F312477

General Info

Members Datasets Scaffolds Average Seq Length
204 158 408 221

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10199279|Ga0105242_101992793
Length 262
Sequence MVSETGCAALGDRPITSRISQTTISRGGRIMADINSDFAQRVVVHSAQIPWIASPVVGVDRRMLDRIGDEVARATSVVRYAPKSRFSAHVHGRGEEFLVLDGVFQDEHGDFPVGSYIRNPPTSSHTPGSEIGCKIFVKLWQFDPTDRKHVRIDTSKLTFTPLVDPDRKGVETMGLFADKSENVRLERWAPGASVELDLKGGGEFFVLEGCFNEGGDQLERVSWLRLPADGYLRATAGRDGCKVWVKTGHLPPRFTAPVRSAH

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
144 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
156 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.22
Nodule 0
Rhizoplane 3.43
Rhizosphere 77.45
Stem 0
Stem Tuber 0
Unclassified 13.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10199279 3300009176 Unclassified 1777
2 JGI25153J46596_10000123 3300003215 Bacteria 86708
3 rootH1_10002858 3300003323 Bacteria 1520
4 Ga0065707_10150278 3300005295 Bacteria 1666
5 Ga0070676_10058449 3300005328 Unclassified 2285
6 Ga0070677_10014137 3300005333 Unclassified 2804
7 Ga0070668_100107407 3300005347 Bacteria 2219
8 Ga0070669_100478539 3300005353 Bacteria 1030
9 Ga0070671_100388372 3300005355 Unclassified 1193
10 Ga0070674_100001684 3300005356 Bacteria 11960
11 Ga0070674_100012635 3300005356 Bacteria 5190
12 Ga0070673_100729489 3300005364 Unclassified 911
13 Ga0070659_100652766 3300005366 Unclassified 907
14 Ga0070709_10303933 3300005434 Bacteria 1166
15 Ga0070714_100088377 3300005435 Bacteria 2711
16 Ga0070714_100235714 3300005435 Bacteria 1687
17 Ga0070713_100222047 3300005436 Bacteria 1714
18 Ga0070713_100504381 3300005436 Bacteria 1142
19 Ga0070713_100639882 3300005436 Bacteria 1012
20 Ga0070710_10258513 3300005437 Bacteria 1122
21 Ga0070710_10513510 3300005437 Bacteria 822
22 Ga0070711_100233251 3300005439 Unclassified 1436
23 Ga0070711_100473600 3300005439 Bacteria 1028
24 Ga0070711_100475219 3300005439 Bacteria 1026
25 Ga0070694_100254223 3300005444 Unclassified 1330
26 Ga0070678_100058193 3300005456 Unclassified 2836
27 Ga0070662_100377037 3300005457 Unclassified 1167
28 Ga0070681_10358893 3300005458 Bacteria 1367
29 Ga0070681_10727384 3300005458 Bacteria 909
30 Ga0068867_100007818 3300005459 Bacteria 7561
31 Ga0070698_100382315 3300005471 Bacteria 1340
32 Ga0070672_100015086 3300005543 Bacteria 5492
33 Ga0070696_100102599 3300005546 Bacteria 2051
34 Ga0068855_100772540 3300005563 Bacteria 1023
35 Ga0068856_100606496 3300005614 Bacteria 1116
36 Ga0068859_100073414 3300005617 Bacteria 3459
37 Ga0068866_10024874 3300005718 Unclassified 2808
38 Ga0068861_100006510 3300005719 Bacteria 7964
39 Ga0068861_100050054 3300005719 Bacteria 3166
40 Ga0068870_10921627 3300005840 Unclassified 618
41 Ga0068863_100304491 3300005841 Bacteria 1546
42 Ga0068860_100455702 3300005843 Bacteria 1272
43 Ga0068860_100537610 3300005843 Bacteria 1170
44 Ga0068862_100010627 3300005844 Bacteria 7606
45 Ga0068862_100034712 3300005844 Bacteria 4269
46 Ga0068862_101036928 3300005844 Bacteria 813
47 Ga0081455_10012536 3300005937 Bacteria 8458
48 Ga0081539_10185565 3300005985 Bacteria 972
49 Ga0075365_10090321 3300006038 Bacteria 2086
50 Ga0075368_10016472 3300006042 Bacteria 2755
51 Ga0075364_10093730 3300006051 Bacteria 1994
52 Ga0070716_100354439 3300006173 Unclassified 1040
53 Ga0070716_100512732 3300006173 Bacteria 887
54 Ga0070712_100166944 3300006175 Bacteria 1704
55 Ga0070712_100581145 3300006175 Bacteria 946
56 Ga0075362_10076210 3300006177 Bacteria 1539
57 Ga0075431_100028592 3300006847 Bacteria 5731
58 Ga0068865_100009993 3300006881 Bacteria 5899
59 Ga0068865_100110684 3300006881 Bacteria 2026
60 Ga0097620_100073410 3300006931 Bacteria 3459
61 Ga0099794_10066260 3300007265 Bacteria 1762
62 Ga0111539_10000123 3300009094 Bacteria 87000
63 Ga0111539_10171119 3300009094 Bacteria 2538
64 Ga0111539_10521348 3300009094 Unclassified 1384
65 Ga0105247_10027825 3300009101 Bacteria 3418
66 Ga0105247_10038760 3300009101 Bacteria 2910
67 Ga0105242_10304256 3300009176 Unclassified 1456
68 Ga0105029_102197 3300009984 Bacteria 1259
69 Ga0105239_10347737 3300010375 Bacteria 1674
70 Ga0157372_10142691 3300013307 Bacteria 2761
71 Ga0157375_10471639 3300013308 Bacteria 1420
72 Ga0163163_10067950 3300014325 Bacteria 3545
73 Ga0157380_10034328 3300014326 Bacteria 3912
74 Ga0157379_10010516 3300014968 Bacteria 8066
75 Ga0157379_10377346 3300014968 Bacteria 1301
76 Ga0213871_10012599 3300021441 Bacteria 1969
77 Ga0209758_1000471 3300025297 Bacteria 66374
78 Ga0209257_1000114 3300025304 Bacteria 233013
79 Ga0207682_10039033 3300025893 Unclassified 1929
80 Ga0207692_10132622 3300025898 Bacteria 1409
81 Ga0207699_10094346 3300025906 Bacteria 1885
82 Ga0207645_10005108 3300025907 Bacteria 9603
83 Ga0207693_10648581 3300025915 Unclassified 820
84 Ga0207652_10564875 3300025921 Bacteria 1022
85 Ga0207681_10029837 3300025923 Bacteria 3549
86 Ga0207681_10075688 3300025923 Bacteria 2361
87 Ga0207694_10222341 3300025924 Bacteria 1541
88 Ga0207659_10130628 3300025926 Bacteria 1938
89 Ga0207700_10274369 3300025928 Bacteria 1448
90 Ga0207700_10294974 3300025928 Bacteria 1398
91 Ga0207664_10134212 3300025929 Bacteria 2087
92 Ga0207664_10341100 3300025929 Bacteria 1325
93 Ga0207706_10005249 3300025933 Bacteria 12082
94 Ga0207669_10248567 3300025937 Bacteria 1323
95 Ga0207704_10013951 3300025938 Unclassified 4043
96 Ga0207704_10198243 3300025938 Bacteria 1467
97 Ga0207665_10191271 3300025939 Bacteria 1487
98 Ga0207665_10386255 3300025939 Bacteria 1063
99 Ga0207665_10670759 3300025939 Bacteria 814
100 Ga0207691_10025918 3300025940 Bacteria 5503
101 Ga0207711_10575004 3300025941 Bacteria 1051
102 Ga0207702_10272098 3300026078 Bacteria 1598
103 Ga0207641_10131146 3300026088 Bacteria 2251
104 Ga0207648_10007114 3300026089 Bacteria 11038
105 Ga0207675_100001013 3300026118 Bacteria 27815
106 Ga0207675_100016379 3300026118 Bacteria 6920
107 Ga0207683_10020906 3300026121 Bacteria 5600
108 Ga0210002_1024543 3300027617 Unclassified 984
109 Ga0209983_1002335 3300027665 Bacteria 4161
110 Ga0209966_1003040 3300027695 Unclassified 2815
111 Ga0209998_10000308 3300027717 Bacteria 14772
112 Ga0209974_10007840 3300027876 Unclassified 3666
113 Ga0207428_10000133 3300027907 Bacteria 100902
114 Ga0207428_10265731 3300027907 Unclassified 1277
115 Ga0268265_10017131 3300028380 Bacteria 4992
116 Ga0268265_10022790 3300028380 Bacteria 4405
117 Ga0307517_10248277 3300028786 Bacteria 1047
118 Ga0307513_10207308 3300031456 Bacteria 1795
119 Ga0307509_10000254 3300031507 Bacteria 86659
120 Ga0307508_10190466 3300031616 Bacteria 1652
121 Ga0307416_100299103 3300032002 Bacteria 1598
122 Ga0373934_0127439 3300035086 Bacteria 1037
123 Ga0373952_0039902 3300035092 Bacteria 1081
124 Ga0373945_0093815 3300035116 Bacteria 1166
125 Ga0373957_0096673 3300035120 Unclassified 1179
126 Ga0373943_0336112 3300035170 Bacteria 863
127 Ga0373931_0076538 3300035691 Bacteria 1838
128 Ga0373933_0003636 3300035724 Bacteria 8544
129 Ga0373937_0008492 3300036401 Bacteria 8925
130 Ga0373925_0197254 3300037068 Bacteria 1600
131 Ga0400483_143913 3300039062 Bacteria 4526
132 Ga0400483_224657 3300039062 Bacteria 11064
133 Ga0436360_0964433 3300039438 Bacteria 6005
134 Ga0436360_1298605 3300039438 Bacteria 2766
135 Ga0436361_0201563 3300039447 Unclassified 656
136 Ga0436363_0618635 3300039450 Bacteria 1691
137 Ga0436363_1263636 3300039450 Bacteria 7386
138 Ga0436362_1122002 3300039453 Unclassified 1695
139 Ga0450896_021641 3300042133 Bacteria 946
140 Ga0466972_0024266 3300044658 Bacteria 3010
141 Ga0466963_0178779 3300044694 Bacteria 1481
142 Ga0453684_0000377 3300044712 Bacteria 183445
143 Ga0451576_0000024 3300045051 Bacteria 470499
144 Ga0451576_0000033 3300045051 Bacteria 393131
145 Ga0451576_0001525 3300045051 Bacteria 38988
146 Ga0466967_0789347 3300045976 Bacteria 943
147 Ga0495638_0453109 3300046460 Bacteria 655
148 Ga0495664_0383299 3300046477 Bacteria 845
149 Ga0495628_0505901 3300046516 Bacteria 872
150 Ga0495586_0048683 3300046535 Bacteria 2291
151 Ga0495667_0032494 3300046559 Bacteria 3497
152 Ga0496102_0168288 3300048905 Bacteria 2063
153 Ga0496104_0034619 3300048907 Bacteria 4711
154 Ga0496104_0066288 3300048907 Bacteria 3428
155 Ga0496104_0121339 3300048907 Bacteria 2509
156 Ga0496105_0043208 3300048908 Bacteria 3717
157 Ga0496105_0081266 3300048908 Bacteria 2677
158 Ga0496110_0049224 3300048913 Bacteria 3696
159 Ga0496121_0075971 3300048924 Bacteria 2681
160 Ga0501033_0044862 3300049570 Bacteria 3291
161 Ga0501034_0320616 3300049571 Bacteria 1483
162 Ga0501038_0073660 3300049574 Bacteria 2891
163 Ga0501046_0421658 3300049580 Bacteria 962
164 Ga0501047_0118302 3300049581 Bacteria 2531
165 Ga0501073_0048982 3300049589 Bacteria 2963
166 Ga0501080_1056846 3300049742 Bacteria 702
167 Ga0501083_0052886 3300049744 Bacteria 2727
168 Ga0501035_0315022 3300049822 Bacteria 1316
169 Ga0501035_0442478 3300049822 Bacteria 1076
170 Ga0501044_0341964 3300049823 Bacteria 1417
171 Ga0501044_0610269 3300049823 Bacteria 983
172 nmdc:mga03n38_160239_c1 3300050490 Bacteria 1139
173 nmdc:mga00v17_254555_c1 3300050491 Bacteria 1139
174 nmdc:mga0yw44_160677_c1 3300050492 Bacteria 1471
175 nmdc:mga05p37_300524_c1 3300050507 Bacteria 1907
176 nmdc:mga09592_9607_c1 3300050508 Bacteria 7857
177 nmdc:mga0qj67_122074_c1 3300050509 Unclassified 2108
178 nmdc:mga0qj67_62197_c1 3300050509 Bacteria 2615
179 nmdc:mga06r32_21840_c1 3300050510 Bacteria 5910
180 nmdc:mga08y16_211_c1 3300050511 Bacteria 52298
181 nmdc:mga08y16_466057_c1 3300050511 Bacteria 1287
182 Ga0495601_0209443 3300053077 Unclassified 1274
183 Ga0495619_0024637 3300053085 Bacteria 3861
184 Ga0500644_0139457 3300053088 Bacteria 962
185 Ga0500646_0010476 3300053090 Bacteria 2379
186 Ga0500651_0012185 3300053093 Bacteria 5207
187 Ga0500566_0021648 3300053094 Bacteria 3779
188 Ga0500641_0031617 3300053096 Bacteria 2088
189 Ga0500555_024367 3300053103 Bacteria 1734
190 Ga0500595_002968 3300053119 Bacteria 8078
191 Ga0500568_0003298 3300053139 Bacteria 9102
192 Ga0500568_0141289 3300053139 Bacteria 892
193 Ga0500577_0004702 3300053142 Bacteria 3629
194 Ga0500577_0082322 3300053142 Bacteria 1286
195 Ga0500588_0004255 3300053146 Bacteria 3086
196 Ga0500588_0051028 3300053146 Bacteria 1289
197 Ga0500604_0001978 3300053151 Bacteria 5680
198 Ga0500604_0020373 3300053151 Bacteria 1866
199 Ga0500616_0001420 3300053153 Bacteria 23105
200 Ga0500609_000165 3300053731 Bacteria 9170
201 Ga0500609_002382 3300053731 Bacteria 2683
202 Ga0500599_004948 3300053736 Bacteria 1663
203 Ga0501084_0282857 3300054114 Bacteria 1401
204 Ga0501082_0006445 3300060353 Bacteria 10178
205 Ga0105242_10199279
206 JGI25153J46596_10000123
207 rootH1_10002858
208 Ga0065707_10150278
209 Ga0070676_10058449
210 Ga0070677_10014137
211 Ga0070668_100107407
212 Ga0070669_100478539
213 Ga0070671_100388372
214 Ga0070674_100001684
215 Ga0070674_100012635
216 Ga0070673_100729489
217 Ga0070659_100652766
218 Ga0070709_10303933
219 Ga0070714_100088377
220 Ga0070714_100235714
221 Ga0070713_100222047
222 Ga0070713_100504381
223 Ga0070713_100639882
224 Ga0070710_10258513
225 Ga0070710_10513510
226 Ga0070711_100233251
227 Ga0070711_100473600
228 Ga0070711_100475219
229 Ga0070694_100254223
230 Ga0070678_100058193
231 Ga0070662_100377037
232 Ga0070681_10358893
233 Ga0070681_10727384
234 Ga0068867_100007818
235 Ga0070698_100382315
236 Ga0070672_100015086
237 Ga0070696_100102599
238 Ga0068855_100772540
239 Ga0068856_100606496
240 Ga0068859_100073414
241 Ga0068866_10024874
242 Ga0068861_100006510
243 Ga0068861_100050054
244 Ga0068870_10921627
245 Ga0068863_100304491
246 Ga0068860_100455702
247 Ga0068860_100537610
248 Ga0068862_100010627
249 Ga0068862_100034712
250 Ga0068862_101036928
251 Ga0081455_10012536
252 Ga0081539_10185565
253 Ga0075365_10090321
254 Ga0075368_10016472
255 Ga0075364_10093730
256 Ga0070716_100354439
257 Ga0070716_100512732
258 Ga0070712_100166944
259 Ga0070712_100581145
260 Ga0075362_10076210
261 Ga0075431_100028592
262 Ga0068865_100009993
263 Ga0068865_100110684
264 Ga0097620_100073410
265 Ga0099794_10066260
266 Ga0111539_10000123
267 Ga0111539_10171119
268 Ga0111539_10521348
269 Ga0105247_10027825
270 Ga0105247_10038760
271 Ga0105242_10304256
272 Ga0105029_102197
273 Ga0105239_10347737
274 Ga0157372_10142691
275 Ga0157375_10471639
276 Ga0163163_10067950
277 Ga0157380_10034328
278 Ga0157379_10010516
279 Ga0157379_10377346
280 Ga0213871_10012599
281 Ga0209758_1000471
282 Ga0209257_1000114
283 Ga0207682_10039033
284 Ga0207692_10132622
285 Ga0207699_10094346
286 Ga0207645_10005108
287 Ga0207693_10648581
288 Ga0207652_10564875
289 Ga0207681_10029837
290 Ga0207681_10075688
291 Ga0207694_10222341
292 Ga0207659_10130628
293 Ga0207700_10274369
294 Ga0207700_10294974
295 Ga0207664_10134212
296 Ga0207664_10341100
297 Ga0207706_10005249
298 Ga0207669_10248567
299 Ga0207704_10013951
300 Ga0207704_10198243
301 Ga0207665_10191271
302 Ga0207665_10386255
303 Ga0207665_10670759
304 Ga0207691_10025918
305 Ga0207711_10575004
306 Ga0207702_10272098
307 Ga0207641_10131146
308 Ga0207648_10007114
309 Ga0207675_100001013
310 Ga0207675_100016379
311 Ga0207683_10020906
312 Ga0210002_1024543
313 Ga0209983_1002335
314 Ga0209966_1003040
315 Ga0209998_10000308
316 Ga0209974_10007840
317 Ga0207428_10000133
318 Ga0207428_10265731
319 Ga0268265_10017131
320 Ga0268265_10022790
321 Ga0307517_10248277
322 Ga0307513_10207308
323 Ga0307509_10000254
324 Ga0307508_10190466
325 Ga0307416_100299103
326 Ga0373934_0127439
327 Ga0373952_0039902
328 Ga0373945_0093815
329 Ga0373957_0096673
330 Ga0373943_0336112
331 Ga0373931_0076538
332 Ga0373933_0003636
333 Ga0373937_0008492
334 Ga0373925_0197254
335 Ga0400483_143913
336 Ga0400483_224657
337 Ga0436360_0964433
338 Ga0436360_1298605
339 Ga0436361_0201563
340 Ga0436363_0618635
341 Ga0436363_1263636
342 Ga0436362_1122002
343 Ga0450896_021641
344 Ga0466972_0024266
345 Ga0466963_0178779
346 Ga0453684_0000377
347 Ga0451576_0000024
348 Ga0451576_0000033
349 Ga0451576_0001525
350 Ga0466967_0789347
351 Ga0495638_0453109
352 Ga0495664_0383299
353 Ga0495628_0505901
354 Ga0495586_0048683
355 Ga0495667_0032494
356 Ga0496102_0168288
357 Ga0496104_0034619
358 Ga0496104_0066288
359 Ga0496104_0121339
360 Ga0496105_0043208
361 Ga0496105_0081266
362 Ga0496110_0049224
363 Ga0496121_0075971
364 Ga0501033_0044862
365 Ga0501034_0320616
366 Ga0501038_0073660
367 Ga0501046_0421658
368 Ga0501047_0118302
369 Ga0501073_0048982
370 Ga0501080_1056846
371 Ga0501083_0052886
372 Ga0501035_0315022
373 Ga0501035_0442478
374 Ga0501044_0341964
375 Ga0501044_0610269
376 nmdc:mga03n38_160239_c1
377 nmdc:mga00v17_254555_c1
378 nmdc:mga0yw44_160677_c1
379 nmdc:mga05p37_300524_c1
380 nmdc:mga09592_9607_c1
381 nmdc:mga0qj67_122074_c1
382 nmdc:mga0qj67_62197_c1
383 nmdc:mga06r32_21840_c1
384 nmdc:mga08y16_211_c1
385 nmdc:mga08y16_466057_c1
386 Ga0495601_0209443
387 Ga0495619_0024637
388 Ga0500644_0139457
389 Ga0500646_0010476
390 Ga0500651_0012185
391 Ga0500566_0021648
392 Ga0500641_0031617
393 Ga0500555_024367
394 Ga0500595_002968
395 Ga0500568_0003298
396 Ga0500568_0141289
397 Ga0500577_0004702
398 Ga0500577_0082322
399 Ga0500588_0004255
400 Ga0500588_0051028
401 Ga0500604_0001978
402 Ga0500604_0020373
403 Ga0500616_0001420
404 Ga0500609_000165
405 Ga0500609_002382
406 Ga0500599_004948
407 Ga0501084_0282857
408 Ga0501082_0006445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12973

Cupin_7

ChrR Cupin-like domain

39

143

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o14-assembly2.cif.gz_B crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution 0.9658 1 225
3o14-assembly2.cif.gz_B crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution 0.9574 1 225
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8701 42 108
2y0o-assembly1.cif.gz_A-2 the structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis 0.8675 137 214
7nzq-assembly1.cif.gz_AAA d-lyxose isomerase from the hyperthermophilic archaeon thermofilum sp complexed with d-mannose 0.866 137 215
ID Description Score Start End Superfamily
3o14B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9623 2 225 2.60.120.10
3o14B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9537 2 225 2.60.120.10
2y0oA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8578 137 215 2.60.120.10
3n9lA02 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.841 44 108 2.60.120.650
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8329 139 214 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A537RK98-F1-model_v4 Cupin 0.9965 1 227
AF-A0A537UMQ5-F1-model_v4 Cupin 0.9955 52 217
AF-A0A6P0IVX6-F1-model_v4 Cupin 0.9943 1 109
AF-A0A537RK98-F1-model_v4 Cupin 0.9922 1 227
AF-G7EBU1-F1-model_v4 ChrR-like cupin domain-containing protein 0.99 1 218

Map