F311537

General Info

Members Datasets Scaffolds Average Seq Length
203 92 406 169

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_1179165|Ga0451577_1179165_13_549
Length 178
Sequence MKTIEEHPVEPQTELQALRQGKDDFFKHDQQSPLTPEQKKVFTGLRYFPENPALRIEAPISRFEKIESIDMQTSTGQVQTYQRYGRFKFQVDGQEAELTVYRDRSGYFLPFVDALAGKETYPAGRYLEPEVINNQVVVDFNLAYNPYCAYNERWSCPLTPFENRLKVPIRAGEQNFHE

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
65 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
66 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
75 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
76 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
77 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
78 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
81 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
82 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
89 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
90 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
91 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
92 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.99
Rhizosphere 99.01
Stem 0
Stem Tuber 0
Unclassified 33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_1179165 3300042876 Unclassified 684
2 SwRhRL3b_contig_1175158 2162886006 Bacteria 1308
3 SwRhRL2b_contig_598413 2162886007 Unclassified 1064
4 SwRhRL2b_contig_929780 2162886007 Bacteria 3504
5 JGI25406J46586_10008220 3300003203 Bacteria 4735
6 Ga0065704_10172072 3300005289 Bacteria 1285
7 Ga0065707_10000503 3300005295 Bacteria 28730
8 Ga0065707_10082633 3300005295 Bacteria 13141
9 Ga0065707_10087080 3300005295 Bacteria 5158
10 Ga0065707_10097076 3300005295 Bacteria 3206
11 Ga0065707_10107400 3300005295 Bacteria 2555
12 Ga0068869_100711302 3300005334 Bacteria 857
13 Ga0070689_100037398 3300005340 Unclassified 3711
14 Ga0070687_101186992 3300005343 Unclassified 562
15 Ga0070705_100156045 3300005440 Bacteria 1520
16 Ga0070705_100181331 3300005440 Unclassified 1427
17 Ga0070700_100411645 3300005441 Bacteria 1019
18 Ga0070694_100098649 3300005444 Unclassified 2063
19 Ga0070685_10512834 3300005466 Bacteria 850
20 Ga0070706_100491715 3300005467 Unclassified 1142
21 Ga0070706_100852058 3300005467 Unclassified 843
22 Ga0070698_100020523 3300005471 Bacteria 6927
23 Ga0070699_100006793 3300005518 Bacteria 9955
24 Ga0070699_100016565 3300005518 Bacteria 6326
25 Ga0070699_100055720 3300005518 Bacteria 3423
26 Ga0070697_100678997 3300005536 Unclassified 908
27 Ga0070695_100272720 3300005545 Unclassified 1240
28 Ga0070695_100729123 3300005545 Unclassified 789
29 Ga0070696_100030580 3300005546 Bacteria 3688
30 Ga0070696_101336875 3300005546 Unclassified 609
31 Ga0070704_100332494 3300005549 Unclassified 1277
32 Ga0070704_100781674 3300005549 Unclassified 852
33 Ga0070702_100371970 3300005615 Unclassified 1013
34 Ga0068859_100063032 3300005617 Unclassified 3737
35 Ga0068859_100205640 3300005617 Bacteria 2054
36 Ga0068859_101217591 3300005617 Bacteria 829
37 Ga0068864_100227128 3300005618 Bacteria 1725
38 Ga0068862_100065927 3300005844 Unclassified 3119
39 Ga0068862_100085663 3300005844 Bacteria 2738
40 Ga0068862_100257476 3300005844 Bacteria 1592
41 Ga0068862_100965909 3300005844 Unclassified 841
42 Ga0081539_10002974 3300005985 Bacteria 22229
43 Ga0081539_10021805 3300005985 Unclassified 4264
44 Ga0075427_10002896 3300006194 Bacteria 2331
45 Ga0075428_100012588 3300006844 Bacteria 9404
46 Ga0075428_100046638 3300006844 Bacteria 4759
47 Ga0075428_100445512 3300006844 Bacteria 1387
48 Ga0075430_100069420 3300006846 Bacteria 2956
49 Ga0075430_100178075 3300006846 Bacteria 1769
50 Ga0075430_100460030 3300006846 Unclassified 1050
51 Ga0075431_100052626 3300006847 Unclassified 4199
52 Ga0075431_100157603 3300006847 Bacteria 2335
53 Ga0075431_100205310 3300006847 Unclassified 2015
54 Ga0075431_100213020 3300006847 Unclassified 1973
55 Ga0075433_10049307 3300006852 Bacteria 3663
56 Ga0075433_10156215 3300006852 Unclassified 2029
57 Ga0075433_11103174 3300006852 Unclassified 690
58 Ga0075429_100008593 3300006880 Bacteria 8883
59 Ga0075429_100025927 3300006880 Bacteria 5088
60 Ga0075429_100184510 3300006880 Unclassified 1828
61 Ga0075429_100332093 3300006880 Bacteria 1330
62 Ga0075429_100502273 3300006880 Unclassified 1063
63 Ga0097620_100063030 3300006931 Unclassified 3737
64 Ga0097620_100205651 3300006931 Bacteria 2054
65 Ga0097620_101217273 3300006931 Bacteria 829
66 Ga0111539_10452616 3300009094 Bacteria 1495
67 Ga0114129_10000808 3300009147 Bacteria 40249
68 Ga0114129_10014459 3300009147 Bacteria 11247
69 Ga0114129_10091494 3300009147 Bacteria 4215
70 Ga0114129_10099070 3300009147 Bacteria 4034
71 Ga0114129_10156554 3300009147 Bacteria 3115
72 Ga0114129_10180640 3300009147 Bacteria 2871
73 Ga0114129_11596839 3300009147 Unclassified 799
74 Ga0105243_10039510 3300009148 Bacteria 3679
75 Ga0105243_10067973 3300009148 Unclassified 2871
76 Ga0105242_10078738 3300009176 Unclassified 2752
77 Ga0105242_11247360 3300009176 Bacteria 765
78 Ga0105249_10247117 3300009553 Bacteria 1767
79 Ga0105239_11840080 3300010375 Unclassified 702
80 Ga0105246_10013931 3300011119 Bacteria 5048
81 Ga0105246_10031701 3300011119 Unclassified 3499
82 Ga0163162_11937366 3300013306 Unclassified 675
83 Ga0157380_10367556 3300014326 Bacteria 1352
84 Ga0157380_10510602 3300014326 Bacteria 1170
85 Ga0207643_10252064 3300025908 Bacteria 1087
86 Ga0207660_10229409 3300025917 Bacteria 1459
87 Ga0207709_10291899 3300025935 Bacteria 1209
88 Ga0207670_10042089 3300025936 Unclassified 3008
89 Ga0207712_10331092 3300025961 Bacteria 1260
90 Ga0207676_10471617 3300026095 Bacteria 1187
91 Ga0210002_1047851 3300027617 Unclassified 734
92 Ga0268265_10062389 3300028380 Bacteria 2864
93 Ga0268265_10455011 3300028380 Unclassified 1196
94 Ga0268265_10505730 3300028380 Bacteria 1139
95 Ga0268265_10623765 3300028380 Bacteria 1033
96 Ga0265336_10053074 3300028666 Bacteria 1222
97 Ga0265338_10261511 3300028800 Bacteria 1272
98 Ga0265320_10359647 3300031240 Bacteria 643
99 Ga0265316_10484595 3300031344 Unclassified 885
100 Ga0307405_10016625 3300031731 Bacteria 4017
101 Ga0307405_10503662 3300031731 Unclassified 971
102 Ga0316577_10491932 3300031733 Unclassified 697
103 Ga0307413_10556856 3300031824 Unclassified 931
104 Ga0307410_10026894 3300031852 Bacteria 3629
105 Ga0307410_10139456 3300031852 Bacteria 1792
106 Ga0307407_10251852 3300031903 Bacteria 1210
107 Ga0307416_100410595 3300032002 Bacteria 1395
108 Ga0307415_100601781 3300032126 Bacteria 978
109 Ga0307415_100741689 3300032126 Unclassified 891
110 Ga0307415_101435447 3300032126 Unclassified 658
111 Ga0316593_10173543 3300032168 Unclassified 791
112 Ga0316582_0070781 3300036647 Unclassified 2257
113 Ga0316584_0101469 3300036712 Bacteria 2155
114 Ga0316581_0046175 3300037588 Bacteria 1331
115 Ga0242420_027456 3300038996 Bacteria 1043
116 Ga0451800_0199349 3300041459 Bacteria 1081
117 Ga0451577_0235278 3300042876 Bacteria 1657
118 Ga0451577_0351311 3300042876 Bacteria 1337
119 Ga0451577_1309175 3300042876 Bacteria 644
120 Ga0453683_0001884 3300044673 Bacteria 17187
121 Ga0453683_0011945 3300044673 Bacteria 5707
122 Ga0453683_0017536 3300044673 Bacteria 4610
123 Ga0453683_0088315 3300044673 Bacteria 1943
124 Ga0453683_0099700 3300044673 Bacteria 1824
125 Ga0453683_0326005 3300044673 Bacteria 984
126 Ga0453683_0354169 3300044673 Bacteria 943
127 Ga0453683_0921704 3300044673 Unclassified 578
128 Ga0453684_0001008 3300044712 Bacteria 91215
129 Ga0453684_0002206 3300044712 Bacteria 48402
130 Ga0453684_0004809 3300044712 Bacteria 27793
131 Ga0453684_0018076 3300044712 Bacteria 10852
132 Ga0453684_0018718 3300044712 Bacteria 10605
133 Ga0453684_0025118 3300044712 Bacteria 8666
134 Ga0453684_0028526 3300044712 Bacteria 7959
135 Ga0453684_0058584 3300044712 Bacteria 4973
136 Ga0453684_0179436 3300044712 Bacteria 2487
137 Ga0453684_0183702 3300044712 Bacteria 2453
138 Ga0453684_0218014 3300044712 Bacteria 2212
139 Ga0453684_0253342 3300044712 Unclassified 2021
140 Ga0453684_0309572 3300044712 Bacteria 1793
141 Ga0453684_0342271 3300044712 Bacteria 1688
142 Ga0453684_0343141 3300044712 Unclassified 1686
143 Ga0453684_0367768 3300044712 Bacteria 1617
144 Ga0453684_0395060 3300044712 Bacteria 1550
145 Ga0453684_0413519 3300044712 Bacteria 1508
146 Ga0453684_0551098 3300044712 Unclassified 1270
147 Ga0453684_0811748 3300044712 Bacteria 1008
148 Ga0453684_1332211 3300044712 Unclassified 747
149 Ga0453684_1361929 3300044712 Bacteria 738
150 Ga0451576_0003853 3300045051 Bacteria 20127
151 Ga0451576_0040285 3300045051 Unclassified 4946
152 Ga0451576_0050636 3300045051 Bacteria 4355
153 Ga0451576_0071985 3300045051 Bacteria 3598
154 Ga0451576_0106010 3300045051 Bacteria 2925
155 Ga0451576_0115806 3300045051 Unclassified 2790
156 Ga0451576_0175809 3300045051 Bacteria 2235
157 Ga0451576_0188642 3300045051 Bacteria 2153
158 Ga0451576_0388037 3300045051 Unclassified 1464
159 Ga0451576_0684585 3300045051 Bacteria 1077
160 Ga0451576_1939259 3300045051 Unclassified 607
161 Ga0496108_0445835 3300048911 Unclassified 1131
162 Ga0501041_0058497 3300049577 Bacteria 2358
163 Ga0501048_0605540 3300049582 Unclassified 787
164 Ga0501068_0360965 3300049584 Unclassified 934
165 Ga0501071_0126010 3300049587 Bacteria 1901
166 Ga0501072_0289213 3300049588 Unclassified 1303
167 Ga0501072_0568218 3300049588 Bacteria 895
168 Ga0501073_0678906 3300049589 Bacteria 711
169 Ga0501074_1014530 3300049590 Bacteria 583
170 Ga0501075_0084075 3300049591 Bacteria 2410
171 Ga0501075_0272558 3300049591 Archaea 1290
172 Ga0501076_0140764 3300049592 Unclassified 1960
173 Ga0501245_062853 3300049708 Unclassified 683
174 Ga0501079_0030500 3300049741 Bacteria 4143
175 Ga0501079_1100667 3300049741 Bacteria 626
176 Ga0501080_0153070 3300049742 Bacteria 2131
177 Ga0501080_1144334 3300049742 Unclassified 671
178 Ga0501081_0033036 3300049743 Bacteria 3513
179 Ga0501081_0212349 3300049743 Bacteria 1406
180 nmdc:mga05p37_14820_c1 3300050507 Bacteria 9360
181 nmdc:mga05p37_161789_c2 3300050507 Bacteria 1912
182 nmdc:mga05p37_16261_c1 3300050507 Bacteria 8958
183 nmdc:mga05p37_44365_c1 3300050507 Bacteria 5470
184 nmdc:mga05p37_56145_c1 3300050507 Unclassified 4848
185 nmdc:mga05p37_661_c1 3300050507 Bacteria 38042
186 nmdc:mga09592_236950_c1 3300050508 Unclassified 1581
187 nmdc:mga09592_250001_c1 3300050508 Bacteria 1537
188 nmdc:mga09592_42882_c1 3300050508 Bacteria 3806
189 nmdc:mga09592_5873_c1 3300050508 Bacteria 10018
190 nmdc:mga0qj67_146159_c1 3300050509 Unclassified 1917
191 nmdc:mga0qj67_214528_c1 3300050509 Bacteria 1563
192 nmdc:mga0qj67_714256_c1 3300050509 Unclassified 797
193 nmdc:mga06r32_105531_c1 3300050510 Bacteria 2768
194 nmdc:mga06r32_380701_c1 3300050510 Bacteria 1394
195 nmdc:mga06r32_69030_c1 3300050510 Unclassified 3415
196 nmdc:mga0n895_987867_c1 3300050512 Bacteria 824
197 nmdc:mga0a205_58005_c1 3300050515 Bacteria 3739
198 nmdc:mga0a205_963920_c1 3300050515 Unclassified 700
199 Ga0501084_0166009 3300054114 Bacteria 1863
200 Ga0501082_0245102 3300060353 Bacteria 1560
201 Ga0501082_0472087 3300060353 Bacteria 1096
202 Ga0530510_0045889 3300061734 Bacteria 3157
203 Ga0530510_0864580 3300061734 Bacteria 691
204 Ga0451577_1179165
205 SwRhRL3b_contig_1175158
206 SwRhRL2b_contig_598413
207 SwRhRL2b_contig_929780
208 JGI25406J46586_10008220
209 Ga0065704_10172072
210 Ga0065707_10000503
211 Ga0065707_10082633
212 Ga0065707_10087080
213 Ga0065707_10097076
214 Ga0065707_10107400
215 Ga0068869_100711302
216 Ga0070689_100037398
217 Ga0070687_101186992
218 Ga0070705_100156045
219 Ga0070705_100181331
220 Ga0070700_100411645
221 Ga0070694_100098649
222 Ga0070685_10512834
223 Ga0070706_100491715
224 Ga0070706_100852058
225 Ga0070698_100020523
226 Ga0070699_100006793
227 Ga0070699_100016565
228 Ga0070699_100055720
229 Ga0070697_100678997
230 Ga0070695_100272720
231 Ga0070695_100729123
232 Ga0070696_100030580
233 Ga0070696_101336875
234 Ga0070704_100332494
235 Ga0070704_100781674
236 Ga0070702_100371970
237 Ga0068859_100063032
238 Ga0068859_100205640
239 Ga0068859_101217591
240 Ga0068864_100227128
241 Ga0068862_100065927
242 Ga0068862_100085663
243 Ga0068862_100257476
244 Ga0068862_100965909
245 Ga0081539_10002974
246 Ga0081539_10021805
247 Ga0075427_10002896
248 Ga0075428_100012588
249 Ga0075428_100046638
250 Ga0075428_100445512
251 Ga0075430_100069420
252 Ga0075430_100178075
253 Ga0075430_100460030
254 Ga0075431_100052626
255 Ga0075431_100157603
256 Ga0075431_100205310
257 Ga0075431_100213020
258 Ga0075433_10049307
259 Ga0075433_10156215
260 Ga0075433_11103174
261 Ga0075429_100008593
262 Ga0075429_100025927
263 Ga0075429_100184510
264 Ga0075429_100332093
265 Ga0075429_100502273
266 Ga0097620_100063030
267 Ga0097620_100205651
268 Ga0097620_101217273
269 Ga0111539_10452616
270 Ga0114129_10000808
271 Ga0114129_10014459
272 Ga0114129_10091494
273 Ga0114129_10099070
274 Ga0114129_10156554
275 Ga0114129_10180640
276 Ga0114129_11596839
277 Ga0105243_10039510
278 Ga0105243_10067973
279 Ga0105242_10078738
280 Ga0105242_11247360
281 Ga0105249_10247117
282 Ga0105239_11840080
283 Ga0105246_10013931
284 Ga0105246_10031701
285 Ga0163162_11937366
286 Ga0157380_10367556
287 Ga0157380_10510602
288 Ga0207643_10252064
289 Ga0207660_10229409
290 Ga0207709_10291899
291 Ga0207670_10042089
292 Ga0207712_10331092
293 Ga0207676_10471617
294 Ga0210002_1047851
295 Ga0268265_10062389
296 Ga0268265_10455011
297 Ga0268265_10505730
298 Ga0268265_10623765
299 Ga0265336_10053074
300 Ga0265338_10261511
301 Ga0265320_10359647
302 Ga0265316_10484595
303 Ga0307405_10016625
304 Ga0307405_10503662
305 Ga0316577_10491932
306 Ga0307413_10556856
307 Ga0307410_10026894
308 Ga0307410_10139456
309 Ga0307407_10251852
310 Ga0307416_100410595
311 Ga0307415_100601781
312 Ga0307415_100741689
313 Ga0307415_101435447
314 Ga0316593_10173543
315 Ga0316582_0070781
316 Ga0316584_0101469
317 Ga0316581_0046175
318 Ga0242420_027456
319 Ga0451800_0199349
320 Ga0451577_0235278
321 Ga0451577_0351311
322 Ga0451577_1309175
323 Ga0453683_0001884
324 Ga0453683_0011945
325 Ga0453683_0017536
326 Ga0453683_0088315
327 Ga0453683_0099700
328 Ga0453683_0326005
329 Ga0453683_0354169
330 Ga0453683_0921704
331 Ga0453684_0001008
332 Ga0453684_0002206
333 Ga0453684_0004809
334 Ga0453684_0018076
335 Ga0453684_0018718
336 Ga0453684_0025118
337 Ga0453684_0028526
338 Ga0453684_0058584
339 Ga0453684_0179436
340 Ga0453684_0183702
341 Ga0453684_0218014
342 Ga0453684_0253342
343 Ga0453684_0309572
344 Ga0453684_0342271
345 Ga0453684_0343141
346 Ga0453684_0367768
347 Ga0453684_0395060
348 Ga0453684_0413519
349 Ga0453684_0551098
350 Ga0453684_0811748
351 Ga0453684_1332211
352 Ga0453684_1361929
353 Ga0451576_0003853
354 Ga0451576_0040285
355 Ga0451576_0050636
356 Ga0451576_0071985
357 Ga0451576_0106010
358 Ga0451576_0115806
359 Ga0451576_0175809
360 Ga0451576_0188642
361 Ga0451576_0388037
362 Ga0451576_0684585
363 Ga0451576_1939259
364 Ga0496108_0445835
365 Ga0501041_0058497
366 Ga0501048_0605540
367 Ga0501068_0360965
368 Ga0501071_0126010
369 Ga0501072_0289213
370 Ga0501072_0568218
371 Ga0501073_0678906
372 Ga0501074_1014530
373 Ga0501075_0084075
374 Ga0501075_0272558
375 Ga0501076_0140764
376 Ga0501245_062853
377 Ga0501079_0030500
378 Ga0501079_1100667
379 Ga0501080_0153070
380 Ga0501080_1144334
381 Ga0501081_0033036
382 Ga0501081_0212349
383 nmdc:mga05p37_14820_c1
384 nmdc:mga05p37_161789_c2
385 nmdc:mga05p37_16261_c1
386 nmdc:mga05p37_44365_c1
387 nmdc:mga05p37_56145_c1
388 nmdc:mga05p37_661_c1
389 nmdc:mga09592_236950_c1
390 nmdc:mga09592_250001_c1
391 nmdc:mga09592_42882_c1
392 nmdc:mga09592_5873_c1
393 nmdc:mga0qj67_146159_c1
394 nmdc:mga0qj67_214528_c1
395 nmdc:mga0qj67_714256_c1
396 nmdc:mga06r32_105531_c1
397 nmdc:mga06r32_380701_c1
398 nmdc:mga06r32_69030_c1
399 nmdc:mga0n895_987867_c1
400 nmdc:mga0a205_58005_c1
401 nmdc:mga0a205_963920_c1
402 Ga0501084_0166009
403 Ga0501082_0245102
404 Ga0501082_0472087
405 Ga0530510_0045889
406 Ga0530510_0864580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07920

DUF1684

Protein of unknown function (DUF1684)

40

174

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fj4-assembly2.cif.gz_A crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.9355 4 166
4fj4-assembly1.cif.gz_B crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.9315 4 167
4dlh-assembly2.cif.gz_B crystal structure of the protein q9hre7 from halobacterium salinarium at the resolution 1.9a, northeast structural genomics consortium (nesg) target hsr50 0.9073 4 166
4fj4-assembly1.cif.gz_B crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.9003 4 167
4fj4-assembly2.cif.gz_A crystal structure of the protein q9hre7 complexed with mercury from halobacterium salinarium at the resolution 2.1a, northeast structural genomics consortium target hsr50 0.8987 4 166
ID Description Score Start End Superfamily
af_Q9XW34_65_172_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.7853 70 96 3.30.505.10
af_E7F166_349_481_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.7739 70 96 3.30.505.10
af_M9PHY7_834_962_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.772 70 96 3.30.505.10
af_G5EBM6_55_158_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.7695 70 96 3.30.505.10
1qadA00 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.7428 70 96 3.30.505.10
ID Description Score Start End GO Terms
AF-A0A3N5RUD2-F1-model_v4 DUF1684 domain-containing protein 0.9997 3 169
AF-A0A7C1ET44-F1-model_v4 DUF1684 domain-containing protein 0.9916 1 169
AF-A0A524PIX0-F1-model_v4 DUF1684 domain-containing protein 0.988 33 167
AF-A0A0P6Y7Q0-F1-model_v4 DUF1684 domain-containing protein 0.9864 4 167
AF-A0A523K4L1-F1-model_v4 DUF1684 domain-containing protein 0.9863 1 167

Map