10058417
336 Ga0307412_10320025
337 Ga0307409_100928244
338 Ga0307414_10452579
339 Ga0307411_10021486
340 Ga0307411_10260589
341 Ga0316053_101284
342 Ga0307415_101510197
343 Ga0373923_0215186
344 Ga0373927_0084147
345 Ga0373937_0155060
346 Ga0373925_0103845
347 Ga0395899_0038918
348 Ga0395899_0119206
349 Ga0395900_0407100
350 Ga0395900_0579569
351 Ga0436364_0798411
352 Ga0436364_1074642
353 Ga0395901_0045548
354 Ga0436365_1519216
355 Ga0436365_1768400
356 Ga0436365_1880932
357 Ga0436360_0619619
358 Ga0436360_0917299
359 Ga0436360_1211722
360 Ga0436360_1238413
361 Ga0436361_0071465
362 Ga0436361_0604004
363 Ga0436361_0622018
364 Ga0436361_0670973
365 Ga0436361_0718183
366 Ga0436361_1004503
367 Ga0436363_0398244
368 Ga0436363_0719557
369 Ga0436362_0130971
370 Ga0495652_0676667
371 Ga0495686_0144600
372 Ga0496112_0807606
373 Ga0496126_0046774
374 Ga0501034_0381758
375 Ga0501037_0129061
376 Ga0501043_0439052
377 Ga0501047_0081386
378 Ga0501067_0106302
379 Ga0501070_0160425
380 Ga0501073_0554078
381 Ga0501073_0628595
382 Ga0501075_0145538
383 Ga0501076_0351100
384 Ga0501077_0007245
385 Ga0501080_0231388
386 Ga0501080_0304457
387 Ga0501080_0568807
388 Ga0501080_0573991
389 Ga0501080_1003651
390 Ga0501083_0016604
391 Ga0501044_0010628
392 Ga0501044_0284774
393 nmdc:mga03683_429295_c1
394 nmdc:mga05p37_104934_c1
395 nmdc:mga09592_573385_c1
396 nmdc:mga06r32_395103_c1
397 nmdc:mga08y16_179_c1
398 nmdc:mga08y16_493327_c1
399 nmdc:mga0n895_314281_c1
400 nmdc:mga0a205_680886_c1
401 Ga0500644_0284210
402 Ga0500646_0025791
403 Ga0500641_0018854
404 Ga0500555_004602
405 Ga0500595_000692
406 Ga0500609_022244
407 Ga0590077_015419
408 Ga0501082_0161677
409 2512035722
410 2599100379
411 2846956393
412 2848862029
413 2883356154
414 8054007889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

57

203

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9762 3 172
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9722 3 172
4m0k-assembly2.cif.gz_D crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775. 0.9573 3 172
5y4a-assembly1.cif.gz_B cadmium directed assembly of adenine phosphoribosyltransferase from yersinia pseudotuberculosis. 0.9537 3 174
4x44-assembly1.cif.gz_A-2 crystal structure of mutant r89q of human adenine phosphoribosyltransferase 0.9499 3 173
ID Description Score Start End Superfamily
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.966 3 172 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.958 3 133 3.40.50.2020
4m0kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9561 3 172 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.953 3 174 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.953 3 172 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1L3RG64-F1-model_v4 deleted 0.9918 1 174
AF-A0A2D7Z748-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9916 28 174 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-G6XJX8-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9896 1 174 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-G8APJ1-F1-model_v4 deleted 0.989 1 174
AF-B6IT90-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9885 1 174 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map