F316731

General Info

Members Datasets Scaffolds Average Seq Length
207 147 189 329

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0094780|Ga0316584_0094780_192_1268
Length 358
Sequence MTIKENASLIMHHTSLILTKERRMNEQTFKALVVEEMADKTFVRSIKDRSVSELPEGDVLVRVDFSSLNYKDALSAAGNKGVTRSYPHTPGIDAAGIVEESRDASFSQGDAVIVTSYDLGMNTPGGFGRFIRVPAGWVVKLPENLSLRESMIYGTAGFTAGLSVHEIVNHLKPDVGSVLVTGATGGVGSIAVGLLSKLGYDVTAVSGKPDAAAFLSNLGAETVVSREQALDESGRPLLKSVWAGVVDTVGGDMLATAVKSTQPGGTVTCCGNVASPNLSLTVFPFILRGVRLIGIDSQNCPMAHRAGIWQKLSAEWKLDCLEDLCREISLTELSPMIDKILKGGIQGRTLVNLEGSVA

Samples

Sample ID Description Type Environment
1 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
2 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
5 2643221594 Achromobacter sp. Root170 Isolate Unclassified
6 2643221621 Achromobacter sp. Root83 Isolate Unclassified
7 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
8 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
9 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
10 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
11 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
12 2858950400 Achromobacter sp. K91 Isolate Unclassified
13 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
14 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
15 2941479691
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
68 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
69 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
79 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
80 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
81 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
82 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
83 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
84 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
85 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
88 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
89 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
94 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
146 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
147 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.37
Metatranscriptomes 1.93
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0.97
Rhizoplane 1.45
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 21.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10002420 3300003322 Bacteria 16660
2 rootL2_10189949 3300003322 Unclassified 4018
3 Ga0055531_10000145 3300003794 Bacteria 81767
4 Ga0065704_10075911 3300005289 Bacteria 5357
5 Ga0070670_100470034 3300005331 Bacteria 1116
6 Ga0070675_100066147 3300005354 Bacteria 2989
7 Ga0070674_100256756 3300005356 Bacteria 1375
8 Ga0070673_100173207 3300005364 Bacteria 1843
9 Ga0070667_100019705 3300005367 Bacteria 5596
10 Ga0070708_100253337 3300005445 Bacteria 1654
11 Ga0070663_100047494 3300005455 Bacteria 3041
12 Ga0068867_100199157 3300005459 Bacteria 1602
13 Ga0070707_100118658 3300005468 Bacteria 2568
14 Ga0070698_100059195 3300005471 Bacteria 3869
15 Ga0070672_100364957 3300005543 Bacteria 1233
16 Ga0068857_100070616 3300005577 Bacteria 3111
17 Ga0068870_10025600 3300005840 Bacteria 2931
18 Ga0068863_100021424 3300005841 Bacteria 6168
19 Ga0068860_100153055 3300005843 Bacteria 2221
20 Ga0068862_100125978 3300005844 Bacteria 2261
21 Ga0075362_10015414 3300006177 Bacteria 3109
22 Ga0099826_10000004 3300006948 Bacteria 802669
23 Ga0105240_10151497 3300009093 Bacteria 2761
24 Ga0105243_10180379 3300009148 Bacteria 1836
25 Ga0105248_10098367 3300009177 Bacteria 3296
26 Ga0157373_10005357 3300013100 Bacteria 9641
27 Ga0157371_10031011 3300013102 Bacteria 3852
28 Ga0157371_10046511 3300013102 Bacteria 3086
29 Ga0157372_10031840 3300013307 Bacteria 5779
30 Ga0157372_10313364 3300013307 Bacteria 1826
31 Ga0157372_10414883 3300013307 Bacteria 1569
32 Ga0209257_1000013 3300025304 Bacteria 1047305
33 Ga0207645_10325449 3300025907 Bacteria 1026
34 Ga0207643_10035459 3300025908 Bacteria 2798
35 Ga0207705_10051130 3300025909 Bacteria 2975
36 Ga0207646_10055232 3300025922 Bacteria 3551
37 Ga0207659_10020093 3300025926 Bacteria 4407
38 Ga0207659_10027206 3300025926 Bacteria 3869
39 Ga0207651_10139040 3300025960 Bacteria 1873
40 Ga0207658_10099948 3300025986 Bacteria 2270
41 Ga0207678_10042084 3300026067 Bacteria 3959
42 Ga0207641_10128253 3300026088 Bacteria 2274
43 Ga0209371_1024138 3300027312 Bacteria 1420
44 Ga0209282_1000035 3300027666 Bacteria 137066
45 Ga0268265_10074633 3300028380 Bacteria 2654
46 Ga0268265_10080584 3300028380 Bacteria 2568
47 Ga0268265_10145290 3300028380 Bacteria 1992
48 Ga0268264_10297478 3300028381 Bacteria 1518
49 Ga0268256_1024415 3300030500 Bacteria 1552
50 Ga0265330_10003033 3300031235 Bacteria 8913
51 Ga0265331_10008240 3300031250 Bacteria 5942
52 Ga0265327_10019655 3300031251 Bacteria 4144
53 Ga0316576_10002301 3300031727 Bacteria 10828
54 Ga0316576_10011112 3300031727 Bacteria 5881
55 Ga0316576_10040246 3300031727 Bacteria 3359
56 Ga0316576_10048326 3300031727 Bacteria 3085
57 Ga0316576_10051893 3300031727 Bacteria 2985
58 Ga0316576_10167054 3300031727 Bacteria 1660
59 Ga0316576_10204002 3300031727 Bacteria 1489
60 Ga0316578_10015203 3300031728 Bacteria 4133
61 Ga0316578_10062055 3300031728 Bacteria 2203
62 Ga0316577_10003100 3300031733 Bacteria 8351
63 Ga0316577_10055036 3300031733 Bacteria 2220
64 Ga0316577_10110764 3300031733 Bacteria 1540
65 Ga0316577_10119194 3300031733 Bacteria 1483
66 Ga0307414_10000104 3300032004 Bacteria 60113
67 Ga0307414_10202540 3300032004 Bacteria 1616
68 Ga0307415_100150855 3300032126 Bacteria 1789
69 Ga0316583_10000174 3300032133 Bacteria 16244
70 Ga0316583_10008100 3300032133 Unclassified 3787
71 Ga0316585_10003498 3300032137 Bacteria 4325
72 Ga0316580_10006264 3300032139 Unclassified 3510
73 Ga0316593_10081952 3300032168 Unclassified 1127
74 Ga0316593_10083449 3300032168 Unclassified 1118
75 Ga0316592_1002281 3300033524 Unclassified 3287
76 Ga0316586_1007101 3300033527 Bacteria 1624
77 Ga0316574_0018917 3300035398 Bacteria 4056
78 Ga0316574_0071525 3300035398 Bacteria 2191
79 Ga0316582_0003626 3300036647 Bacteria 7616
80 Ga0316582_0158138 3300036647 Bacteria 1534
81 Ga0316584_0011478 3300036712 Bacteria 6226
82 Ga0316584_0049111 3300036712 Bacteria 3153
83 Ga0316584_0059862 3300036712 Bacteria 2852
84 Ga0316584_0088870 3300036712 Bacteria 2313
85 Ga0316584_0094780 3300036712 Bacteria 2235
86 Ga0316584_0130650 3300036712 Bacteria 1876
87 Ga0316584_0198424 3300036712 Bacteria 1481
88 Ga0395899_0033631 3300037312 Bacteria 3850
89 Ga0395900_0077199 3300037418 Bacteria 3422
90 Ga0395900_0085660 3300037418 Bacteria 3238
91 Ga0395901_0103744 3300038443 Bacteria 2983
92 Ga0395901_0130250 3300038443 Bacteria 2643
93 Ga0400484_22110 3300038725 Bacteria 12193
94 Ga0400490_06016 3300038726 Bacteria 3667
95 Ga0400485_12648 3300038735 Bacteria 70172
96 Ga0400488_01011 3300038741 Bacteria 21514
97 Ga0400488_31115 3300038741 Bacteria 3317
98 Ga0400486_19650 3300038742 Bacteria 31391
99 Ga0400486_32820 3300038742 Bacteria 16746
100 Ga0400483_267336 3300039062 Bacteria 5023
101 Ga0400489_19568 3300039093 Bacteria 3730
102 Ga0400489_36800 3300039093 Bacteria 19838
103 Ga0400489_55776 3300039093 Bacteria 15112
104 Ga0400487_35590 3300039110 Bacteria 25492
105 Ga0436361_1121067 3300039447 Bacteria 3126
106 Ga0439445_0008841 3300042004 Bacteria 2365
107 Ga0450911_000087 3300042115 Bacteria 36997
108 Ga0450905_011307 3300042142 Bacteria 1247
109 Ga0451577_0000491 3300042876 Bacteria 67041
110 Ga0451577_0009558 3300042876 Bacteria 9324
111 Ga0451577_0105354 3300042876 Bacteria 2520
112 Ga0453684_0001444 3300044712 Bacteria 67679
113 Ga0453684_0005514 3300044712 Bacteria 24972
114 Ga0451576_0597639 3300045051 Bacteria 1160
115 Ga0495591_050266 3300046458 Bacteria 1142
116 Ga0495605_0004816 3300046474 Bacteria 7893
117 Ga0495584_0013128 3300046491 Bacteria 4225
118 Ga0495584_0047026 3300046491 Bacteria 2176
119 Ga0495585_0000187 3300046492 Bacteria 66273
120 Ga0495596_0000369 3300046500 Bacteria 28842
121 Ga0495607_0013465 3300046501 Bacteria 5358
122 Ga0495610_0000497 3300046512 Bacteria 40184
123 Ga0495616_0001191 3300046513 Bacteria 18342
124 Ga0495609_0001650 3300046538 Bacteria 14544
125 Ga0495633_0000002 3300046558 Bacteria 488754
126 Ga0495661_0010483 3300046665 Bacteria 6322
127 Ga0495671_0000914 3300046692 Bacteria 20938
128 Ga0495672_0141207 3300047320 Bacteria 1258
129 Ga0495684_0104751 3300047471 Bacteria 2138
130 Ga0496109_0379422 3300048912 Bacteria 1335
131 Ga0496116_0022397 3300048919 Bacteria 4734
132 Ga0496121_0000396 3300048924 Bacteria 87716
133 Ga0496121_0004667 3300048924 Bacteria 18198
134 Ga0496121_0015026 3300048924 Bacteria 8150
135 Ga0496121_0015745 3300048924 Bacteria 7879
136 Ga0496122_0000044 3300048925 Bacteria 280179
137 Ga0496122_0000451 3300048925 Bacteria 85677
138 Ga0496122_0005257 3300048925 Bacteria 15511
139 Ga0496122_0073531 3300048925 Bacteria 2423
140 Ga0496123_0000639 3300048926 Bacteria 58527
141 Ga0496123_0001401 3300048926 Bacteria 33755
142 Ga0496124_0080176 3300048927 Bacteria 2687
143 Ga0496124_0148043 3300048927 Bacteria 1845
144 Ga0496125_0007295 3300048928 Bacteria 11772
145 Ga0496125_0017127 3300048928 Bacteria 6924
146 Ga0496125_0150866 3300048928 Bacteria 1596
147 Ga0496125_0161625 3300048928 Bacteria 1520
148 Ga0496126_0008332 3300048929 Bacteria 11191
149 Ga0496126_0044050 3300048929 Bacteria 4112
150 Ga0496126_0094899 3300048929 Bacteria 2617
151 Ga0501031_0000224 3300049568 Bacteria 32404
152 Ga0501032_0001266 3300049569 Bacteria 20268
153 Ga0501033_0001627 3300049570 Bacteria 19724
154 Ga0501034_0000039 3300049571 Bacteria 237357
155 Ga0501034_0325271 3300049571 Bacteria 1470
156 Ga0501036_0000214 3300049572 Bacteria 38627
157 Ga0501036_0504455 3300049572 Bacteria 1007
158 Ga0501037_0000974 3300049573 Bacteria 21269
159 Ga0501038_0000133 3300049574 Bacteria 63587
160 Ga0501038_0149940 3300049574 Bacteria 1902
161 Ga0501039_0000146 3300049575 Bacteria 47895
162 Ga0501040_0074632 3300049576 Bacteria 2344
163 Ga0501043_0012372 3300049579 Bacteria 6674
164 Ga0501046_0000218 3300049580 Bacteria 59989
165 Ga0501047_0000787 3300049581 Bacteria 33222
166 Ga0501047_0025227 3300049581 Bacteria 5712
167 Ga0501047_0190144 3300049581 Bacteria 1917
168 Ga0501048_0007724 3300049582 Bacteria 8153
169 Ga0501067_0001775 3300049583 Bacteria 11844
170 Ga0501068_0000697 3300049584 Bacteria 17228
171 Ga0501069_0001612 3300049585 Bacteria 11171
172 Ga0501070_0046926 3300049586 Bacteria 3593
173 Ga0501070_0071727 3300049586 Bacteria 2867
174 Ga0501071_0341703 3300049587 Bacteria 1138
175 Ga0501072_0004773 3300049588 Bacteria 10320
176 Ga0501073_0000131 3300049589 Bacteria 48153
177 Ga0501074_0000116 3300049590 Bacteria 40213
178 Ga0501074_0200988 3300049590 Bacteria 1420
179 Ga0501079_0023987 3300049741 Bacteria 4679
180 Ga0501080_0000374 3300049742 Bacteria 34495
181 Ga0501035_0000052 3300049822 Bacteria 143038
182 Ga0501044_0000638 3300049823 Bacteria 42323
183 Ga0501045_0056274 3300049824 Bacteria 2876
184 nmdc:mga03683_3653_c1 3300050489 Bacteria 5003
185 Ga0501084_0002449 3300054114 Bacteria 14934
186 Ga0501082_0000630 3300060353 Bacteria 31079
187 Ga0501082_0262326 3300060353 Bacteria 1503
188 Ga0530510_0043775 3300061734 Bacteria 3234
189 Ga0530510_0385063 3300061734 Bacteria 1056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10325449 Ga0207645_103254491 285
2 3300045051 Ga0451576_0597639 Ga0451576_0597639_12_899 294
3 3300027312 Ga0209371_1024138 Ga0209371_10241382 299
4 3300030500 Ga0268256_1024415 Ga0268256_10244152 299
5 3300049572 Ga0501036_0504455 Ga0501036_0504455_20_943 306
6 3300005445 Ga0070708_100253337 Ga0070708_1002533372 307
7 3300005468 Ga0070707_100118658 Ga0070707_1001186582 307
8 3300005471 Ga0070698_100059195 Ga0070698_1000591953 307
9 3300025922 Ga0207646_10055232 Ga0207646_100552322 307
10 3300005354 Ga0070675_100066147 Ga0070675_1000661471 312
11 3300005364 Ga0070673_100173207 Ga0070673_1001732072 312
12 3300025926 Ga0207659_10027206 Ga0207659_100272063 312
13 3300025960 Ga0207651_10139040 Ga0207651_101390403 312
14 3300005577 Ga0068857_100070616 Ga0068857_1000706162 315
15 3300005840 Ga0068870_10025600 Ga0068870_100256002 315
16 3300025908 Ga0207643_10035459 Ga0207643_100354592 315
17 3300025926 Ga0207659_10020093 Ga0207659_100200932 315
18 3300028380 Ga0268265_10080584 Ga0268265_100805843 316
19 iso_pu_bacteria 646564506 646812292 317
20 iso_pu_bacteria 2690315857 2691331240 320
21 3300031733 Ga0316577_10055036 Ga0316577_100550362 321
22 iso_pu_bacteria 2721755487 2722728997 321
23 3300005455 Ga0070663_100047494 Ga0070663_1000474943 322
24 3300026067 Ga0207678_10042084 Ga0207678_100420842 322
25 3300035398 Ga0316574_0018917 Ga0316574_0018917_2587_3564 322
26 3300036647 Ga0316582_0003626 Ga0316582_0003626_906_1883 322
27 3300036712 Ga0316584_0198424 Ga0316584_0198424_186_1163 322
28 iso_pu_bacteria 8002745576 8002746030 322
29 iso_pu_bacteria 2510065055 2510291734 323
30 iso_pu_bacteria 2510065058 2510310255 323
31 iso_pu_bacteria 2919399522 2919400264 323
32 iso_pu_bacteria 2599185292 2599905123 324
33 iso_pu_bacteria 2600254943 2600401504 324
34 iso_pu_bacteria 2643221594 2643982174 324
35 iso_pu_bacteria 2643221621 2644122862 324
36 iso_pu_bacteria 2808606395 2809034288 324
37 iso_pu_bacteria 2857537821 2857539802 324
38 iso_pu_bacteria 2858950400 2858955247 324
39 iso_pu_bacteria 2941479691 2941479774 324
40 3300005367 Ga0070667_100019705 Ga0070667_1000197052 325
41 3300013307 Ga0157372_10313364 Ga0157372_103133642 325
42 3300025909 Ga0207705_10051130 Ga0207705_100511302 325
43 3300025986 Ga0207658_10099948 Ga0207658_100999482 325
44 3300037312 Ga0395899_0033631 Ga0395899_0033631_2100_3083 325
45 3300037418 Ga0395900_0085660 Ga0395900_0085660_1316_2299 325
46 3300038443 Ga0395901_0103744 Ga0395901_0103744_1202_2185 325
47 3300049571 Ga0501034_0325271 Ga0501034_0325271_451_1434 325
48 3300049574 Ga0501038_0149940 Ga0501038_0149940_528_1511 325
49 3300049581 Ga0501047_0190144 Ga0501047_0190144_146_1129 325
50 iso_pu_bacteria 2740891818 2740990856 325
51 iso_pu_bacteria 2904780799 2904784975 325
52 iso_pu_bacteria 8007371054 8007371366 325
53 3300005543 Ga0070672_100364957 Ga0070672_1003649571 326
54 3300013102 Ga0157371_10046511 Ga0157371_100465112 326
55 3300013307 Ga0157372_10414883 Ga0157372_104148832 326
56 3300031251 Ga0265327_10019655 Ga0265327_100196552 326
57 3300048912 Ga0496109_0379422 Ga0496109_0379422_296_1285 326
58 3300049568 Ga0501031_0000224 Ga0501031_0000224_25667_26656 326
59 3300049569 Ga0501032_0001266 Ga0501032_0001266_188_1177 326
60 3300049570 Ga0501033_0001627 Ga0501033_0001627_7209_8198 326
61 3300049571 Ga0501034_0000039 Ga0501034_0000039_58865_59854 326
62 3300049572 Ga0501036_0000214 Ga0501036_0000214_19138_20127 326
63 3300049573 Ga0501037_0000974 Ga0501037_0000974_8708_9697 326
64 3300049574 Ga0501038_0000133 Ga0501038_0000133_18714_19703 326
65 3300049575 Ga0501039_0000146 Ga0501039_0000146_3236_4225 326
66 3300049576 Ga0501040_0074632 Ga0501040_0074632_983_1972 326
67 3300049579 Ga0501043_0012372 Ga0501043_0012372_4234_5223 326
68 3300049580 Ga0501046_0000218 Ga0501046_0000218_36583_37572 326
69 3300049581 Ga0501047_0000787 Ga0501047_0000787_24885_25874 326
70 3300049581 Ga0501047_0025227 Ga0501047_0025227_3153_4139 326
71 3300049582 Ga0501048_0007724 Ga0501048_0007724_2467_3456 326
72 3300049583 Ga0501067_0001775 Ga0501067_0001775_4233_5222 326
73 3300049584 Ga0501068_0000697 Ga0501068_0000697_2413_3402 326
74 3300049585 Ga0501069_0001612 Ga0501069_0001612_638_1627 326
75 3300049586 Ga0501070_0046926 Ga0501070_0046926_234_1220 326
76 3300049586 Ga0501070_0071727 Ga0501070_0071727_668_1657 326
77 3300049587 Ga0501071_0341703 Ga0501071_0341703_91_1080 326
78 3300049588 Ga0501072_0004773 Ga0501072_0004773_6276_7265 326
79 3300049589 Ga0501073_0000131 Ga0501073_0000131_46325_47314 326
80 3300049590 Ga0501074_0000116 Ga0501074_0000116_11427_12416 326
81 3300049590 Ga0501074_0200988 Ga0501074_0200988_296_1282 326
82 3300049741 Ga0501079_0023987 Ga0501079_0023987_3503_4492 326
83 3300049742 Ga0501080_0000374 Ga0501080_0000374_20625_21614 326
84 3300049822 Ga0501035_0000052 Ga0501035_0000052_140769_141758 326
85 3300049823 Ga0501044_0000638 Ga0501044_0000638_27995_28984 326
86 3300049824 Ga0501045_0056274 Ga0501045_0056274_154_1143 326
87 3300054114 Ga0501084_0002449 Ga0501084_0002449_8803_9792 326
88 3300060353 Ga0501082_0000630 Ga0501082_0000630_7300_8289 326
89 3300060353 Ga0501082_0262326 Ga0501082_0262326_497_1486 326
90 3300061734 Ga0530510_0385063 Ga0530510_0385063_52_1041 326
91 3300005289 Ga0065704_10075911 Ga0065704_100759116 327
92 3300006177 Ga0075362_10015414 Ga0075362_100154142 327
93 3300013102 Ga0157371_10031011 Ga0157371_100310112 327
94 3300013307 Ga0157372_10031840 Ga0157372_100318402 327
95 3300032126 Ga0307415_100150855 Ga0307415_1001508552 327
96 3300037418 Ga0395900_0077199 Ga0395900_0077199_1618_2610 327
97 3300038443 Ga0395901_0130250 Ga0395901_0130250_1581_2573 327
98 3300039447 Ga0436361_1121067 Ga0436361_1121067_1383_2375 327
99 3300042876 Ga0451577_0105354 Ga0451577_0105354_489_1484 327
100 3300046491 Ga0495584_0013128 Ga0495584_0013128_393_1382 327
101 3300046491 Ga0495584_0047026 Ga0495584_0047026_660_1649 327
102 3300046492 Ga0495585_0000187 Ga0495585_0000187_9885_10874 327
103 3300046558 Ga0495633_0000002 Ga0495633_0000002_142892_143884 327
104 3300047471 Ga0495684_0104751 Ga0495684_0104751_195_1187 327
105 3300050489 nmdc:mga03683_3653_c1 nmdc:mga03683_3653_c1_1300_2286 327
106 3300003322 rootL2_10189949 rootL2_101899493 328
107 3300003794 Ga0055531_10000145 Ga0055531_1000014549 328
108 3300005331 Ga0070670_100470034 Ga0070670_1004700341 328
109 3300005356 Ga0070674_100256756 Ga0070674_1002567562 328
110 3300005459 Ga0068867_100199157 Ga0068867_1001991572 328
111 3300005841 Ga0068863_100021424 Ga0068863_1000214242 328
112 3300005843 Ga0068860_100153055 Ga0068860_1001530552 328
113 3300005844 Ga0068862_100125978 Ga0068862_1001259782 328
114 3300006948 Ga0099826_10000004 Ga0099826_10000004108 328
115 3300009148 Ga0105243_10180379 Ga0105243_101803792 328
116 3300009177 Ga0105248_10098367 Ga0105248_100983671 328
117 3300025304 Ga0209257_1000013 Ga0209257_100001390 328
118 3300026088 Ga0207641_10128253 Ga0207641_101282532 328
119 3300027666 Ga0209282_1000035 Ga0209282_10000358 328
120 3300028380 Ga0268265_10074633 Ga0268265_100746332 328
121 3300028380 Ga0268265_10145290 Ga0268265_101452902 328
122 3300028381 Ga0268264_10297478 Ga0268264_102974781 328
123 3300031235 Ga0265330_10003033 Ga0265330_100030335 328
124 3300031250 Ga0265331_10008240 Ga0265331_100082403 328
125 3300031727 Ga0316576_10167054 Ga0316576_101670541 328
126 3300032004 Ga0307414_10000104 Ga0307414_1000010416 328
127 3300042004 Ga0439445_0008841 Ga0439445_0008841_1234_2226 328
128 3300042115 Ga0450911_000087 Ga0450911_000087_14113_15105 328
129 3300042142 Ga0450905_011307 Ga0450905_011307_223_1215 328
130 3300042876 Ga0451577_0009558 Ga0451577_0009558_40_1035 328
131 3300044712 Ga0453684_0005514 Ga0453684_0005514_10412_11407 328
132 3300046458 Ga0495591_050266 Ga0495591_050266_122_1117 328
133 3300046474 Ga0495605_0004816 Ga0495605_0004816_6814_7809 328
134 3300046500 Ga0495596_0000369 Ga0495596_0000369_14698_15693 328
135 3300046501 Ga0495607_0013465 Ga0495607_0013465_3449_4444 328
136 3300046512 Ga0495610_0000497 Ga0495610_0000497_14984_15979 328
137 3300046513 Ga0495616_0001191 Ga0495616_0001191_4181_5176 328
138 3300046538 Ga0495609_0001650 Ga0495609_0001650_467_1462 328
139 3300046665 Ga0495661_0010483 Ga0495661_0010483_2801_3796 328
140 3300046692 Ga0495671_0000914 Ga0495671_0000914_6855_7850 328
141 3300047320 Ga0495672_0141207 Ga0495672_0141207_57_1052 328
142 3300048919 Ga0496116_0022397 Ga0496116_0022397_367_1362 328
143 3300048924 Ga0496121_0000396 Ga0496121_0000396_72876_73871 328
144 3300048924 Ga0496121_0004667 Ga0496121_0004667_6898_7893 328
145 3300048924 Ga0496121_0015026 Ga0496121_0015026_161_1156 328
146 3300048925 Ga0496122_0000451 Ga0496122_0000451_51703_52698 328
147 3300048925 Ga0496122_0005257 Ga0496122_0005257_7673_8668 328
148 3300048926 Ga0496123_0000639 Ga0496123_0000639_5522_6517 328
149 3300048926 Ga0496123_0001401 Ga0496123_0001401_7313_8308 328
150 3300048927 Ga0496124_0080176 Ga0496124_0080176_872_1867 328
151 3300048927 Ga0496124_0148043 Ga0496124_0148043_790_1785 328
152 3300048928 Ga0496125_0017127 Ga0496125_0017127_768_1763 328
153 3300048928 Ga0496125_0150866 Ga0496125_0150866_296_1288 328
154 3300048928 Ga0496125_0161625 Ga0496125_0161625_121_1116 328
155 3300048929 Ga0496126_0044050 Ga0496126_0044050_531_1526 328
156 3300048929 Ga0496126_0094899 Ga0496126_0094899_1228_2220 328
157 3300009093 Ga0105240_10151497 Ga0105240_101514972 329
158 3300013100 Ga0157373_10005357 Ga0157373_100053577 329
159 3300031727 Ga0316576_10051893 Ga0316576_100518933 329
160 3300032168 Ga0316593_10081952 Ga0316593_100819521 329
161 3300032168 Ga0316593_10083449 Ga0316593_100834491 329
162 3300036712 Ga0316584_0059862 Ga0316584_0059862_1285_2283 329
163 3300042876 Ga0451577_0000491 Ga0451577_0000491_48419_49423 329
164 3300044712 Ga0453684_0001444 Ga0453684_0001444_48419_49423 329
165 3300048929 Ga0496126_0008332 Ga0496126_0008332_2301_3314 329
166 3300031727 Ga0316576_10002301 Ga0316576_100023012 330
167 3300031727 Ga0316576_10011112 Ga0316576_100111122 330
168 3300031727 Ga0316576_10040246 Ga0316576_100402463 330
169 3300031727 Ga0316576_10048326 Ga0316576_100483263 330
170 3300031727 Ga0316576_10204002 Ga0316576_102040022 330
171 3300031728 Ga0316578_10015203 Ga0316578_100152032 330
172 3300031728 Ga0316578_10062055 Ga0316578_100620552 330
173 3300031733 Ga0316577_10003100 Ga0316577_100031006 330
174 3300031733 Ga0316577_10110764 Ga0316577_101107642 330
175 3300031733 Ga0316577_10119194 Ga0316577_101191941 330
176 3300032004 Ga0307414_10202540 Ga0307414_102025402 330
177 3300032133 Ga0316583_10000174 Ga0316583_100001749 330
178 3300032133 Ga0316583_10008100 Ga0316583_100081002 330
179 3300032137 Ga0316585_10003498 Ga0316585_100034981 330
180 3300032139 Ga0316580_10006264 Ga0316580_100062642 330
181 3300033524 Ga0316592_1002281 Ga0316592_10022813 330
182 3300033527 Ga0316586_1007101 Ga0316586_10071012 330
183 3300035398 Ga0316574_0071525 Ga0316574_0071525_310_1350 330
184 3300036647 Ga0316582_0158138 Ga0316582_0158138_333_1334 330
185 3300036712 Ga0316584_0011478 Ga0316584_0011478_861_1862 330
186 3300036712 Ga0316584_0049111 Ga0316584_0049111_1546_2547 330
187 3300036712 Ga0316584_0088870 Ga0316584_0088870_1125_2129 330
188 3300036712 Ga0316584_0094780 Ga0316584_0094780_192_1268 330
189 3300036712 Ga0316584_0130650 Ga0316584_0130650_152_1153 330
190 3300038735 Ga0400485_12648 Ga0400485_12648_8668_9669 330
191 3300038742 Ga0400486_19650 Ga0400486_19650_21752_22753 330
192 3300038742 Ga0400486_32820 Ga0400486_32820_15035_16036 330
193 3300039093 Ga0400489_36800 Ga0400489_36800_18611_19612 330
194 3300039093 Ga0400489_55776 Ga0400489_55776_8645_9646 330
195 3300039110 Ga0400487_35590 Ga0400487_35590_14287_15288 330
196 3300048924 Ga0496121_0015745 Ga0496121_0015745_895_1893 330
197 3300048925 Ga0496122_0000044 Ga0496122_0000044_151253_152257 330
198 3300048925 Ga0496122_0073531 Ga0496122_0073531_217_1218 330
199 3300048928 Ga0496125_0007295 Ga0496125_0007295_3299_4297 330
200 3300038725 Ga0400484_22110 Ga0400484_22110_1957_2961 331
201 3300038726 Ga0400490_06016 Ga0400490_06016_664_1668 331
202 3300038741 Ga0400488_01011 Ga0400488_01011_2054_3058 331
203 3300038741 Ga0400488_31115 Ga0400488_31115_691_1695 331
204 3300039062 Ga0400483_267336 Ga0400483_267336_1046_2050 331
205 3300039093 Ga0400489_19568 Ga0400489_19568_2452_3456 331
206 3300061734 Ga0530510_0043775 Ga0530510_0043775_195_1199 331
207 3300003322 rootL2_10002420 rootL2_100024203 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

186

314

0.92

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

55

143

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nx4-assembly1.cif.gz_B crystal structure of the yhdh oxidoreductase from salmonella enterica in complex with nadp 0.9802 19 347
3nx4-assembly1.cif.gz_B crystal structure of the yhdh oxidoreductase from salmonella enterica in complex with nadp 0.9742 19 347
1o8c-assembly1.cif.gz_D crystal structure of e. coli k-12 yhdh with bound nadph 0.9716 19 347
1o8c-assembly1.cif.gz_D crystal structure of e. coli k-12 yhdh with bound nadph 0.9657 19 347
5gxf-assembly1.cif.gz_B acryloyl-coa reductase acui from ruegeria pomeroyi dss-3 0.9624 18 345
ID Description Score Start End Superfamily
af_P26646_4_324_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9763 21 347 2.40.50.140
af_P26646_4_324_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9733 21 347 2.40.50.140
af_Q2FVQ0_5_96_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9618 59 147 3.90.180.10
af_Q2FVQ0_2_295_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9616 54 344 3.90.180.10
af_P26646_2_123_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9505 20 144 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A522BUH4-F1-model_v4 Oxidoreductase 0.9933 170 344 GO:0043957
AF-A0A258D1T8-F1-model_v4 Oxidoreductase 0.9912 102 347 GO:0043957
AF-A0A5S3T1J5-F1-model_v4 deleted 0.991 189 329
AF-A0A6N6XA74-F1-model_v4 deleted 0.9902 59 216
AF-A0A0D5MB40-F1-model_v4 Alcohol dehydrogenase zinc-binding domain protein 0.9897 158 348 GO:0043957

Feature Viewer

pLDDT pTM Quality
91.82 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map