F307522

General Info

Members Datasets Scaffolds Average Seq Length
200 154 400 141

Family's Representative Sequence

Representative Sequence 3300042004|Ga0439445_0005274|Ga0439445_0005274_1632_2159
Length 175
Sequence VLGRRPANLKFFRRAVESARAASSCRHGHQENTMRFMILVRSVPAFDVETQPVADDPAHAAMYAAMAAYHEELARAGVLLDAAGLKPQSAGWRIRYGEGDRRTVIDGPFAEAKELIAGYTLIQVRSREEALEWARRYPNPVGAGQPAEIEVRQLYEVDDFPPGDTTERFKNIGTL

Samples

Sample ID Description Type Environment
1 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
53 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
59 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
62 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
78 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
81 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
84 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
85 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
86 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
87 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
88 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
131 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
132 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
135 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
136 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
137 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
138 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
139 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
140 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
141 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
147 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
148 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
149 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
150 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
151 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
152 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
153 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
154 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.5
Nodule 1.5
Rhizoplane 0
Rhizosphere 77
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439445_0005274 3300042004 Bacteria 2943
2 JGI25153J46596_10000138 3300003215 Bacteria 75653
3 rootH1_10007643 3300003323 Bacteria 1893
4 Ga0065704_10319540 3300005289 Bacteria 855
5 Ga0065704_10438769 3300005289 Archaea 714
6 Ga0065707_10369454 3300005295 Bacteria 892
7 Ga0070675_100425103 3300005354 Bacteria 1188
8 Ga0070714_100838394 3300005435 Bacteria 891
9 Ga0070678_101823263 3300005456 Bacteria 574
10 Ga0068867_100816151 3300005459 Bacteria 833
11 Ga0070679_101985170 3300005530 Unclassified 531
12 Ga0068859_100750146 3300005617 Bacteria 1065
13 Ga0068862_100048224 3300005844 Bacteria 3636
14 Ga0081455_10274870 3300005937 Unclassified 1220
15 Ga0075365_10010740 3300006038 Bacteria 5350
16 Ga0075365_10046994 3300006038 Bacteria 2836
17 Ga0075365_10278737 3300006038 Bacteria 1176
18 Ga0070716_100028935 3300006173 Bacteria 2990
19 Ga0070712_100079502 3300006175 Bacteria 2370
20 Ga0075362_10056269 3300006177 Bacteria 1770
21 Ga0075367_10635138 3300006178 Bacteria 679
22 Ga0075370_10608996 3300006353 Bacteria 662
23 Ga0075430_100148685 3300006846 Bacteria 1950
24 Ga0075434_100130213 3300006871 Bacteria 2534
25 Ga0068865_100157082 3300006881 Bacteria 1731
26 Ga0097620_100750125 3300006931 Bacteria 1065
27 Ga0075435_100018843 3300007076 Bacteria 5259
28 Ga0111539_10141906 3300009094 Unclassified 2812
29 Ga0105245_11859913 3300009098 Bacteria 655
30 Ga0105242_10102568 3300009176 Bacteria 2426
31 Ga0105248_11603533 3300009177 Bacteria 737
32 Ga0105033_109510 3300009986 Bacteria 851
33 Ga0157378_10006240 3300013297 Bacteria 10437
34 Ga0157375_10038231 3300013308 Bacteria 4607
35 Ga0213872_10065170 3300021361 Bacteria 1645
36 Ga0209673_1064663 3300025273 Bacteria 896
37 Ga0209758_1000028 3300025297 Bacteria 530102
38 Ga0209758_1052161 3300025297 Bacteria 1417
39 Ga0209257_1022139 3300025304 Bacteria 2278
40 Ga0207642_10208223 3300025899 Bacteria 1085
41 Ga0207693_10017013 3300025915 Bacteria 5806
42 Ga0207652_11619480 3300025921 Unclassified 552
43 Ga0207659_10907145 3300025926 Bacteria 758
44 Ga0207687_11424633 3300025927 Bacteria 595
45 Ga0207686_10658254 3300025934 Bacteria 829
46 Ga0207704_10033830 3300025938 Bacteria 2911
47 Ga0207665_10222528 3300025939 Unclassified 1384
48 Ga0207641_11020100 3300026088 Bacteria 824
49 Ga0207674_11617868 3300026116 Bacteria 616
50 Ga0268266_10256968 3300028379 Bacteria 1618
51 Ga0268265_10007642 3300028380 Bacteria 7294
52 Ga0307517_10157030 3300028786 Bacteria 1540
53 Ga0307406_10069718 3300031901 Bacteria 2300
54 Ga0307412_10152063 3300031911 Bacteria 1709
55 Ga0307414_10679904 3300032004 Bacteria 930
56 Ga0373954_0177544 3300035118 Bacteria 1044
57 Ga0373937_0302966 3300036401 Bacteria 1511
58 Ga0395900_0041719 3300037418 Bacteria 4729
59 Ga0395898_0041268 3300037466 Bacteria 4558
60 Ga0395898_0275301 3300037466 Bacteria 1605
61 Ga0395905_0028389 3300037471 Bacteria 5275
62 Ga0395905_0259751 3300037471 Bacteria 1622
63 Ga0395905_0343800 3300037471 Bacteria 1383
64 Ga0395905_1230896 3300037471 Bacteria 652
65 Ga0395901_0053240 3300038443 Bacteria 4205
66 Ga0395901_0223481 3300038443 Bacteria 1968
67 Ga0436360_0614126 3300039438 Bacteria 1956
68 Ga0436361_0420662 3300039447 Bacteria 621
69 Ga0439462_0002681 3300042015 Bacteria 4181
70 Ga0450911_000232 3300042115 Bacteria 21434
71 Ga0439458_0028651 3300042157 Bacteria 1319
72 Ga0466969_0073628 3300044656 Bacteria 1639
73 Ga0453683_0644545 3300044673 Bacteria 692
74 Ga0466965_0492573 3300044683 Bacteria 687
75 Ga0466966_0433481 3300044684 Bacteria 790
76 Ga0466961_0306709 3300044693 Bacteria 969
77 Ga0453684_0802673 3300044712 Bacteria 1015
78 Ga0466971_0081406 3300044719 Bacteria 1477
79 Ga0466971_0390695 3300044719 Bacteria 677
80 Ga0466957_0090746 3300044842 Bacteria 1914
81 Ga0466959_0409626 3300045049 Bacteria 921
82 Ga0466959_0865011 3300045049 Bacteria 603
83 Ga0451576_1074736 3300045051 Unclassified 842
84 Ga0451576_1652774 3300045051 Bacteria 664
85 Ga0466967_0513301 3300045976 Bacteria 1177
86 Ga0495650_0254852 3300046471 Bacteria 596
87 Ga0495580_0023035 3300046472 Bacteria 4578
88 Ga0495582_0000242 3300046473 Bacteria 30326
89 Ga0495663_0037396 3300046525 Bacteria 1464
90 Ga0495633_0048594 3300046558 Bacteria 2003
91 Ga0495656_0103708 3300046615 Bacteria 1319
92 Ga0495661_0606353 3300046665 Bacteria 514
93 Ga0495647_0176042 3300046681 Bacteria 929
94 Ga0495658_0086767 3300046683 Unclassified 1847
95 Ga0495669_0138352 3300046684 Bacteria 1149
96 Ga0495677_0023025 3300047445 Bacteria 2261
97 Ga0495685_051181 3300047447 Bacteria 1401
98 Ga0495615_0008406 3300048090 Bacteria 1993
99 Ga0496122_0557663 3300048925 Bacteria 544
100 Ga0496125_0013191 3300048928 Bacteria 8140
101 Ga0496125_0014607 3300048928 Bacteria 7638
102 Ga0496125_0018023 3300048928 Bacteria 6712
103 Ga0496126_0328356 3300048929 Bacteria 1256
104 Ga0496126_0684662 3300048929 Bacteria 799
105 Ga0501031_0016271 3300049568 Bacteria 4831
106 Ga0501033_0119427 3300049570 Bacteria 1914
107 Ga0501033_0259715 3300049570 Bacteria 1230
108 Ga0501033_0569943 3300049570 Bacteria 779
109 Ga0501034_0156034 3300049571 Bacteria 2256
110 Ga0501034_0266256 3300049571 Bacteria 1656
111 Ga0501034_0364056 3300049571 Bacteria 1373
112 Ga0501034_1363236 3300049571 Bacteria 585
113 Ga0501036_0000740 3300049572 Bacteria 24134
114 Ga0501037_0026915 3300049573 Bacteria 4248
115 Ga0501038_0002850 3300049574 Bacteria 16098
116 Ga0501038_0466236 3300049574 Bacteria 970
117 Ga0501039_0003121 3300049575 Bacteria 12389
118 Ga0501040_0051187 3300049576 Bacteria 2825
119 Ga0501041_0000154 3300049577 Bacteria 30297
120 Ga0501042_0003231 3300049578 Bacteria 10188
121 Ga0501043_0090198 3300049579 Bacteria 2410
122 Ga0501043_0116269 3300049579 Bacteria 2099
123 Ga0501046_0148562 3300049580 Bacteria 1769
124 Ga0501046_0303318 3300049580 Bacteria 1166
125 Ga0501046_0671505 3300049580 Bacteria 731
126 Ga0501047_0053759 3300049581 Bacteria 3895
127 Ga0501047_0066763 3300049581 Bacteria 3468
128 Ga0501048_0004793 3300049582 Bacteria 10308
129 Ga0501068_0012459 3300049584 Bacteria 4824
130 Ga0501068_0054789 3300049584 Bacteria 2416
131 Ga0501068_0415696 3300049584 Bacteria 868
132 Ga0501069_0020517 3300049585 Bacteria 3581
133 Ga0501069_0040887 3300049585 Bacteria 2562
134 Ga0501070_1246549 3300049586 Bacteria 569
135 Ga0501071_0000173 3300049587 Bacteria 28262
136 Ga0501072_0003649 3300049588 Bacteria 11590
137 Ga0501073_0011469 3300049589 Bacteria 6482
138 Ga0501074_0022180 3300049590 Bacteria 4613
139 Ga0501075_0006614 3300049591 Bacteria 7987
140 Ga0501075_1048763 3300049591 Bacteria 619
141 Ga0501076_0002854 3300049592 Bacteria 11953
142 Ga0501076_0218557 3300049592 Bacteria 1558
143 Ga0501076_0418587 3300049592 Bacteria 1102
144 Ga0501076_0860786 3300049592 Bacteria 747
145 Ga0501077_0005576 3300049593 Bacteria 7663
146 Ga0501079_0003115 3300049741 Bacteria 12153
147 Ga0501079_0166527 3300049741 Bacteria 1719
148 Ga0501080_0003817 3300049742 Bacteria 13318
149 Ga0501080_0083952 3300049742 Bacteria 2959
150 Ga0501080_0167459 3300049742 Bacteria 2027
151 Ga0501081_0163552 3300049743 Bacteria 1604
152 Ga0501083_0000755 3300049744 Bacteria 21112
153 Ga0501083_0071696 3300049744 Bacteria 2303
154 Ga0501083_0163287 3300049744 Bacteria 1457
155 Ga0501035_0005442 3300049822 Bacteria 12042
156 Ga0501035_0166949 3300049822 Bacteria 1903
157 Ga0501044_0045723 3300049823 Bacteria 4535
158 Ga0501045_0000153 3300049824 Bacteria 36957
159 nmdc:mga03683_241513_c1 3300050489 Bacteria 837
160 nmdc:mga0yw44_42035_c1 3300050492 Bacteria 2724
161 nmdc:mga0k408_218638_c1 3300050493 Bacteria 1137
162 nmdc:mga0k408_72285_c1 3300050493 Bacteria 2014
163 nmdc:mga06z11_253645_c1 3300050494 Bacteria 1036
164 nmdc:mga06z11_731756_c1 3300050494 Bacteria 603
165 nmdc:mga07m45_672789_c1 3300050496 Bacteria 596
166 nmdc:mga0qj67_47040_c1 3300050509 Bacteria 3407
167 nmdc:mga06r32_1798995_c1 3300050510 Bacteria 548
168 nmdc:mga0n895_51694_c1 3300050512 Bacteria 4031
169 nmdc:mga0rr50_13741_c1 3300050513 Bacteria 5285
170 nmdc:mga0rr50_973234_c1 3300050513 Unclassified 723
171 Ga0500646_0013336 3300053090 Bacteria 2126
172 Ga0500650_0281682 3300053098 Bacteria 739
173 Ga0500642_0000891 3300053130 Bacteria 8700
174 Ga0500658_0113790 3300053134 Bacteria 1193
175 Ga0500568_0020359 3300053139 Bacteria 2870
176 Ga0500568_0057855 3300053139 Bacteria 1507
177 Ga0500577_0146132 3300053142 Bacteria 1000
178 Ga0500588_0026201 3300053146 Bacteria 1628
179 Ga0500604_0087196 3300053151 Bacteria 1015
180 Ga0500634_0232987 3300053161 Unclassified 780
181 Ga0500609_006611 3300053731 Bacteria 1578
182 Ga0500656_013317 3300053732 Bacteria 940
183 Ga0500599_002644 3300053736 Bacteria 2161
184 Ga0501084_0011003 3300054114 Bacteria 7494
185 Ga0501084_0029072 3300054114 Bacteria 4622
186 Ga0501084_0143644 3300054114 Bacteria 2010
187 Ga0501084_0874220 3300054114 Bacteria 756
188 Ga0501082_0002472 3300060353 Bacteria 16208
189 Ga0501082_0012022 3300060353 Bacteria 7444
190 Ga0466962_0234982 3300061719 Bacteria 899
191 Ga0530510_0182899 3300061734 Bacteria 1554
192 2501085460 2501025502 Bacteria 9641094
193 2501409253 2501025504 Bacteria 8008976
194 2511090880 2510917013 Bacteria 9951648
195 2511098814 2510917014 Bacteria 8296963
196 2513555424 2513237082 Bacteria 8640282
197 2513562699 2513237083 Bacteria 8410967
198 2516020854 2515154189 Bacteria 9629850
199 2883092333 2883087390 Bacteria 9532701
200 8003959902 8003955200 Bacteria 8601927
201 Ga0439445_0005274
202 JGI25153J46596_10000138
203 rootH1_10007643
204 Ga0065704_10319540
205 Ga0065704_10438769
206 Ga0065707_10369454
207 Ga0070675_100425103
208 Ga0070714_100838394
209 Ga0070678_101823263
210 Ga0068867_100816151
211 Ga0070679_101985170
212 Ga0068859_100750146
213 Ga0068862_100048224
214 Ga0081455_10274870
215 Ga0075365_10010740
216 Ga0075365_10046994
217 Ga0075365_10278737
218 Ga0070716_100028935
219 Ga0070712_100079502
220 Ga0075362_10056269
221 Ga0075367_10635138
222 Ga0075370_10608996
223 Ga0075430_100148685
224 Ga0075434_100130213
225 Ga0068865_100157082
226 Ga0097620_100750125
227 Ga0075435_100018843
228 Ga0111539_10141906
229 Ga0105245_11859913
230 Ga0105242_10102568
231 Ga0105248_11603533
232 Ga0105033_109510
233 Ga0157378_10006240
234 Ga0157375_10038231
235 Ga0213872_10065170
236 Ga0209673_1064663
237 Ga0209758_1000028
238 Ga0209758_1052161
239 Ga0209257_1022139
240 Ga0207642_10208223
241 Ga0207693_10017013
242 Ga0207652_11619480
243 Ga0207659_10907145
244 Ga0207687_11424633
245 Ga0207686_10658254
246 Ga0207704_10033830
247 Ga0207665_10222528
248 Ga0207641_11020100
249 Ga0207674_11617868
250 Ga0268266_10256968
251 Ga0268265_10007642
252 Ga0307517_10157030
253 Ga0307406_10069718
254 Ga0307412_10152063
255 Ga0307414_10679904
256 Ga0373954_0177544
257 Ga0373937_0302966
258 Ga0395900_0041719
259 Ga0395898_0041268
260 Ga0395898_0275301
261 Ga0395905_0028389
262 Ga0395905_0259751
263 Ga0395905_0343800
264 Ga0395905_1230896
265 Ga0395901_0053240
266 Ga0395901_0223481
267 Ga0436360_0614126
268 Ga0436361_0420662
269 Ga0439462_0002681
270 Ga0450911_000232
271 Ga0439458_0028651
272 Ga0466969_0073628
273 Ga0453683_0644545
274 Ga0466965_0492573
275 Ga0466966_0433481
276 Ga0466961_0306709
277 Ga0453684_0802673
278 Ga0466971_0081406
279 Ga0466971_0390695
280 Ga0466957_0090746
281 Ga0466959_0409626
282 Ga0466959_0865011
283 Ga0451576_1074736
284 Ga0451576_1652774
285 Ga0466967_0513301
286 Ga0495650_0254852
287 Ga0495580_0023035
288 Ga0495582_0000242
289 Ga0495663_0037396
290 Ga0495633_0048594
291 Ga0495656_0103708
292 Ga0495661_0606353
293 Ga0495647_0176042
294 Ga0495658_0086767
295 Ga0495669_0138352
296 Ga0495677_0023025
297 Ga0495685_051181
298 Ga0495615_0008406
299 Ga0496122_0557663
300 Ga0496125_0013191
301 Ga0496125_0014607
302 Ga0496125_0018023
303 Ga0496126_0328356
304 Ga0496126_0684662
305 Ga0501031_0016271
306 Ga0501033_0119427
307 Ga0501033_0259715
308 Ga0501033_0569943
309 Ga0501034_0156034
310 Ga0501034_0266256
311 Ga0501034_0364056
312 Ga0501034_1363236
313 Ga0501036_0000740
314 Ga0501037_0026915
315 Ga0501038_0002850
316 Ga0501038_0466236
317 Ga0501039_0003121
318 Ga0501040_0051187
319 Ga0501041_0000154
320 Ga0501042_0003231
321 Ga0501043_0090198
322 Ga0501043_0116269
323 Ga0501046_0148562
324 Ga0501046_0303318
325 Ga0501046_0671505
326 Ga0501047_0053759
327 Ga0501047_0066763
328 Ga0501048_0004793
329 Ga0501068_0012459
330 Ga0501068_0054789
331 Ga0501068_0415696
332 Ga0501069_0020517
333 Ga0501069_0040887
334 Ga0501070_1246549
335 Ga0501071_0000173
336 Ga0501072_0003649
337 Ga0501073_0011469
338 Ga0501074_0022180
339 Ga0501075_0006614
340 Ga0501075_1048763
341 Ga0501076_0002854
342 Ga0501076_0218557
343 Ga0501076_0418587
344 Ga0501076_0860786
345 Ga0501077_0005576
346 Ga0501079_0003115
347 Ga0501079_0166527
348 Ga0501080_0003817
349 Ga0501080_0083952
350 Ga0501080_0167459
351 Ga0501081_0163552
352 Ga0501083_0000755
353 Ga0501083_0071696
354 Ga0501083_0163287
355 Ga0501035_0005442
356 Ga0501035_0166949
357 Ga0501044_0045723
358 Ga0501045_0000153
359 nmdc:mga03683_241513_c1
360 nmdc:mga0yw44_42035_c1
361 nmdc:mga0k408_218638_c1
362 nmdc:mga0k408_72285_c1
363 nmdc:mga06z11_253645_c1
364 nmdc:mga06z11_731756_c1
365 nmdc:mga07m45_672789_c1
366 nmdc:mga0qj67_47040_c1
367 nmdc:mga06r32_1798995_c1
368 nmdc:mga0n895_51694_c1
369 nmdc:mga0rr50_13741_c1
370 nmdc:mga0rr50_973234_c1
371 Ga0500646_0013336
372 Ga0500650_0281682
373 Ga0500642_0000891
374 Ga0500658_0113790
375 Ga0500568_0020359
376 Ga0500568_0057855
377 Ga0500577_0146132
378 Ga0500588_0026201
379 Ga0500604_0087196
380 Ga0500634_0232987
381 Ga0500609_006611
382 Ga0500656_013317
383 Ga0500599_002644
384 Ga0501084_0011003
385 Ga0501084_0029072
386 Ga0501084_0143644
387 Ga0501084_0874220
388 Ga0501082_0002472
389 Ga0501082_0012022
390 Ga0466962_0234982
391 Ga0530510_0182899
392 2501085460
393 2501409253
394 2511090880
395 2511098814
396 2513555424
397 2513562699
398 2516020854
399 2883092333
400 8003959902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

34

155

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7426 1 117
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6971 1 117
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6793 1 117
5h1p-assembly1.cif.gz_A crispr-associated protein 0.655 1 117
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6413 1 117
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7426 1 117 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6971 1 117 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6854 1 117 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6561 1 117 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6397 1 117 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A127JSV1-F1-model_v4 Dehydrogenase 0.9095 1 137
AF-A0A7W1SK36-F1-model_v4 YciI family protein 0.9009 1 143
AF-A0A366GCQ1-F1-model_v4 deleted 0.8983 1 135
AF-A0A4Q3LMQ4-F1-model_v4 YciI family protein 0.8955 1 138
AF-A0A7W1SK36-F1-model_v4 YciI family protein 0.8948 1 143

Map