F315770

General Info

Members Datasets Scaffolds Average Seq Length
206 164 412 236

Family's Representative Sequence

Representative Sequence 3300059424|Ga0590075_011879|Ga0590075_011879_1156_1944
Length 262
Sequence MVCQWKLEKEKRMFFKQRLAANATLSYFFGCAGHAKAVAVDVVAGDEDWFLEEANRAGVRIVHVIDTHVHADHYSGGAELARRAGAAYHLHESNKGRASLDFSPLAHGQRLEAGNVLVDVLHTPGHTDDSVCLLVRDLRRGDEPWFLLTGDTLFVGAVGRPDLAGREREMAAQLYDSLHRELLALPAELEIYPGHQAGSACGVGLSGKPASTLAFEKRFNPMLSVGKEEFVARLMRDIPPAPADMNAIVSANLHGRLHAATA

Samples

Sample ID Description Type Environment
1 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
109 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
110 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
128 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
140 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
141 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
142 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
143 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
144 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
145 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
148 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
149 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
150 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
151 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
161 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
162 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
163 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
164 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0.49
Rhizoplane 3.88
Rhizosphere 85.92
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590075_011879 3300059424 Bacteria 2110
2 rootL2_10150378 3300003322 Bacteria 6094
3 rootL2_10330502 3300003322 Bacteria 1253
4 Ga0065704_10157152 3300005289 Unclassified 1381
5 Ga0065704_10217988 3300005289 Bacteria 1084
6 Ga0065707_10001484 3300005295 Bacteria 8420
7 Ga0070658_10003833 3300005327 Bacteria 12321
8 Ga0070683_100058253 3300005329 Bacteria 3589
9 Ga0070690_100090842 3300005330 Bacteria 2011
10 Ga0070670_100409775 3300005331 Unclassified 1197
11 Ga0068869_100166302 3300005334 Bacteria 1720
12 Ga0070680_100075197 3300005336 Bacteria 2780
13 Ga0070660_100066649 3300005339 Bacteria 2803
14 Ga0070689_100016707 3300005340 Bacteria 5373
15 Ga0070687_100230726 3300005343 Bacteria 1139
16 Ga0070661_100064058 3300005344 Unclassified 2701
17 Ga0070692_10089337 3300005345 Bacteria 1672
18 Ga0070692_10248281 3300005345 Bacteria 1064
19 Ga0070688_100097978 3300005365 Bacteria 1928
20 Ga0070659_100007479 3300005366 Bacteria 7936
21 Ga0070709_10200813 3300005434 Bacteria 1412
22 Ga0070714_100135562 3300005435 Bacteria 2204
23 Ga0070705_100009699 3300005440 Bacteria 4796
24 Ga0070694_100125141 3300005444 Bacteria 1849
25 Ga0070694_100309168 3300005444 Bacteria 1213
26 Ga0070663_100029409 3300005455 Bacteria 3754
27 Ga0070663_100096201 3300005455 Bacteria 2202
28 Ga0070706_100000387 3300005467 Bacteria 52792
29 Ga0070698_100840488 3300005471 Unclassified 863
30 Ga0070679_100010654 3300005530 Bacteria 8725
31 Ga0068853_100053681 3300005539 Bacteria 3470
32 Ga0070686_100042414 3300005544 Bacteria 2850
33 Ga0070695_100011016 3300005545 Bacteria 5405
34 Ga0070664_100013071 3300005564 Bacteria 6755
35 Ga0068854_100020941 3300005578 Bacteria 4431
36 Ga0068856_100017649 3300005614 Bacteria 6918
37 Ga0070702_100230023 3300005615 Bacteria 1245
38 Ga0070702_100299443 3300005615 Unclassified 1112
39 Ga0068852_100073539 3300005616 Bacteria 3007
40 Ga0068859_100112874 3300005617 Bacteria 2781
41 Ga0068859_100284149 3300005617 Bacteria 1747
42 Ga0068864_100007031 3300005618 Bacteria 9238
43 Ga0068861_100013036 3300005719 Bacteria 5812
44 Ga0068851_10018704 3300005834 Bacteria 3340
45 Ga0068860_100036835 3300005843 Bacteria 4685
46 Ga0068862_100190297 3300005844 Bacteria 1846
47 Ga0075366_10001327 3300006195 Bacteria 12358
48 Ga0075366_10003084 3300006195 Bacteria 8700
49 Ga0075366_10004982 3300006195 Bacteria 7166
50 Ga0075366_10013626 3300006195 Bacteria 4634
51 Ga0075428_100053960 3300006844 Bacteria 4404
52 Ga0075430_100051943 3300006846 Bacteria 3452
53 Ga0075431_100004570 3300006847 Bacteria 13593
54 Ga0075433_10024541 3300006852 Bacteria 5090
55 Ga0075436_100305962 3300006914 Bacteria 1140
56 Ga0097620_100112869 3300006931 Bacteria 2781
57 Ga0097620_100284144 3300006931 Bacteria 1747
58 Ga0099826_10026410 3300006948 Bacteria 4284
59 Ga0105251_10029014 3300009011 Bacteria 2791
60 Ga0105240_10010948 3300009093 Bacteria 12707
61 Ga0105240_10093359 3300009093 Bacteria 3673
62 Ga0105247_10538229 3300009101 Unclassified 857
63 Ga0105243_10062866 3300009148 Bacteria 2973
64 Ga0105241_10034122 3300009174 Bacteria 3821
65 Ga0105241_10057344 3300009174 Bacteria 2987
66 Ga0105237_10008724 3300009545 Bacteria 10946
67 Ga0105238_10088909 3300009551 Bacteria 3076
68 Ga0105238_10561890 3300009551 Bacteria 1146
69 Ga0105239_10004810 3300010375 Bacteria 16023
70 Ga0105239_10159587 3300010375 Bacteria 2519
71 Ga0105246_10085887 3300011119 Bacteria 2254
72 Ga0105246_10475487 3300011119 Unclassified 1056
73 Ga0157373_10001814 3300013100 Bacteria 16254
74 Ga0157373_10059216 3300013100 Bacteria 2714
75 Ga0157371_10034042 3300013102 Bacteria 3658
76 Ga0157372_10010983 3300013307 Bacteria 9638
77 Ga0163163_10351253 3300014325 Unclassified 1531
78 Ga0163163_10616013 3300014325 Unclassified 1149
79 Ga0157377_10027371 3300014745 Unclassified 3060
80 Ga0209051_1031196 3300025303 Bacteria 2055
81 Ga0207643_10003341 3300025908 Bacteria 8647
82 Ga0207705_10069532 3300025909 Bacteria 2550
83 Ga0207684_10000348 3300025910 Bacteria 63974
84 Ga0207707_10039594 3300025912 Bacteria 4119
85 Ga0207695_10098935 3300025913 Bacteria 2916
86 Ga0207671_10073770 3300025914 Bacteria 2549
87 Ga0207660_10499153 3300025917 Bacteria 987
88 Ga0207657_10000148 3300025919 Bacteria 71376
89 Ga0207649_10024668 3300025920 Bacteria 3498
90 Ga0207652_10044073 3300025921 Bacteria 3800
91 Ga0207652_10081349 3300025921 Bacteria 2833
92 Ga0207652_10587954 3300025921 Unclassified 999
93 Ga0207694_10007573 3300025924 Bacteria 8230
94 Ga0207694_10532253 3300025924 Bacteria 985
95 Ga0207700_10234401 3300025928 Bacteria 1562
96 Ga0207664_10238041 3300025929 Bacteria 1584
97 Ga0207690_10035836 3300025932 Bacteria 3209
98 Ga0207709_10007846 3300025935 Bacteria 5919
99 Ga0207670_10024120 3300025936 Bacteria 3798
100 Ga0207689_10179072 3300025942 Bacteria 1748
101 Ga0207661_10045629 3300025944 Bacteria 3470
102 Ga0207667_10012903 3300025949 Bacteria 9599
103 Ga0207640_10092497 3300025981 Bacteria 2098
104 Ga0207639_10063598 3300026041 Bacteria 2858
105 Ga0207678_10046232 3300026067 Bacteria 3764
106 Ga0207678_10121633 3300026067 Bacteria 2228
107 Ga0207702_10138875 3300026078 Bacteria 2196
108 Ga0207641_10072564 3300026088 Bacteria 2965
109 Ga0207676_10017108 3300026095 Bacteria 5253
110 Ga0207674_10000312 3300026116 Bacteria 61824
111 Ga0207674_10268761 3300026116 Unclassified 1653
112 Ga0207675_100004307 3300026118 Bacteria 13752
113 Ga0207675_100207333 3300026118 Bacteria 1884
114 Ga0207698_10122843 3300026142 Bacteria 2201
115 Ga0268265_10765223 3300028380 Bacteria 938
116 Ga0307517_10133672 3300028786 Bacteria 1774
117 Ga0307515_10038785 3300028794 Bacteria 7604
118 Ga0307513_10000012 3300031456 Bacteria 328865
119 Ga0307513_10000667 3300031456 Bacteria 49266
120 Ga0307509_10000022 3300031507 Bacteria 247822
121 Ga0307405_10741396 3300031731 Unclassified 817
122 Ga0307416_100234571 3300032002 Bacteria 1772
123 Ga0307416_100536066 3300032002 Bacteria 1241
124 Ga0307411_10092804 3300032005 Bacteria 2112
125 Ga0307415_100094180 3300032126 Bacteria 2177
126 Ga0373960_0023962 3300035121 Bacteria 1647
127 Ga0373933_0021480 3300035724 Bacteria 3667
128 Ga0373937_0047185 3300036401 Unclassified 3940
129 Ga0395900_0154537 3300037418 Bacteria 2344
130 Ga0395900_0188172 3300037418 Bacteria 2095
131 Ga0395898_0012688 3300037466 Bacteria 8704
132 Ga0395905_0000302 3300037471 Bacteria 71957
133 Ga0395905_0172589 3300037471 Bacteria 2031
134 Ga0395901_0058527 3300038443 Bacteria 4008
135 Ga0395901_0489005 3300038443 Unclassified 1254
136 Ga0439466_0031997 3300041411 Unclassified 1796
137 Ga0439431_0013734 3300041997 Bacteria 1870
138 Ga0439437_022144 3300042000 Unclassified 772
139 Ga0439441_024018 3300042001 Bacteria 1142
140 Ga0439449_0000184 3300042007 Bacteria 21742
141 Ga0439451_000818 3300042009 Bacteria 5953
142 Ga0439462_0002184 3300042015 Bacteria 4510
143 Ga0439435_0076411 3300042436 Bacteria 999
144 Ga0439435_0151025 3300042436 Bacteria 745
145 Ga0439464_0009105 3300042439 Unclassified 2609
146 Ga0451577_0124453 3300042876 Bacteria 2310
147 Ga0451577_0302562 3300042876 Bacteria 1449
148 Ga0451577_0367087 3300042876 Bacteria 1306
149 Ga0453684_0003051 3300044712 Bacteria 38906
150 Ga0453684_0022686 3300044712 Bacteria 9300
151 Ga0451576_0145179 3300045051 Bacteria 2474
152 Ga0451576_0460631 3300045051 Bacteria 1335
153 Ga0495603_0003327 3300046455 Bacteria 9570
154 Ga0495590_0003240 3300046457 Bacteria 6653
155 Ga0495651_0136864 3300046462 Unclassified 1781
156 Ga0495580_0025521 3300046472 Bacteria 4319
157 Ga0495580_0037466 3300046472 Bacteria 3480
158 Ga0495583_0009581 3300046506 Bacteria 5769
159 Ga0495648_0072361 3300046524 Bacteria 1995
160 Ga0495586_0240435 3300046535 Bacteria 1032
161 Ga0495687_020103 3300047443 Bacteria 3261
162 Ga0495673_0038356 3300047469 Bacteria 2180
163 Ga0495626_0093471 3300048091 Bacteria 1320
164 Ga0496101_0076712 3300048904 Bacteria 2462
165 Ga0496102_0295677 3300048905 Bacteria 1526
166 Ga0496103_0099930 3300048906 Bacteria 1835
167 Ga0496104_0083278 3300048907 Bacteria 3051
168 Ga0496104_0106507 3300048907 Bacteria 2687
169 Ga0496106_0166545 3300048909 Bacteria 1745
170 Ga0496109_0180556 3300048912 Bacteria 1982
171 Ga0496113_0131976 3300048916 Bacteria 1961
172 Ga0495682_0006460 3300049460 Bacteria 4736
173 Ga0501069_0008142 3300049585 Bacteria 5506
174 Ga0501070_0018243 3300049586 Bacteria 5887
175 Ga0501070_0083568 3300049586 Bacteria 2643
176 Ga0501198_008502 3300049649 Bacteria 1491
177 Ga0501206_002459 3300049653 Bacteria 2339
178 Ga0501223_069208 3300049663 Unclassified 696
179 Ga0501227_015534 3300049665 Bacteria 1701
180 Ga0501238_032707 3300049671 Bacteria 755
181 Ga0501249_073006 3300049679 Bacteria 802
182 Ga0501225_0031328 3300049705 Bacteria 1463
183 Ga0501080_0735595 3300049742 Bacteria 868
184 Ga0501263_002988 3300049760 Bacteria 1773
185 Ga0501271_001463 3300049768 Bacteria 2028
186 Ga0501275_002384 3300049772 Bacteria 1734
187 Ga0501283_000441 3300049779 Bacteria 5506
188 Ga0501226_002510 3300049853 Bacteria 2237
189 nmdc:mga03683_21110_c1 3300050489 Bacteria 2506
190 nmdc:mga0k408_1424_c1 3300050493 Bacteria 12953
191 nmdc:mga0k408_25937_c1 3300050493 Bacteria 3321
192 nmdc:mga0k408_271_c1 3300050493 Bacteria 28147
193 nmdc:mga0k408_41818_c1 3300050493 Bacteria 2639
194 nmdc:mga0qj67_8923_c1 3300050509 Bacteria 7436
195 nmdc:mga06r32_5227_c1 3300050510 Bacteria 11669
196 nmdc:mga08y16_821090_c1 3300050511 Bacteria 921
197 nmdc:mga08x19_457168_c1 3300050514 Unclassified 899
198 nmdc:mga0a205_19601_c1 3300050515 Bacteria 6380
199 nmdc:mga0sz30_32417_c1 3300050516 Bacteria 2167
200 Ga0500608_004031 3300053122 Bacteria 5623
201 2563055153 2562617112 Bacteria 10918404
202 2563056356 2562617112 Bacteria 10918404
203 2713473003 2711768613 Bacteria 11048459
204 2713475243 2711768613 Bacteria 11048459
205 2919706546 2919704043 Bacteria 5560311
206 2990713800 2990710928 Bacteria 5002431
207 Ga0590075_011879
208 rootL2_10150378
209 rootL2_10330502
210 Ga0065704_10157152
211 Ga0065704_10217988
212 Ga0065707_10001484
213 Ga0070658_10003833
214 Ga0070683_100058253
215 Ga0070690_100090842
216 Ga0070670_100409775
217 Ga0068869_100166302
218 Ga0070680_100075197
219 Ga0070660_100066649
220 Ga0070689_100016707
221 Ga0070687_100230726
222 Ga0070661_100064058
223 Ga0070692_10089337
224 Ga0070692_10248281
225 Ga0070688_100097978
226 Ga0070659_100007479
227 Ga0070709_10200813
228 Ga0070714_100135562
229 Ga0070705_100009699
230 Ga0070694_100125141
231 Ga0070694_100309168
232 Ga0070663_100029409
233 Ga0070663_100096201
234 Ga0070706_100000387
235 Ga0070698_100840488
236 Ga0070679_100010654
237 Ga0068853_100053681
238 Ga0070686_100042414
239 Ga0070695_100011016
240 Ga0070664_100013071
241 Ga0068854_100020941
242 Ga0068856_100017649
243 Ga0070702_100230023
244 Ga0070702_100299443
245 Ga0068852_100073539
246 Ga0068859_100112874
247 Ga0068859_100284149
248 Ga0068864_100007031
249 Ga0068861_100013036
250 Ga0068851_10018704
251 Ga0068860_100036835
252 Ga0068862_100190297
253 Ga0075366_10001327
254 Ga0075366_10003084
255 Ga0075366_10004982
256 Ga0075366_10013626
257 Ga0075428_100053960
258 Ga0075430_100051943
259 Ga0075431_100004570
260 Ga0075433_10024541
261 Ga0075436_100305962
262 Ga0097620_100112869
263 Ga0097620_100284144
264 Ga0099826_10026410
265 Ga0105251_10029014
266 Ga0105240_10010948
267 Ga0105240_10093359
268 Ga0105247_10538229
269 Ga0105243_10062866
270 Ga0105241_10034122
271 Ga0105241_10057344
272 Ga0105237_10008724
273 Ga0105238_10088909
274 Ga0105238_10561890
275 Ga0105239_10004810
276 Ga0105239_10159587
277 Ga0105246_10085887
278 Ga0105246_10475487
279 Ga0157373_10001814
280 Ga0157373_10059216
281 Ga0157371_10034042
282 Ga0157372_10010983
283 Ga0163163_10351253
284 Ga0163163_10616013
285 Ga0157377_10027371
286 Ga0209051_1031196
287 Ga0207643_10003341
288 Ga0207705_10069532
289 Ga0207684_10000348
290 Ga0207707_10039594
291 Ga0207695_10098935
292 Ga0207671_10073770
293 Ga0207660_10499153
294 Ga0207657_10000148
295 Ga0207649_10024668
296 Ga0207652_10044073
297 Ga0207652_10081349
298 Ga0207652_10587954
299 Ga0207694_10007573
300 Ga0207694_10532253
301 Ga0207700_10234401
302 Ga0207664_10238041
303 Ga0207690_10035836
304 Ga0207709_10007846
305 Ga0207670_10024120
306 Ga0207689_10179072
307 Ga0207661_10045629
308 Ga0207667_10012903
309 Ga0207640_10092497
310 Ga0207639_10063598
311 Ga0207678_10046232
312 Ga0207678_10121633
313 Ga0207702_10138875
314 Ga0207641_10072564
315 Ga0207676_10017108
316 Ga0207674_10000312
317 Ga0207674_10268761
318 Ga0207675_100004307
319 Ga0207675_100207333
320 Ga0207698_10122843
321 Ga0268265_10765223
322 Ga0307517_10133672
323 Ga0307515_10038785
324 Ga0307513_10000012
325 Ga0307513_10000667
326 Ga0307509_10000022
327 Ga0307405_10741396
328 Ga0307416_100234571
329 Ga0307416_100536066
330 Ga0307411_10092804
331 Ga0307415_100094180
332 Ga0373960_0023962
333 Ga0373933_0021480
334 Ga0373937_0047185
335 Ga0395900_0154537
336 Ga0395900_0188172
337 Ga0395898_0012688
338 Ga0395905_0000302
339 Ga0395905_0172589
340 Ga0395901_0058527
341 Ga0395901_0489005
342 Ga0439466_0031997
343 Ga0439431_0013734
344 Ga0439437_022144
345 Ga0439441_024018
346 Ga0439449_0000184
347 Ga0439451_000818
348 Ga0439462_0002184
349 Ga0439435_0076411
350 Ga0439435_0151025
351 Ga0439464_0009105
352 Ga0451577_0124453
353 Ga0451577_0302562
354 Ga0451577_0367087
355 Ga0453684_0003051
356 Ga0453684_0022686
357 Ga0451576_0145179
358 Ga0451576_0460631
359 Ga0495603_0003327
360 Ga0495590_0003240
361 Ga0495651_0136864
362 Ga0495580_0025521
363 Ga0495580_0037466
364 Ga0495583_0009581
365 Ga0495648_0072361
366 Ga0495586_0240435
367 Ga0495687_020103
368 Ga0495673_0038356
369 Ga0495626_0093471
370 Ga0496101_0076712
371 Ga0496102_0295677
372 Ga0496103_0099930
373 Ga0496104_0083278
374 Ga0496104_0106507
375 Ga0496106_0166545
376 Ga0496109_0180556
377 Ga0496113_0131976
378 Ga0495682_0006460
379 Ga0501069_0008142
380 Ga0501070_0018243
381 Ga0501070_0083568
382 Ga0501198_008502
383 Ga0501206_002459
384 Ga0501223_069208
385 Ga0501227_015534
386 Ga0501238_032707
387 Ga0501249_073006
388 Ga0501225_0031328
389 Ga0501080_0735595
390 Ga0501263_002988
391 Ga0501271_001463
392 Ga0501275_002384
393 Ga0501283_000441
394 Ga0501226_002510
395 nmdc:mga03683_21110_c1
396 nmdc:mga0k408_1424_c1
397 nmdc:mga0k408_25937_c1
398 nmdc:mga0k408_271_c1
399 nmdc:mga0k408_41818_c1
400 nmdc:mga0qj67_8923_c1
401 nmdc:mga06r32_5227_c1
402 nmdc:mga08y16_821090_c1
403 nmdc:mga08x19_457168_c1
404 nmdc:mga0a205_19601_c1
405 nmdc:mga0sz30_32417_c1
406 Ga0500608_004031
407 2563055153
408 2563056356
409 2713473003
410 2713475243
411 2919706546
412 2990713800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

21

195

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gcu-assembly2.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at1g53580 0.8794 2 212
5ve5-assembly2.cif.gz_B crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.8788 2 212
5ve4-assembly1.cif.gz_A crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans 0.878 2 212
5ve3-assembly2.cif.gz_A crystal structure of wild-type persulfide dioxygenase-rhodanese fusion protein from burkholderia phytofirmans 0.8777 2 212
5ve5-assembly3.cif.gz_C crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.8734 2 212
ID Description Score Start End Superfamily
af_Q86PD3_43_273_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8929 2 212 3.60.15.10
af_Q2G1R6_1_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8777 2 212 3.60.15.10
af_K7MDN4_21_187_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8729 2 114 3.60.15.10
af_Q2G1R6_1_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8586 2 212 3.60.15.10
af_A0A1D6NGC6_55_266_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8546 2 195 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7W0VIH0-F1-model_v4 MBL fold metallo-hydrolase 0.9955 2 101 GO:0006749
GO:0016787
GO:0050313
GO:0070813
AF-A0A529FKH3-F1-model_v4 MBL fold metallo-hydrolase 0.9838 2 96 GO:0006749
GO:0016787
GO:0050313
GO:0070813
AF-A0A529HEB8-F1-model_v4 MBL fold metallo-hydrolase 0.9818 2 111 GO:0006749
GO:0016787
GO:0050313
GO:0070813
AF-A0A4Q3EBN5-F1-model_v4 MBL fold metallo-hydrolase 0.9612 2 93 GO:0006749
GO:0016787
GO:0050313
GO:0070813
AF-A0A7Y5X014-F1-model_v4 MBL fold metallo-hydrolase 0.9605 2 106 GO:0006749
GO:0016787
GO:0050313
GO:0070813

Map