F310312

General Info

Members Datasets Scaffolds Average Seq Length
202 140 199 340

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0012314|Ga0495640_0012314_1711_2964
Length 409
Sequence MAVGAAENSVESPVFCKSSRAAVNLPRYDGSPWHLHAGLTLFDDDRYEGPAFKPNRENQLGGLASPLEFGAPLVSVSPTDVNEDALSTLVRLVQADLEACNDVIVARMDSPVALIPQLAAHIVAAGGKRLRPLLTLASARLCGYPGSETRHVDLAACVEFIHTATLLHDDVVDESRLRRGLASANAIFGNKASVLVGDFLFARSFQLMVDDGSLRVLAILSKAAATIAEGEVLQLVTQNDLSTTESRYLEVIQGKTAALFAAACQIGAVVADRPEHEEDALAAYGMKLGIAFQLVDDALDYVADEATLGKTIGDDFREGKITLPVLAAFLAGDDREKAFWRRTIETLEQTDEDLDHAMRLIAQHGAIKTTLDRAQRFVQEAKDALLVFPDTPIRRALEGVADYSVHRLR

Samples

Sample ID Description Type Environment
1 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
2 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
3 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
29 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
66 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
131 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
134 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
137 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.87
Nodule 0.5
Rhizoplane 0
Rhizosphere 76.73
Stem 0
Stem Tuber 0
Unclassified 9.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000225 3300003187 Bacteria 66974
2 JGI25153J46596_10000042 3300003215 Bacteria 161788
3 Ga0055531_10026652 3300003794 Bacteria 2053
4 Ga0070714_100190345 3300005435 Bacteria 1872
5 Ga0070713_100171262 3300005436 Bacteria 1945
6 Ga0070713_100273568 3300005436 Bacteria 1547
7 Ga0070705_100023992 3300005440 Bacteria 3285
8 Ga0070694_100111971 3300005444 Bacteria 1946
9 Ga0070695_100009217 3300005545 Bacteria 5868
10 Ga0070696_100049707 3300005546 Bacteria 2914
11 Ga0068856_100203757 3300005614 Bacteria 1993
12 Ga0068856_100584404 3300005614 Bacteria 1138
13 Ga0068862_100030468 3300005844 Bacteria 4547
14 Ga0068862_100057921 3300005844 Bacteria 3323
15 Ga0081455_10312295 3300005937 Bacteria 1123
16 Ga0081538_10023018 3300005981 Bacteria 4491
17 Ga0081540_1036280 3300005983 Bacteria 2631
18 Ga0105240_10027863 3300009093 Bacteria 7391
19 Ga0105240_10033010 3300009093 Bacteria 6692
20 Ga0105240_10199095 3300009093 Bacteria 2349
21 Ga0111539_10000097 3300009094 Bacteria 91946
22 Ga0111539_10427538 3300009094 Bacteria 1542
23 Ga0105248_10121017 3300009177 Bacteria 2952
24 Ga0105237_10497059 3300009545 Bacteria 1226
25 Ga0105239_10068360 3300010375 Bacteria 3904
26 Ga0105239_10343513 3300010375 Bacteria 1685
27 Ga0157370_10080294 3300013104 Bacteria 3071
28 Ga0163163_10028117 3300014325 Bacteria 5396
29 Ga0157380_10040755 3300014326 Bacteria 3620
30 Ga0157379_10113373 3300014968 Bacteria 2436
31 Ga0213875_10002600 3300021388 Bacteria 10727
32 Ga0213875_10006278 3300021388 Bacteria 6255
33 Ga0213875_10013437 3300021388 Bacteria 4020
34 Ga0213871_10003678 3300021441 Bacteria 2989
35 Ga0209148_1001490 3300025254 Bacteria 11700
36 Ga0209455_1000564 3300025272 Bacteria 24785
37 Ga0209130_1000328 3300025284 Bacteria 54726
38 Ga0209676_1041859 3300025292 Bacteria 1276
39 Ga0209025_1000224 3300025294 Bacteria 133328
40 Ga0209758_1000110 3300025297 Bacteria 213110
41 Ga0209758_1001786 3300025297 Bacteria 23762
42 Ga0209050_1005607 3300025298 Bacteria 7792
43 Ga0207426_1000151 3300025302 Bacteria 185103
44 Ga0209257_1000407 3300025304 Bacteria 83438
45 Ga0209257_1039908 3300025304 Bacteria 1406
46 Ga0207695_10037957 3300025913 Bacteria 5193
47 Ga0207693_10113200 3300025915 Bacteria 2129
48 Ga0207652_10525890 3300025921 Bacteria 1064
49 Ga0207681_10114173 3300025923 Bacteria 1970
50 Ga0207694_10000385 3300025924 Bacteria 41099
51 Ga0207700_10053947 3300025928 Bacteria 3015
52 Ga0207700_10290197 3300025928 Bacteria 1410
53 Ga0207669_10041389 3300025937 Bacteria 2681
54 Ga0207704_10137353 3300025938 Bacteria 1704
55 Ga0207667_10129889 3300025949 Bacteria 2595
56 Ga0207675_100006055 3300026118 Bacteria 11510
57 Ga0207428_10004460 3300027907 Bacteria 13283
58 Ga0268266_10000520 3300028379 Bacteria 54335
59 Ga0268266_10077395 3300028379 Bacteria 2892
60 Ga0268265_10010483 3300028380 Bacteria 6258
61 Ga0268265_10153470 3300028380 Bacteria 1945
62 Ga0265318_10040260 3300028577 Bacteria 1780
63 Ga0307517_10162697 3300028786 Bacteria 1493
64 Ga0265338_10176227 3300028800 Bacteria 1634
65 Ga0265328_10001722 3300031239 Bacteria 10022
66 Ga0265331_10000078 3300031250 Bacteria 143415
67 Ga0265331_10006414 3300031250 Bacteria 6956
68 Ga0265327_10000294 3300031251 Bacteria 96710
69 Ga0307513_10030599 3300031456 Bacteria 6112
70 Ga0316578_10017454 3300031728 Bacteria 3905
71 Ga0307516_10108813 3300031730 Bacteria 2578
72 Ga0307413_10090358 3300031824 Bacteria 1992
73 Ga0307410_10221962 3300031852 Bacteria 1454
74 Ga0307412_10039544 3300031911 Bacteria 3046
75 Ga0307409_100111882 3300031995 Bacteria 2291
76 Ga0307414_10373036 3300032004 Bacteria 1231
77 Ga0373934_0056393 3300035086 Bacteria 1563
78 Ga0373939_0023698 3300035114 Bacteria 1703
79 Ga0373956_0066799 3300035119 Bacteria 1636
80 Ga0373947_0148848 3300035725 Bacteria 1506
81 Ga0373937_0020766 3300036401 Bacteria 5890
82 Ga0373937_0224363 3300036401 Bacteria 1769
83 Ga0373925_0079379 3300037068 Bacteria 2493
84 Ga0395899_0064827 3300037312 Bacteria 2685
85 Ga0395899_0208196 3300037312 Bacteria 1360
86 Ga0395900_0070138 3300037418 Bacteria 3603
87 Ga0436364_0182519 3300037853 Bacteria 1324
88 Ga0436364_0941645 3300037853 Bacteria 4579
89 Ga0436364_0984485 3300037853 Bacteria 2624
90 Ga0436364_1033166 3300037853 Bacteria 1987
91 Ga0436364_1248975 3300037853 Bacteria 21770
92 Ga0436364_1553373 3300037853 Bacteria 9291
93 Ga0436365_0373356 3300039437 Bacteria 1611
94 Ga0436365_0543366 3300039437 Bacteria 3209
95 Ga0436365_0548662 3300039437 Bacteria 2065
96 Ga0436360_0201103 3300039438 Bacteria 3258
97 Ga0436360_0357311 3300039438 Bacteria 2058
98 Ga0436360_0418122 3300039438 Bacteria 5398
99 Ga0436360_0845431 3300039438 Bacteria 5347
100 Ga0436360_0955694 3300039438 Bacteria 7245
101 Ga0436361_0320659 3300039447 Bacteria 2378
102 Ga0436361_0684421 3300039447 Bacteria 7272
103 Ga0436362_0118689 3300039453 Bacteria 3480
104 Ga0439431_0006267 3300041997 Bacteria 2626
105 Ga0451577_0059274 3300042876 Bacteria 3413
106 Ga0453684_0030873 3300044712 Bacteria 7554
107 Ga0451576_0001747 3300045051 Bacteria 35699
108 Ga0451576_0004283 3300045051 Bacteria 18688
109 Ga0451576_0038049 3300045051 Bacteria 5093
110 Ga0451576_0062280 3300045051 Bacteria 3889
111 Ga0451576_0103109 3300045051 Bacteria 2968
112 Ga0495592_0060036 3300046454 Bacteria 2798
113 Ga0495629_0140893 3300046459 Bacteria 1678
114 Ga0495638_0170700 3300046460 Bacteria 1248
115 Ga0495651_0049203 3300046462 Bacteria 3254
116 Ga0495653_0218620 3300046463 Bacteria 1282
117 Ga0495664_0005426 3300046477 Bacteria 7004
118 Ga0495664_0205097 3300046477 Bacteria 1194
119 Ga0495610_0017893 3300046512 Bacteria 4024
120 Ga0495628_0019337 3300046516 Bacteria 5632
121 Ga0495628_0214942 3300046516 Bacteria 1445
122 Ga0495652_0338236 3300046529 Bacteria 1082
123 Ga0495640_0012314 3300046533 Bacteria 6540
124 Ga0495640_0091175 3300046533 Bacteria 2011
125 Ga0495645_0082300 3300046543 Bacteria 2309
126 Ga0495667_0024227 3300046559 Bacteria 4087
127 Ga0495667_0131569 3300046559 Bacteria 1614
128 Ga0495635_0032519 3300046663 Bacteria 3619
129 Ga0495599_0035500 3300046678 Bacteria 3130
130 Ga0495674_0095787 3300047319 Bacteria 2530
131 Ga0495675_0021837 3300047444 Bacteria 4077
132 Ga0495684_0127329 3300047471 Bacteria 1915
133 Ga0495602_0011870 3300048088 Bacteria 8989
134 Ga0495602_0053226 3300048088 Bacteria 3587
135 Ga0496119_0006524 3300048922 Bacteria 10768
136 Ga0496120_0029500 3300048923 Bacteria 3348
137 Ga0496126_0147163 3300048929 Bacteria 2022
138 Ga0501032_0007096 3300049569 Bacteria 8205
139 Ga0501032_0075938 3300049569 Bacteria 2238
140 Ga0501033_0004526 3300049570 Bacteria 11127
141 Ga0501034_0093891 3300049571 Bacteria 2997
142 Ga0501034_0193574 3300049571 Bacteria 1995
143 Ga0501034_0205582 3300049571 Bacteria 1925
144 Ga0501036_0011044 3300049572 Bacteria 7468
145 Ga0501038_0013957 3300049574 Bacteria 7322
146 Ga0501038_0092314 3300049574 Bacteria 2535
147 Ga0501038_0108830 3300049574 Bacteria 2297
148 Ga0501038_0113720 3300049574 Bacteria 2240
149 Ga0501039_0035521 3300049575 Bacteria 3846
150 Ga0501043_0007821 3300049579 Bacteria 8452
151 Ga0501043_0239571 3300049579 Bacteria 1399
152 Ga0501046_0039333 3300049580 Bacteria 3788
153 Ga0501047_0055101 3300049581 Bacteria 3845
154 Ga0501047_0075103 3300049581 Bacteria 3253
155 Ga0501047_0156363 3300049581 Bacteria 2153
156 Ga0501047_0232446 3300049581 Bacteria 1697
157 Ga0501048_0042402 3300049582 Bacteria 3258
158 Ga0501067_0021970 3300049583 Bacteria 3530
159 Ga0501069_0000207 3300049585 Bacteria 26116
160 Ga0501070_0004092 3300049586 Bacteria 12539
161 Ga0501070_0133805 3300049586 Bacteria 2047
162 Ga0501072_0063310 3300049588 Bacteria 2918
163 Ga0501073_0005221 3300049589 Bacteria 9740
164 Ga0501073_0049368 3300049589 Bacteria 2951
165 Ga0501074_0118391 3300049590 Bacteria 1894
166 Ga0501076_0117441 3300049592 Bacteria 2153
167 Ga0501079_0092415 3300049741 Bacteria 2344
168 Ga0501080_0013536 3300049742 Bacteria 7509
169 Ga0501080_0092112 3300049742 Bacteria 2815
170 Ga0501080_0167821 3300049742 Bacteria 2025
171 Ga0501083_0002752 3300049744 Bacteria 12150
172 Ga0501035_0101503 3300049822 Bacteria 2524
173 Ga0501044_0012656 3300049823 Bacteria 9136
174 Ga0501044_0027163 3300049823 Bacteria 6053
175 Ga0501044_0067526 3300049823 Bacteria 3643
176 Ga0501044_0182152 3300049823 Bacteria 2067
177 nmdc:mga05p37_390419_c1 3300050507 Bacteria 1628
178 nmdc:mga08y16_179_c1 3300050511 Bacteria 56078
179 Ga0495601_0007700 3300053077 Bacteria 6331
180 Ga0495601_0138674 3300053077 Bacteria 1586
181 Ga0495612_0003474 3300053078 Bacteria 6530
182 Ga0495619_0076056 3300053085 Bacteria 2253
183 Ga0500578_0063019 3300053086 Bacteria 2366
184 Ga0500651_0071902 3300053093 Bacteria 2151
185 Ga0500641_0035558 3300053096 Bacteria 1988
186 Ga0500555_002457 3300053103 Bacteria 5356
187 Ga0500595_002879 3300053119 Bacteria 8248
188 Ga0500595_008231 3300053119 Bacteria 4273
189 Ga0500642_0012067 3300053130 Bacteria 3119
190 Ga0500642_0025596 3300053130 Bacteria 2398
191 Ga0500588_0000065 3300053146 Bacteria 16577
192 Ga0500588_0005142 3300053146 Bacteria 2887
193 Ga0500604_0000718 3300053151 Bacteria 9054
194 Ga0500616_0002189 3300053153 Bacteria 16828
195 Ga0501084_0014217 3300054114 Bacteria 6592
196 Ga0501082_0032880 3300060353 Bacteria 4473
197 Ga0501082_0051962 3300060353 Bacteria 3532
198 Ga0501082_0053019 3300060353 Bacteria 3497
199 Ga0501082_0461720 3300060353 Bacteria 1110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0066799 Ga0373956_0066799_293_1276 291
2 3300046477 Ga0495664_0005426 Ga0495664_0005426_2439_3422 291
3 3300046516 Ga0495628_0214942 Ga0495628_0214942_251_1234 291
4 3300046533 Ga0495640_0091175 Ga0495640_0091175_1006_1989 291
5 3300046559 Ga0495667_0024227 Ga0495667_0024227_3035_4018 291
6 3300046663 Ga0495635_0032519 Ga0495635_0032519_1570_2553 291
7 3300046678 Ga0495599_0035500 Ga0495599_0035500_1012_1995 291
8 3300047319 Ga0495674_0095787 Ga0495674_0095787_1350_2333 291
9 3300047444 Ga0495675_0021837 Ga0495675_0021837_530_1513 291
10 3300048088 Ga0495602_0011870 Ga0495602_0011870_3633_4616 291
11 3300053077 Ga0495601_0007700 Ga0495601_0007700_4358_5341 291
12 3300053078 Ga0495612_0003474 Ga0495612_0003474_1196_2179 291
13 3300046463 Ga0495653_0218620 Ga0495653_0218620_79_1104 297
14 3300047471 Ga0495684_0127329 Ga0495684_0127329_867_1892 297
15 3300053085 Ga0495619_0076056 Ga0495619_0076056_24_1049 297
16 3300003794 Ga0055531_10026652 Ga0055531_100266522 311
17 3300005937 Ga0081455_10312295 Ga0081455_103122951 311
18 3300028786 Ga0307517_10162697 Ga0307517_101626971 311
19 3300005983 Ga0081540_1036280 Ga0081540_10362803 314
20 3300009093 Ga0105240_10033010 Ga0105240_100330103 317
21 3300036401 Ga0373937_0224363 Ga0373937_0224363_446_1414 318
22 3300025921 Ga0207652_10525890 Ga0207652_105258902 319
23 3300014325 Ga0163163_10028117 Ga0163163_100281174 326
24 3300031824 Ga0307413_10090358 Ga0307413_100903584 326
25 3300031852 Ga0307410_10221962 Ga0307410_102219622 326
26 3300031911 Ga0307412_10039544 Ga0307412_100395442 326
27 3300031995 Ga0307409_100111882 Ga0307409_1001118821 326
28 3300032004 Ga0307414_10373036 Ga0307414_103730362 326
29 3300048922 Ga0496119_0006524 Ga0496119_0006524_7794_8789 327
30 3300048923 Ga0496120_0029500 Ga0496120_0029500_505_1500 327
31 3300037853 Ga0436364_1553373 Ga0436364_1553373_6715_7743 329
32 3300021388 Ga0213875_10002600 Ga0213875_100026004 331
33 3300021441 Ga0213871_10003678 Ga0213871_100036783 331
34 3300037853 Ga0436364_1248975 Ga0436364_1248975_14317_15393 331
35 3300005436 Ga0070713_100171262 Ga0070713_1001712622 332
36 3300005436 Ga0070713_100273568 Ga0070713_1002735682 332
37 3300005614 Ga0068856_100203757 Ga0068856_1002037573 332
38 3300025928 Ga0207700_10053947 Ga0207700_100539474 332
39 3300025928 Ga0207700_10290197 Ga0207700_102901971 332
40 3300039437 Ga0436365_0373356 Ga0436365_0373356_407_1489 332
41 3300039438 Ga0436360_0357311 Ga0436360_0357311_81_1124 332
42 3300060353 Ga0501082_0461720 Ga0501082_0461720_17_1015 332
43 3300025915 Ga0207693_10113200 Ga0207693_101132002 333
44 3300044712 Ga0453684_0030873 Ga0453684_0030873_1479_2480 333
45 3300005435 Ga0070714_100190345 Ga0070714_1001903453 334
46 3300046460 Ga0495638_0170700 Ga0495638_0170700_168_1196 334
47 3300009093 Ga0105240_10199095 Ga0105240_101990953 335
48 3300010375 Ga0105239_10343513 Ga0105239_103435132 335
49 3300025924 Ga0207694_10000385 Ga0207694_1000038525 335
50 3300028379 Ga0268266_10000520 Ga0268266_1000052019 335
51 3300037312 Ga0395899_0064827 Ga0395899_0064827_1300_2334 335
52 3300037312 Ga0395899_0208196 Ga0395899_0208196_130_1164 335
53 3300037418 Ga0395900_0070138 Ga0395900_0070138_1781_2815 335
54 3300046459 Ga0495629_0140893 Ga0495629_0140893_517_1545 335
55 3300046477 Ga0495664_0205097 Ga0495664_0205097_142_1170 335
56 3300046529 Ga0495652_0338236 Ga0495652_0338236_33_1061 335
57 3300053119 Ga0500595_008231 Ga0500595_008231_1119_2159 335
58 3300003215 JGI25153J46596_10000042 JGI25153J46596_1000004277 336
59 3300005844 Ga0068862_100030468 Ga0068862_1000304682 336
60 3300025297 Ga0209758_1000110 Ga0209758_1000110127 336
61 3300025304 Ga0209257_1039908 Ga0209257_10399081 336
62 3300028380 Ga0268265_10010483 Ga0268265_100104833 336
63 3300031728 Ga0316578_10017454 Ga0316578_100174543 336
64 3300035725 Ga0373947_0148848 Ga0373947_0148848_278_1330 336
65 3300037853 Ga0436364_0984485 Ga0436364_0984485_135_1166 336
66 3300042876 Ga0451577_0059274 Ga0451577_0059274_2257_3273 336
67 3300045051 Ga0451576_0004283 Ga0451576_0004283_17138_18154 336
68 3300049569 Ga0501032_0075938 Ga0501032_0075938_738_1748 336
69 3300049571 Ga0501034_0193574 Ga0501034_0193574_473_1483 336
70 3300049574 Ga0501038_0092314 Ga0501038_0092314_502_1512 336
71 3300049579 Ga0501043_0239571 Ga0501043_0239571_260_1270 336
72 3300049581 Ga0501047_0055101 Ga0501047_0055101_1125_2135 336
73 3300049581 Ga0501047_0232446 Ga0501047_0232446_654_1664 336
74 3300049586 Ga0501070_0133805 Ga0501070_0133805_872_1882 336
75 3300049742 Ga0501080_0092112 Ga0501080_0092112_1540_2550 336
76 3300049742 Ga0501080_0167821 Ga0501080_0167821_476_1486 336
77 3300049823 Ga0501044_0027163 Ga0501044_0027163_422_1432 336
78 3300049823 Ga0501044_0067526 Ga0501044_0067526_2159_3169 336
79 3300053086 Ga0500578_0063019 Ga0500578_0063019_896_1906 336
80 3300053093 Ga0500651_0071902 Ga0500651_0071902_432_1442 336
81 3300053096 Ga0500641_0035558 Ga0500641_0035558_370_1380 336
82 3300053103 Ga0500555_002457 Ga0500555_002457_1854_2864 336
83 3300053119 Ga0500595_002879 Ga0500595_002879_1527_2537 336
84 3300053130 Ga0500642_0012067 Ga0500642_0012067_1175_2185 336
85 3300053130 Ga0500642_0025596 Ga0500642_0025596_435_1445 336
86 3300053151 Ga0500604_0000718 Ga0500604_0000718_496_1506 336
87 3300060353 Ga0501082_0051962 Ga0501082_0051962_1443_2453 336
88 iso_pu_bacteria 2842333319 2842335972 336
89 3300005546 Ga0070696_100049707 Ga0070696_1000497072 337
90 3300005844 Ga0068862_100057921 Ga0068862_1000579213 337
91 3300005981 Ga0081538_10023018 Ga0081538_100230183 337
92 3300009094 Ga0111539_10000097 Ga0111539_1000009761 337
93 3300009094 Ga0111539_10427538 Ga0111539_104275381 337
94 3300009177 Ga0105248_10121017 Ga0105248_101210174 337
95 3300010375 Ga0105239_10068360 Ga0105239_100683603 337
96 3300014326 Ga0157380_10040755 Ga0157380_100407551 337
97 3300014968 Ga0157379_10113373 Ga0157379_101133733 337
98 3300025923 Ga0207681_10114173 Ga0207681_101141733 337
99 3300025937 Ga0207669_10041389 Ga0207669_100413892 337
100 3300025938 Ga0207704_10137353 Ga0207704_101373532 337
101 3300026118 Ga0207675_100006055 Ga0207675_10000605512 337
102 3300027907 Ga0207428_10004460 Ga0207428_100044607 337
103 3300028379 Ga0268266_10077395 Ga0268266_100773951 337
104 3300028380 Ga0268265_10153470 Ga0268265_101534702 337
105 3300028577 Ga0265318_10040260 Ga0265318_100402602 337
106 3300031239 Ga0265328_10001722 Ga0265328_100017228 337
107 3300031250 Ga0265331_10000078 Ga0265331_1000007860 337
108 3300031250 Ga0265331_10006414 Ga0265331_100064147 337
109 3300031251 Ga0265327_10000294 Ga0265327_1000029417 337
110 3300037853 Ga0436364_1033166 Ga0436364_1033166_620_1675 337
111 3300039438 Ga0436360_0845431 Ga0436360_0845431_1649_2734 337
112 3300039447 Ga0436361_0684421 Ga0436361_0684421_5706_6719 337
113 3300039453 Ga0436362_0118689 Ga0436362_0118689_1216_2301 337
114 3300045051 Ga0451576_0001747 Ga0451576_0001747_26047_27075 337
115 3300045051 Ga0451576_0038049 Ga0451576_0038049_3921_4934 337
116 3300045051 Ga0451576_0062280 Ga0451576_0062280_2519_3538 337
117 3300049571 Ga0501034_0093891 Ga0501034_0093891_1874_2893 337
118 3300049581 Ga0501047_0075103 Ga0501047_0075103_136_1155 337
119 3300049823 Ga0501044_0182152 Ga0501044_0182152_136_1155 337
120 3300050507 nmdc:mga05p37_390419_c1 nmdc:mga05p37_390419_c1_511_1530 337
121 3300050511 nmdc:mga08y16_179_c1 nmdc:mga08y16_179_c1_27707_28804 337
122 3300053146 Ga0500588_0000065 Ga0500588_0000065_13873_14922 337
123 3300005440 Ga0070705_100023992 Ga0070705_1000239923 338
124 3300005444 Ga0070694_100111971 Ga0070694_1001119711 338
125 3300005545 Ga0070695_100009217 Ga0070695_1000092174 338
126 3300009545 Ga0105237_10497059 Ga0105237_104970591 338
127 3300013104 Ga0157370_10080294 Ga0157370_100802942 338
128 3300021388 Ga0213875_10006278 Ga0213875_100062786 338
129 3300025254 Ga0209148_1001490 Ga0209148_100149010 338
130 3300025272 Ga0209455_1000564 Ga0209455_100056416 338
131 3300025292 Ga0209676_1041859 Ga0209676_10418592 338
132 3300025298 Ga0209050_1005607 Ga0209050_10056075 338
133 3300025304 Ga0209257_1000407 Ga0209257_10004071 338
134 3300031456 Ga0307513_10030599 Ga0307513_100305993 338
135 3300031730 Ga0307516_10108813 Ga0307516_101088132 338
136 3300035114 Ga0373939_0023698 Ga0373939_0023698_295_1320 338
137 3300045051 Ga0451576_0103109 Ga0451576_0103109_1140_2213 338
138 3300048088 Ga0495602_0053226 Ga0495602_0053226_373_1431 338
139 3300048929 Ga0496126_0147163 Ga0496126_0147163_834_1892 338
140 3300049569 Ga0501032_0007096 Ga0501032_0007096_6738_7766 338
141 3300049570 Ga0501033_0004526 Ga0501033_0004526_3137_4165 338
142 3300049571 Ga0501034_0205582 Ga0501034_0205582_84_1112 338
143 3300049572 Ga0501036_0011044 Ga0501036_0011044_6254_7282 338
144 3300049574 Ga0501038_0013957 Ga0501038_0013957_2207_3235 338
145 3300049574 Ga0501038_0113720 Ga0501038_0113720_369_1391 338
146 3300049575 Ga0501039_0035521 Ga0501039_0035521_263_1291 338
147 3300049579 Ga0501043_0007821 Ga0501043_0007821_1125_2153 338
148 3300049580 Ga0501046_0039333 Ga0501046_0039333_439_1467 338
149 3300049581 Ga0501047_0156363 Ga0501047_0156363_814_1842 338
150 3300049582 Ga0501048_0042402 Ga0501048_0042402_1036_2064 338
151 3300049583 Ga0501067_0021970 Ga0501067_0021970_1752_2780 338
152 3300049585 Ga0501069_0000207 Ga0501069_0000207_24594_25622 338
153 3300049586 Ga0501070_0004092 Ga0501070_0004092_10589_11617 338
154 3300049588 Ga0501072_0063310 Ga0501072_0063310_322_1350 338
155 3300049589 Ga0501073_0005221 Ga0501073_0005221_7663_8691 338
156 3300049589 Ga0501073_0049368 Ga0501073_0049368_413_1435 338
157 3300049590 Ga0501074_0118391 Ga0501074_0118391_783_1811 338
158 3300049592 Ga0501076_0117441 Ga0501076_0117441_991_2019 338
159 3300049741 Ga0501079_0092415 Ga0501079_0092415_847_1875 338
160 3300049742 Ga0501080_0013536 Ga0501080_0013536_89_1117 338
161 3300049744 Ga0501083_0002752 Ga0501083_0002752_811_1839 338
162 3300049822 Ga0501035_0101503 Ga0501035_0101503_84_1112 338
163 3300049823 Ga0501044_0012656 Ga0501044_0012656_7426_8454 338
164 3300053146 Ga0500588_0005142 Ga0500588_0005142_1390_2412 338
165 3300053153 Ga0500616_0002189 Ga0500616_0002189_350_1372 338
166 3300054114 Ga0501084_0014217 Ga0501084_0014217_4075_5103 338
167 3300060353 Ga0501082_0032880 Ga0501082_0032880_2324_3352 338
168 3300060353 Ga0501082_0053019 Ga0501082_0053019_1838_2860 338
169 3300025949 Ga0207667_10129889 Ga0207667_101298892 339
170 3300035086 Ga0373934_0056393 Ga0373934_0056393_388_1479 339
171 3300036401 Ga0373937_0020766 Ga0373937_0020766_405_1496 339
172 3300037068 Ga0373925_0079379 Ga0373925_0079379_971_2062 339
173 3300037853 Ga0436364_0182519 Ga0436364_0182519_15_1094 339
174 3300039437 Ga0436365_0543366 Ga0436365_0543366_1693_2772 339
175 3300046454 Ga0495592_0060036 Ga0495592_0060036_247_1338 339
176 3300046462 Ga0495651_0049203 Ga0495651_0049203_291_1382 339
177 3300046516 Ga0495628_0019337 Ga0495628_0019337_266_1357 339
178 3300046543 Ga0495645_0082300 Ga0495645_0082300_1172_2263 339
179 3300046559 Ga0495667_0131569 Ga0495667_0131569_291_1382 339
180 3300053077 Ga0495601_0138674 Ga0495601_0138674_248_1339 339
181 3300039438 Ga0436360_0418122 Ga0436360_0418122_2801_3859 340
182 3300039438 Ga0436360_0955694 Ga0436360_0955694_368_1426 340
183 3300005614 Ga0068856_100584404 Ga0068856_1005844041 341
184 3300009093 Ga0105240_10027863 Ga0105240_100278633 341
185 3300021388 Ga0213875_10013437 Ga0213875_100134372 341
186 3300025913 Ga0207695_10037957 Ga0207695_100379575 341
187 3300037853 Ga0436364_0941645 Ga0436364_0941645_2274_3311 341
188 3300039437 Ga0436365_0548662 Ga0436365_0548662_881_1918 341
189 iso_pu_bacteria 2821443989 2821450379 341
190 iso_pu_bacteria 2844533157 2844535911 341
191 3300028800 Ga0265338_10176227 Ga0265338_101762272 342
192 3300039438 Ga0436360_0201103 Ga0436360_0201103_1260_2372 342
193 3300039447 Ga0436361_0320659 Ga0436361_0320659_161_1273 342
194 3300046533 Ga0495640_0012314 Ga0495640_0012314_1711_2964 342
195 3300049574 Ga0501038_0108830 Ga0501038_0108830_960_2072 343
196 3300003187 JGI25151J46595_10000225 JGI25151J46595_1000022553 345
197 3300025284 Ga0209130_1000328 Ga0209130_100032817 345
198 3300025294 Ga0209025_1000224 Ga0209025_1000224130 345
199 3300025297 Ga0209758_1001786 Ga0209758_100178617 345
200 3300025302 Ga0207426_1000151 Ga0207426_1000151164 345
201 3300041997 Ga0439431_0006267 Ga0439431_0006267_690_1751 345
202 3300046512 Ga0495610_0017893 Ga0495610_0017893_991_2049 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

112

361

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jyx-assembly1.cif.gz_G-2 crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica, complex with inorganic phosphate and an unknown ligand 0.9608 24 345
4jyx-assembly2.cif.gz_B crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica, complex with inorganic phosphate and an unknown ligand 0.96 24 343
4jxn-assembly1.cif.gz_A-2 crystal structure of polyprenyl synthase isp_b (target efi-509198) from roseobacter denitrificans 0.9569 23 343
3oyr-assembly1.cif.gz_B crystal structure of polyprenyl synthase from caulobacter crescentus cb15 complexed with calcium and isoprenyl diphosphate 0.9547 20 345
4jyx-assembly6.cif.gz_C crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica, complex with inorganic phosphate and an unknown ligand 0.9512 21 345
ID Description Score Start End Superfamily
af_P0AD57_1_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9621 24 345 1.10.600.10
3oyrB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9547 20 345 1.10.600.10
af_P0AD57_1_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9535 24 345 1.10.600.10
3oyrB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9463 20 345 1.10.600.10
3oyrA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9368 20 343 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A3C1XZI6-F1-model_v4 Octaprenyl diphosphate synthase 0.9825 24 235 GO:0004659
GO:0008299
AF-A0A526RS86-F1-model_v4 Polyprenyl synthetase family protein 0.9816 124 343 GO:0004659
GO:0008299
AF-A0A3S1WN61-F1-model_v4 deleted 0.9774 72 238
AF-A0A2E3KBX0-F1-model_v4 Farnesyltranstransferase 0.9769 29 345 GO:0004659
GO:0008299
AF-A0A3D2GNN7-F1-model_v4 Farnesyltranstransferase 0.9763 20 237 GO:0004659
GO:0008299

Feature Viewer

pLDDT pTM Quality
85.5 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map