F315310

General Info

Members Datasets Scaffolds Average Seq Length
206 119 412 241

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10462642|Ga0307516_104626422
Length 240
Sequence MFDLTADEFRSRLMALQAVDKPPEGNLAVKRDPFNAVKMGDIFRLGKEFSGMLVGEIEKLMESPVHKLRVGALSIMGQCAKGRNCTPSRLAELFDLYIRRHDRINTWDLVDLAAYYVVGGYLADKSRKPLYKLARSKDMWERRSSIVATAHFILKMKEVDDTFAIAEILVNDKEESVNKGTGWMLRTAGDVDRKRLLLFLDKHASSMPRVSLRYSIEKLSKAERDHYMKIKKDSRPGGNI

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
80 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
81 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
84 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
100 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
101 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
102 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
103 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
108 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
109 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 0
Rhizosphere 98.06
Stem 0
Stem Tuber 0
Unclassified 20.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10462642 3300031730 Unclassified 924
2 SwRhRL3b_contig_862913 2162886006 Bacteria 6633
3 SwRhRL2b_contig_3445787 2162886007 Bacteria 3745
4 Ga0065704_10001073 3300005289 Bacteria 9991
5 Ga0065707_10000452 3300005295 Bacteria 48326
6 Ga0065707_10007245 3300005295 Bacteria 3001
7 Ga0065707_10086156 3300005295 Bacteria 5629
8 Ga0065707_10093480 3300005295 Unclassified 3617
9 Ga0065707_10142237 3300005295 Bacteria 1757
10 Ga0070680_100186589 3300005336 Unclassified 1747
11 Ga0068868_100687334 3300005338 Bacteria 914
12 Ga0070687_100089635 3300005343 Bacteria 1698
13 Ga0070692_10140513 3300005345 Bacteria 1366
14 Ga0070668_100241569 3300005347 Bacteria 1496
15 Ga0070675_100197782 3300005354 Bacteria 1744
16 Ga0070688_100058607 3300005365 Bacteria 2425
17 Ga0070688_100276745 3300005365 Bacteria 1204
18 Ga0070701_10035550 3300005438 Bacteria 2504
19 Ga0070705_100066311 3300005440 Bacteria 2164
20 Ga0070705_100234486 3300005440 Unclassified 1279
21 Ga0070700_100050397 3300005441 Bacteria 2588
22 Ga0070700_100166694 3300005441 Bacteria 1522
23 Ga0070694_100127818 3300005444 Bacteria 1832
24 Ga0070694_100183396 3300005444 Bacteria 1549
25 Ga0070708_100200266 3300005445 Unclassified 1869
26 Ga0070707_100082594 3300005468 Unclassified 3104
27 Ga0070698_100242480 3300005471 Bacteria 1736
28 Ga0070698_100250781 3300005471 Unclassified 1703
29 Ga0070698_100251894 3300005471 Bacteria 1698
30 Ga0070698_100316158 3300005471 Unclassified 1492
31 Ga0070699_100001030 3300005518 Bacteria 25897
32 Ga0070699_100047514 3300005518 Bacteria 3714
33 Ga0070699_100753551 3300005518 Bacteria 890
34 Ga0070695_100305824 3300005545 Bacteria 1177
35 Ga0070696_100096953 3300005546 Unclassified 2108
36 Ga0070696_100146167 3300005546 Bacteria 1732
37 Ga0070704_100005018 3300005549 Bacteria 7691
38 Ga0070704_100110887 3300005549 Bacteria 2087
39 Ga0068857_100019025 3300005577 Bacteria 6026
40 Ga0068859_100011714 3300005617 Bacteria 8810
41 Ga0068859_100088678 3300005617 Unclassified 3142
42 Ga0068861_100103667 3300005719 Unclassified 2268
43 Ga0068870_10125003 3300005840 Bacteria 1486
44 Ga0068862_100032797 3300005844 Bacteria 4387
45 Ga0068862_100053786 3300005844 Bacteria 3447
46 Ga0068862_100054292 3300005844 Bacteria 3430
47 Ga0081455_10001203 3300005937 Bacteria 32430
48 Ga0075362_10062266 3300006177 Unclassified 1690
49 Ga0075428_100046170 3300006844 Bacteria 4785
50 Ga0075428_100324378 3300006844 Bacteria 1654
51 Ga0075431_100080128 3300006847 Bacteria 3371
52 Ga0075431_100480241 3300006847 Bacteria 1236
53 Ga0075429_100037691 3300006880 Bacteria 4208
54 Ga0075429_100049597 3300006880 Bacteria 3650
55 Ga0075429_100093722 3300006880 Unclassified 2619
56 Ga0075429_100831003 3300006880 Unclassified 809
57 Ga0097620_100011714 3300006931 Bacteria 8810
58 Ga0097620_100088678 3300006931 Unclassified 3142
59 Ga0111539_10060161 3300009094 Bacteria 4502
60 Ga0111539_10175567 3300009094 Bacteria 2503
61 Ga0111539_10388230 3300009094 Unclassified 1626
62 Ga0111539_11566680 3300009094 Bacteria 764
63 Ga0105245_10069742 3300009098 Bacteria 3188
64 Ga0114129_10001275 3300009147 Bacteria 33647
65 Ga0114129_10082804 3300009147 Bacteria 4458
66 Ga0114129_10101798 3300009147 Bacteria 3974
67 Ga0114129_10575699 3300009147 Bacteria 1462
68 Ga0114129_11578593 3300009147 Bacteria 804
69 Ga0105243_10094770 3300009148 Bacteria 2466
70 Ga0105243_10112424 3300009148 Bacteria 2282
71 Ga0105243_10170607 3300009148 Bacteria 1884
72 Ga0105249_10079424 3300009553 Bacteria 3045
73 Ga0105249_10202434 3300009553 Bacteria 1943
74 Ga0105249_10322061 3300009553 Bacteria 1557
75 Ga0105249_10562877 3300009553 Bacteria 1192
76 Ga0105249_10617487 3300009553 Bacteria 1140
77 Ga0105246_10004664 3300011119 Bacteria 8341
78 Ga0105246_10022114 3300011119 Bacteria 4101
79 Ga0157375_11409467 3300013308 Bacteria 821
80 Ga0163163_10072693 3300014325 Bacteria 3429
81 Ga0157380_10022479 3300014326 Bacteria 4749
82 Ga0157380_10111812 3300014326 Bacteria 2297
83 Ga0157380_10174768 3300014326 Bacteria 1880
84 Ga0157380_10296832 3300014326 Bacteria 1486
85 Ga0157377_10083124 3300014745 Bacteria 1875
86 Ga0157376_10759169 3300014969 Bacteria 980
87 Ga0207662_10134377 3300025918 Bacteria 1562
88 Ga0207646_10050741 3300025922 Unclassified 3712
89 Ga0207659_10037094 3300025926 Bacteria 3382
90 Ga0207659_10161051 3300025926 Bacteria 1762
91 Ga0207706_10277968 3300025933 Bacteria 1461
92 Ga0207709_10331801 3300025935 Bacteria 1142
93 Ga0207670_10135521 3300025936 Bacteria 1809
94 Ga0207670_10310991 3300025936 Unclassified 1237
95 Ga0207691_10426759 3300025940 Bacteria 1129
96 Ga0207689_10437360 3300025942 Bacteria 1092
97 Ga0207651_10148998 3300025960 Bacteria 1819
98 Ga0207712_10162660 3300025961 Bacteria 1736
99 Ga0207712_10258011 3300025961 Unclassified 1412
100 Ga0207640_10461622 3300025981 Bacteria 1049
101 Ga0207708_10034095 3300026075 Bacteria 3871
102 Ga0207708_10042251 3300026075 Bacteria 3475
103 Ga0207708_10260109 3300026075 Bacteria 1401
104 Ga0207674_10026460 3300026116 Bacteria 6159
105 Ga0207674_10232766 3300026116 Unclassified 1790
106 Ga0207428_10023497 3300027907 Bacteria 5185
107 Ga0207428_10060765 3300027907 Bacteria 2993
108 Ga0268265_10019875 3300028380 Bacteria 4678
109 Ga0268265_10167968 3300028380 Bacteria 1872
110 Ga0268265_10192046 3300028380 Unclassified 1764
111 Ga0307513_10255953 3300031456 Unclassified 1544
112 Ga0307408_100217844 3300031548 Bacteria 1556
113 Ga0307408_100290529 3300031548 Bacteria 1365
114 Ga0307408_100490304 3300031548 Unclassified 1074
115 Ga0307405_10130490 3300031731 Bacteria 1736
116 Ga0307413_10152465 3300031824 Bacteria 1612
117 Ga0307410_10050307 3300031852 Bacteria 2802
118 Ga0307406_10282675 3300031901 Bacteria 1266
119 Ga0307407_10057144 3300031903 Bacteria 2262
120 Ga0307412_10144670 3300031911 Bacteria 1746
121 Ga0307409_100191365 3300031995 Unclassified 1821
122 Ga0307416_100464384 3300032002 Bacteria 1322
123 Ga0307416_101054373 3300032002 Bacteria 917
124 Ga0307414_10213052 3300032004 Bacteria 1580
125 Ga0439431_0029546 3300041997 Bacteria 1355
126 Ga0451577_0048987 3300042876 Bacteria 3772
127 Ga0451577_0144521 3300042876 Unclassified 2138
128 Ga0451577_0263977 3300042876 Bacteria 1559
129 Ga0453683_0001235 3300044673 Bacteria 22899
130 Ga0453683_0057758 3300044673 Unclassified 2427
131 Ga0453683_0166264 3300044673 Bacteria 1396
132 Ga0453683_0246014 3300044673 Bacteria 1139
133 Ga0453684_0039249 3300044712 Bacteria 6455
134 Ga0453684_0092457 3300044712 Bacteria 3729
135 Ga0453684_0125676 3300044712 Bacteria 3087
136 Ga0453684_0148219 3300044712 Bacteria 2792
137 Ga0453684_0151947 3300044712 Unclassified 2750
138 Ga0453684_0185811 3300044712 Bacteria 2436
139 Ga0453684_0349969 3300044712 Bacteria 1666
140 Ga0451576_0001483 3300045051 Bacteria 39693
141 Ga0451576_0082808 3300045051 Unclassified 3337
142 Ga0451576_0114520 3300045051 Unclassified 2807
143 Ga0495584_0095755 3300046491 Bacteria 1499
144 Ga0495585_0065461 3300046492 Bacteria 1991
145 Ga0495637_0094242 3300046520 Unclassified 1177
146 Ga0495644_0052094 3300046523 Bacteria 1537
147 Ga0495656_0133105 3300046615 Unclassified 1185
148 Ga0495670_0094383 3300046691 Bacteria 1534
149 Ga0495685_075379 3300047447 Bacteria 1127
150 Ga0495615_0106426 3300048090 Bacteria 798
151 Ga0501031_0146641 3300049568 Bacteria 1542
152 Ga0501036_0115009 3300049572 Bacteria 2273
153 Ga0501039_0178804 3300049575 Bacteria 1668
154 Ga0501039_0235691 3300049575 Unclassified 1439
155 Ga0501040_0301631 3300049576 Bacteria 1145
156 Ga0501041_0126940 3300049577 Bacteria 1588
157 Ga0501042_0057621 3300049578 Bacteria 2772
158 Ga0501048_0107661 3300049582 Bacteria 1968
159 Ga0501048_0110845 3300049582 Bacteria 1938
160 Ga0501068_0109936 3300049584 Bacteria 1713
161 Ga0501071_0029566 3300049587 Bacteria 3868
162 Ga0501072_0032066 3300049588 Bacteria 4113
163 Ga0501073_0174729 3300049589 Bacteria 1487
164 Ga0501075_0037198 3300049591 Bacteria 3635
165 Ga0501076_0030828 3300049592 Bacteria 4178
166 Ga0501077_0027311 3300049593 Bacteria 3625
167 Ga0501207_021649 3300049654 Unclassified 1033
168 Ga0501223_034514 3300049663 Unclassified 984
169 Ga0501227_051452 3300049665 Bacteria 1040
170 Ga0501247_010148 3300049677 Bacteria 1119
171 Ga0501257_018981 3300049686 Bacteria 1606
172 Ga0501079_0053809 3300049741 Bacteria 3105
173 Ga0501080_0167980 3300049742 Bacteria 2024
174 Ga0501080_0707373 3300049742 Unclassified 888
175 Ga0501083_0261872 3300049744 Bacteria 1125
176 Ga0501264_000111 3300049761 Bacteria 12421
177 Ga0501268_053275 3300049765 Unclassified 787
178 Ga0501272_006863 3300049769 Unclassified 1224
179 Ga0501035_0109960 3300049822 Bacteria 2416
180 Ga0501045_0044700 3300049824 Bacteria 3226
181 nmdc:mga03683_1804_c2 3300050489 Unclassified 2410
182 nmdc:mga05p37_100879_c1 3300050507 Bacteria 3555
183 nmdc:mga05p37_30776_c1 3300050507 Bacteria 6551
184 nmdc:mga05p37_341877_c1 3300050507 Bacteria 1764
185 nmdc:mga05p37_47779_c1 3300050507 Bacteria 5263
186 nmdc:mga05p37_49505_c1 3300050507 Bacteria 5169
187 nmdc:mga05p37_64483_c1 3300050507 Bacteria 4508
188 nmdc:mga05p37_858_c1 3300050507 Bacteria 34211
189 nmdc:mga05p37_919652_c1 3300050507 Unclassified 940
190 nmdc:mga09592_156268_c1 3300050508 Unclassified 1969
191 nmdc:mga09592_163086_c1 3300050508 Bacteria 1926
192 nmdc:mga09592_78081_c1 3300050508 Bacteria 2817
193 nmdc:mga09592_88976_c1 3300050508 Bacteria 2637
194 nmdc:mga09592_92179_c1 3300050508 Bacteria 2590
195 nmdc:mga09592_9331_c1 3300050508 Bacteria 7978
196 nmdc:mga06r32_162828_c1 3300050510 Bacteria 2213
197 nmdc:mga06r32_733353_c1 3300050510 Unclassified 952
198 nmdc:mga06r32_99229_c1 3300050510 Bacteria 2856
199 nmdc:mga08y16_2710_c1 3300050511 Bacteria 18172
200 nmdc:mga08y16_301512_c1 3300050511 Unclassified 1651
201 nmdc:mga08y16_31257_c1 3300050511 Bacteria 5601
202 nmdc:mga0a205_312828_c1 3300050515 Bacteria 1442
203 nmdc:mga0a205_47892_c1 3300050515 Bacteria 4125
204 Ga0501084_0167516 3300054114 Bacteria 1854
205 Ga0501084_0271257 3300054114 Unclassified 1433
206 Ga0530510_0033178 3300061734 Bacteria 3717
207 Ga0307516_10462642
208 SwRhRL3b_contig_862913
209 SwRhRL2b_contig_3445787
210 Ga0065704_10001073
211 Ga0065707_10000452
212 Ga0065707_10007245
213 Ga0065707_10086156
214 Ga0065707_10093480
215 Ga0065707_10142237
216 Ga0070680_100186589
217 Ga0068868_100687334
218 Ga0070687_100089635
219 Ga0070692_10140513
220 Ga0070668_100241569
221 Ga0070675_100197782
222 Ga0070688_100058607
223 Ga0070688_100276745
224 Ga0070701_10035550
225 Ga0070705_100066311
226 Ga0070705_100234486
227 Ga0070700_100050397
228 Ga0070700_100166694
229 Ga0070694_100127818
230 Ga0070694_100183396
231 Ga0070708_100200266
232 Ga0070707_100082594
233 Ga0070698_100242480
234 Ga0070698_100250781
235 Ga0070698_100251894
236 Ga0070698_100316158
237 Ga0070699_100001030
238 Ga0070699_100047514
239 Ga0070699_100753551
240 Ga0070695_100305824
241 Ga0070696_100096953
242 Ga0070696_100146167
243 Ga0070704_100005018
244 Ga0070704_100110887
245 Ga0068857_100019025
246 Ga0068859_100011714
247 Ga0068859_100088678
248 Ga0068861_100103667
249 Ga0068870_10125003
250 Ga0068862_100032797
251 Ga0068862_100053786
252 Ga0068862_100054292
253 Ga0081455_10001203
254 Ga0075362_10062266
255 Ga0075428_100046170
256 Ga0075428_100324378
257 Ga0075431_100080128
258 Ga0075431_100480241
259 Ga0075429_100037691
260 Ga0075429_100049597
261 Ga0075429_100093722
262 Ga0075429_100831003
263 Ga0097620_100011714
264 Ga0097620_100088678
265 Ga0111539_10060161
266 Ga0111539_10175567
267 Ga0111539_10388230
268 Ga0111539_11566680
269 Ga0105245_10069742
270 Ga0114129_10001275
271 Ga0114129_10082804
272 Ga0114129_10101798
273 Ga0114129_10575699
274 Ga0114129_11578593
275 Ga0105243_10094770
276 Ga0105243_10112424
277 Ga0105243_10170607
278 Ga0105249_10079424
279 Ga0105249_10202434
280 Ga0105249_10322061
281 Ga0105249_10562877
282 Ga0105249_10617487
283 Ga0105246_10004664
284 Ga0105246_10022114
285 Ga0157375_11409467
286 Ga0163163_10072693
287 Ga0157380_10022479
288 Ga0157380_10111812
289 Ga0157380_10174768
290 Ga0157380_10296832
291 Ga0157377_10083124
292 Ga0157376_10759169
293 Ga0207662_10134377
294 Ga0207646_10050741
295 Ga0207659_10037094
296 Ga0207659_10161051
297 Ga0207706_10277968
298 Ga0207709_10331801
299 Ga0207670_10135521
300 Ga0207670_10310991
301 Ga0207691_10426759
302 Ga0207689_10437360
303 Ga0207651_10148998
304 Ga0207712_10162660
305 Ga0207712_10258011
306 Ga0207640_10461622
307 Ga0207708_10034095
308 Ga0207708_10042251
309 Ga0207708_10260109
310 Ga0207674_10026460
311 Ga0207674_10232766
312 Ga0207428_10023497
313 Ga0207428_10060765
314 Ga0268265_10019875
315 Ga0268265_10167968
316 Ga0268265_10192046
317 Ga0307513_10255953
318 Ga0307408_100217844
319 Ga0307408_100290529
320 Ga0307408_100490304
321 Ga0307405_10130490
322 Ga0307413_10152465
323 Ga0307410_10050307
324 Ga0307406_10282675
325 Ga0307407_10057144
326 Ga0307412_10144670
327 Ga0307409_100191365
328 Ga0307416_100464384
329 Ga0307416_101054373
330 Ga0307414_10213052
331 Ga0439431_0029546
332 Ga0451577_0048987
333 Ga0451577_0144521
334 Ga0451577_0263977
335 Ga0453683_0001235
336 Ga0453683_0057758
337 Ga0453683_0166264
338 Ga0453683_0246014
339 Ga0453684_0039249
340 Ga0453684_0092457
341 Ga0453684_0125676
342 Ga0453684_0148219
343 Ga0453684_0151947
344 Ga0453684_0185811
345 Ga0453684_0349969
346 Ga0451576_0001483
347 Ga0451576_0082808
348 Ga0451576_0114520
349 Ga0495584_0095755
350 Ga0495585_0065461
351 Ga0495637_0094242
352 Ga0495644_0052094
353 Ga0495656_0133105
354 Ga0495670_0094383
355 Ga0495685_075379
356 Ga0495615_0106426
357 Ga0501031_0146641
358 Ga0501036_0115009
359 Ga0501039_0178804
360 Ga0501039_0235691
361 Ga0501040_0301631
362 Ga0501041_0126940
363 Ga0501042_0057621
364 Ga0501048_0107661
365 Ga0501048_0110845
366 Ga0501068_0109936
367 Ga0501071_0029566
368 Ga0501072_0032066
369 Ga0501073_0174729
370 Ga0501075_0037198
371 Ga0501076_0030828
372 Ga0501077_0027311
373 Ga0501207_021649
374 Ga0501223_034514
375 Ga0501227_051452
376 Ga0501247_010148
377 Ga0501257_018981
378 Ga0501079_0053809
379 Ga0501080_0167980
380 Ga0501080_0707373
381 Ga0501083_0261872
382 Ga0501264_000111
383 Ga0501268_053275
384 Ga0501272_006863
385 Ga0501035_0109960
386 Ga0501045_0044700
387 nmdc:mga03683_1804_c2
388 nmdc:mga05p37_100879_c1
389 nmdc:mga05p37_30776_c1
390 nmdc:mga05p37_341877_c1
391 nmdc:mga05p37_47779_c1
392 nmdc:mga05p37_49505_c1
393 nmdc:mga05p37_64483_c1
394 nmdc:mga05p37_858_c1
395 nmdc:mga05p37_919652_c1
396 nmdc:mga09592_156268_c1
397 nmdc:mga09592_163086_c1
398 nmdc:mga09592_78081_c1
399 nmdc:mga09592_88976_c1
400 nmdc:mga09592_92179_c1
401 nmdc:mga09592_9331_c1
402 nmdc:mga06r32_162828_c1
403 nmdc:mga06r32_733353_c1
404 nmdc:mga06r32_99229_c1
405 nmdc:mga08y16_2710_c1
406 nmdc:mga08y16_301512_c1
407 nmdc:mga08y16_31257_c1
408 nmdc:mga0a205_312828_c1
409 nmdc:mga0a205_47892_c1
410 Ga0501084_0167516
411 Ga0501084_0271257
412 Ga0530510_0033178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08713

DNA_alkylation

DNA alkylation repair enzyme

10

219

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b6c-assembly1.cif.gz_A predicted dna alkylation repair enzyme from enterococcus faecalis. 0.7966 18 223
2b6c-assembly1.cif.gz_A predicted dna alkylation repair enzyme from enterococcus faecalis. 0.7698 18 223
5clc-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (9-mer b) 0.7602 1 223
5clc-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (9-mer b) 0.7517 1 223
5cl3-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (100% substrate at 4 hours) 0.7467 1 225
ID Description Score Start End Superfamily
6m9mA02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;ARM repeat domains 0.7985 117 222 1.25.40.290
5clcA00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant; 0.7602 1 223 1.25.10.90
5clcA00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant; 0.7517 1 223 1.25.10.90
6m9mA02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;ARM repeat domains 0.7143 117 222 1.25.40.290
af_A0A1D6HPB1_249_353_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6953 130 223 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A7C3K5I7-F1-model_v4 DNA alkylation repair protein 0.9966 133 232
AF-A1R966-F1-model_v4 DNA alkylation repair protein 0.9954 55 235
AF-A0A399ZUY1-F1-model_v4 DNA alkylation repair protein 0.9943 6 234
AF-A0A3N5UVM0-F1-model_v4 DNA alkylation repair protein 0.9934 76 234
AF-H8K5P9-F1-model_v4 DNA alkylation repair enzyme family protein 0.9922 139 230

Map